(data stored in SCRATCH3701 zone)

EMBL: CP001721

ID   CP001721; SV 1; circular; genomic DNA; STD; PRO; 1543805 BP.
XX
AC   CP001721; ABTD01000000-ABTD01000001;
XX
PR   Project:PRJNA29401;
XX
DT   11-SEP-2009 (Rel. 102, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Atopobium parvulum DSM 20469, complete genome.
XX
KW   .
XX
OS   Atopobium parvulum DSM 20469
OC   Bacteria; Actinobacteria; Coriobacteriia; Coriobacteriales; Atopobiaceae;
OC   Atopobium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1543805
RX   DOI; 10.4056/sigs.29547.
RX   PUBMED; 21304653.
RA   Copeland A., Sikorski J., Lapidus A., Nolan M., Del Rio T.G., Lucas S.,
RA   Chen F., Tice H., Pitluck S., Cheng J.F., Pukall R., Chertkov O.,
RA   Brettin T., Han C., Detter J.C., Kuske C., Bruce D., Goodwin L.,
RA   Ivanova N., Mavromatis K., Mikhailova N., Chen A., Palaniappan K.,
RA   Chain P., Rohde M., Goker M., Bristow J., Eisen J.A., Markowitz V.,
RA   Hugenholtz P., Kyrpides N.C., Klenk H.P., Detter J.C.;
RT   "Complete genome sequence of Atopobium parvulum type strain (IPP 1246)";
RL   Stand Genomic Sci 1(2):166-173(2009).
XX
RN   [2]
RP   1-1543805
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Pukall R., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Atopobium parvulum DSM 20469";
RL   Unpublished.
XX
RN   [3]
RP   1-1543805
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Pukall R., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (01-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0f4ef6a6b89c6c8da5cf3c4be3de4d7d.
DR   BioSample; SAMN00001907.
DR   CABRI; DSM 20469.
DR   EnsemblGenomes-Gn; Apar_R0001.
DR   EnsemblGenomes-Gn; Apar_R0002.
DR   EnsemblGenomes-Gn; Apar_R0003.
DR   EnsemblGenomes-Gn; Apar_R0004.
DR   EnsemblGenomes-Gn; Apar_R0005.
DR   EnsemblGenomes-Gn; Apar_R0006.
DR   EnsemblGenomes-Gn; Apar_R0007.
DR   EnsemblGenomes-Gn; Apar_R0008.
DR   EnsemblGenomes-Gn; Apar_R0009.
DR   EnsemblGenomes-Gn; Apar_R0010.
DR   EnsemblGenomes-Gn; Apar_R0011.
DR   EnsemblGenomes-Gn; Apar_R0012.
DR   EnsemblGenomes-Gn; Apar_R0013.
DR   EnsemblGenomes-Gn; Apar_R0014.
DR   EnsemblGenomes-Gn; Apar_R0015.
DR   EnsemblGenomes-Gn; Apar_R0016.
DR   EnsemblGenomes-Gn; Apar_R0017.
DR   EnsemblGenomes-Gn; Apar_R0018.
DR   EnsemblGenomes-Gn; Apar_R0019.
DR   EnsemblGenomes-Gn; Apar_R0020.
DR   EnsemblGenomes-Gn; Apar_R0021.
DR   EnsemblGenomes-Gn; Apar_R0022.
DR   EnsemblGenomes-Gn; Apar_R0023.
DR   EnsemblGenomes-Gn; Apar_R0024.
DR   EnsemblGenomes-Gn; Apar_R0025.
DR   EnsemblGenomes-Gn; Apar_R0026.
DR   EnsemblGenomes-Gn; Apar_R0027.
DR   EnsemblGenomes-Gn; Apar_R0028.
DR   EnsemblGenomes-Gn; Apar_R0029.
DR   EnsemblGenomes-Gn; Apar_R0030.
DR   EnsemblGenomes-Gn; Apar_R0031.
DR   EnsemblGenomes-Gn; Apar_R0032.
DR   EnsemblGenomes-Gn; Apar_R0033.
DR   EnsemblGenomes-Gn; Apar_R0034.
DR   EnsemblGenomes-Gn; Apar_R0035.
DR   EnsemblGenomes-Gn; Apar_R0036.
DR   EnsemblGenomes-Gn; Apar_R0037.
DR   EnsemblGenomes-Gn; Apar_R0038.
DR   EnsemblGenomes-Gn; Apar_R0039.
DR   EnsemblGenomes-Gn; Apar_R0040.
DR   EnsemblGenomes-Gn; Apar_R0041.
DR   EnsemblGenomes-Gn; Apar_R0042.
DR   EnsemblGenomes-Gn; Apar_R0043.
DR   EnsemblGenomes-Gn; Apar_R0044.
DR   EnsemblGenomes-Gn; Apar_R0045.
DR   EnsemblGenomes-Gn; Apar_R0046.
DR   EnsemblGenomes-Gn; Apar_R0047.
DR   EnsemblGenomes-Gn; Apar_R0048.
DR   EnsemblGenomes-Gn; Apar_R0049.
DR   EnsemblGenomes-Gn; Apar_R0050.
DR   EnsemblGenomes-Gn; Apar_R0051.
DR   EnsemblGenomes-Gn; Apar_R0052.
DR   EnsemblGenomes-Gn; Apar_R0053.
DR   EnsemblGenomes-Gn; EBG00001212894.
DR   EnsemblGenomes-Gn; EBG00001212895.
DR   EnsemblGenomes-Gn; EBG00001212896.
DR   EnsemblGenomes-Gn; EBG00001212897.
DR   EnsemblGenomes-Gn; EBG00001212898.
DR   EnsemblGenomes-Gn; EBG00001212899.
DR   EnsemblGenomes-Gn; EBG00001212900.
DR   EnsemblGenomes-Gn; EBG00001212901.
DR   EnsemblGenomes-Gn; EBG00001212902.
DR   EnsemblGenomes-Gn; EBG00001212903.
DR   EnsemblGenomes-Gn; EBG00001212904.
DR   EnsemblGenomes-Gn; EBG00001212905.
DR   EnsemblGenomes-Gn; EBG00001212906.
DR   EnsemblGenomes-Gn; EBG00001212907.
DR   EnsemblGenomes-Gn; EBG00001212908.
DR   EnsemblGenomes-Gn; EBG00001212909.
DR   EnsemblGenomes-Gn; EBG00001212910.
DR   EnsemblGenomes-Gn; EBG00001212911.
DR   EnsemblGenomes-Gn; EBG00001212912.
DR   EnsemblGenomes-Gn; EBG00001212913.
DR   EnsemblGenomes-Gn; EBG00001212914.
DR   EnsemblGenomes-Gn; EBG00001212915.
DR   EnsemblGenomes-Gn; EBG00001212916.
DR   EnsemblGenomes-Gn; EBG00001212917.
DR   EnsemblGenomes-Gn; EBG00001212918.
DR   EnsemblGenomes-Gn; EBG00001212919.
DR   EnsemblGenomes-Gn; EBG00001212920.
DR   EnsemblGenomes-Gn; EBG00001212921.
DR   EnsemblGenomes-Gn; EBG00001212922.
DR   EnsemblGenomes-Gn; EBG00001212923.
DR   EnsemblGenomes-Gn; EBG00001212924.
DR   EnsemblGenomes-Gn; EBG00001212925.
DR   EnsemblGenomes-Gn; EBG00001212926.
DR   EnsemblGenomes-Gn; EBG00001212927.
DR   EnsemblGenomes-Gn; EBG00001212928.
DR   EnsemblGenomes-Gn; EBG00001212929.
DR   EnsemblGenomes-Gn; EBG00001212930.
DR   EnsemblGenomes-Gn; EBG00001212931.
DR   EnsemblGenomes-Gn; EBG00001212932.
DR   EnsemblGenomes-Gn; EBG00001212933.
DR   EnsemblGenomes-Gn; EBG00001212934.
DR   EnsemblGenomes-Gn; EBG00001212935.
DR   EnsemblGenomes-Gn; EBG00001212936.
DR   EnsemblGenomes-Gn; EBG00001212937.
DR   EnsemblGenomes-Gn; EBG00001212938.
DR   EnsemblGenomes-Gn; EBG00001212939.
DR   EnsemblGenomes-Gn; EBG00001212940.
DR   EnsemblGenomes-Gn; EBG00001212941.
DR   EnsemblGenomes-Gn; EBG00001212942.
DR   EnsemblGenomes-Gn; EBG00001212943.
DR   EnsemblGenomes-Gn; EBG00001212944.
DR   EnsemblGenomes-Gn; EBG00001212945.
DR   EnsemblGenomes-Gn; EBG00001212946.
DR   EnsemblGenomes-Tr; Apar_R0001-1.
DR   EnsemblGenomes-Tr; Apar_R0002-1.
DR   EnsemblGenomes-Tr; Apar_R0003-1.
DR   EnsemblGenomes-Tr; Apar_R0004-1.
DR   EnsemblGenomes-Tr; Apar_R0005-1.
DR   EnsemblGenomes-Tr; Apar_R0006-1.
DR   EnsemblGenomes-Tr; Apar_R0007-1.
DR   EnsemblGenomes-Tr; Apar_R0008-1.
DR   EnsemblGenomes-Tr; Apar_R0009-1.
DR   EnsemblGenomes-Tr; Apar_R0010-1.
DR   EnsemblGenomes-Tr; Apar_R0011-1.
DR   EnsemblGenomes-Tr; Apar_R0012-1.
DR   EnsemblGenomes-Tr; Apar_R0013-1.
DR   EnsemblGenomes-Tr; Apar_R0014-1.
DR   EnsemblGenomes-Tr; Apar_R0015-1.
DR   EnsemblGenomes-Tr; Apar_R0016-1.
DR   EnsemblGenomes-Tr; Apar_R0017-1.
DR   EnsemblGenomes-Tr; Apar_R0018-1.
DR   EnsemblGenomes-Tr; Apar_R0019-1.
DR   EnsemblGenomes-Tr; Apar_R0020-1.
DR   EnsemblGenomes-Tr; Apar_R0021-1.
DR   EnsemblGenomes-Tr; Apar_R0022-1.
DR   EnsemblGenomes-Tr; Apar_R0023-1.
DR   EnsemblGenomes-Tr; Apar_R0024-1.
DR   EnsemblGenomes-Tr; Apar_R0025-1.
DR   EnsemblGenomes-Tr; Apar_R0026-1.
DR   EnsemblGenomes-Tr; Apar_R0027-1.
DR   EnsemblGenomes-Tr; Apar_R0028-1.
DR   EnsemblGenomes-Tr; Apar_R0029-1.
DR   EnsemblGenomes-Tr; Apar_R0030-1.
DR   EnsemblGenomes-Tr; Apar_R0031-1.
DR   EnsemblGenomes-Tr; Apar_R0032-1.
DR   EnsemblGenomes-Tr; Apar_R0033-1.
DR   EnsemblGenomes-Tr; Apar_R0034-1.
DR   EnsemblGenomes-Tr; Apar_R0035-1.
DR   EnsemblGenomes-Tr; Apar_R0036-1.
DR   EnsemblGenomes-Tr; Apar_R0037-1.
DR   EnsemblGenomes-Tr; Apar_R0038-1.
DR   EnsemblGenomes-Tr; Apar_R0039-1.
DR   EnsemblGenomes-Tr; Apar_R0040-1.
DR   EnsemblGenomes-Tr; Apar_R0041-1.
DR   EnsemblGenomes-Tr; Apar_R0042-1.
DR   EnsemblGenomes-Tr; Apar_R0043-1.
DR   EnsemblGenomes-Tr; Apar_R0044-1.
DR   EnsemblGenomes-Tr; Apar_R0045-1.
DR   EnsemblGenomes-Tr; Apar_R0046-1.
DR   EnsemblGenomes-Tr; Apar_R0047-1.
DR   EnsemblGenomes-Tr; Apar_R0048-1.
DR   EnsemblGenomes-Tr; Apar_R0049-1.
DR   EnsemblGenomes-Tr; Apar_R0050-1.
DR   EnsemblGenomes-Tr; Apar_R0051-1.
DR   EnsemblGenomes-Tr; Apar_R0052-1.
DR   EnsemblGenomes-Tr; Apar_R0053-1.
DR   EnsemblGenomes-Tr; EBT00001782131.
DR   EnsemblGenomes-Tr; EBT00001782132.
DR   EnsemblGenomes-Tr; EBT00001782133.
DR   EnsemblGenomes-Tr; EBT00001782134.
DR   EnsemblGenomes-Tr; EBT00001782135.
DR   EnsemblGenomes-Tr; EBT00001782136.
DR   EnsemblGenomes-Tr; EBT00001782137.
DR   EnsemblGenomes-Tr; EBT00001782138.
DR   EnsemblGenomes-Tr; EBT00001782139.
DR   EnsemblGenomes-Tr; EBT00001782140.
DR   EnsemblGenomes-Tr; EBT00001782141.
DR   EnsemblGenomes-Tr; EBT00001782142.
DR   EnsemblGenomes-Tr; EBT00001782143.
DR   EnsemblGenomes-Tr; EBT00001782144.
DR   EnsemblGenomes-Tr; EBT00001782145.
DR   EnsemblGenomes-Tr; EBT00001782146.
DR   EnsemblGenomes-Tr; EBT00001782147.
DR   EnsemblGenomes-Tr; EBT00001782148.
DR   EnsemblGenomes-Tr; EBT00001782149.
DR   EnsemblGenomes-Tr; EBT00001782150.
DR   EnsemblGenomes-Tr; EBT00001782151.
DR   EnsemblGenomes-Tr; EBT00001782152.
DR   EnsemblGenomes-Tr; EBT00001782153.
DR   EnsemblGenomes-Tr; EBT00001782154.
DR   EnsemblGenomes-Tr; EBT00001782155.
DR   EnsemblGenomes-Tr; EBT00001782156.
DR   EnsemblGenomes-Tr; EBT00001782157.
DR   EnsemblGenomes-Tr; EBT00001782158.
DR   EnsemblGenomes-Tr; EBT00001782159.
DR   EnsemblGenomes-Tr; EBT00001782160.
DR   EnsemblGenomes-Tr; EBT00001782161.
DR   EnsemblGenomes-Tr; EBT00001782162.
DR   EnsemblGenomes-Tr; EBT00001782163.
DR   EnsemblGenomes-Tr; EBT00001782164.
DR   EnsemblGenomes-Tr; EBT00001782165.
DR   EnsemblGenomes-Tr; EBT00001782166.
DR   EnsemblGenomes-Tr; EBT00001782167.
DR   EnsemblGenomes-Tr; EBT00001782168.
DR   EnsemblGenomes-Tr; EBT00001782169.
DR   EnsemblGenomes-Tr; EBT00001782170.
DR   EnsemblGenomes-Tr; EBT00001782171.
DR   EnsemblGenomes-Tr; EBT00001782172.
DR   EnsemblGenomes-Tr; EBT00001782173.
DR   EnsemblGenomes-Tr; EBT00001782174.
DR   EnsemblGenomes-Tr; EBT00001782175.
DR   EnsemblGenomes-Tr; EBT00001782176.
DR   EnsemblGenomes-Tr; EBT00001782177.
DR   EnsemblGenomes-Tr; EBT00001782178.
DR   EnsemblGenomes-Tr; EBT00001782179.
DR   EnsemblGenomes-Tr; EBT00001782180.
DR   EnsemblGenomes-Tr; EBT00001782181.
DR   EnsemblGenomes-Tr; EBT00001782182.
DR   EnsemblGenomes-Tr; EBT00001782183.
DR   EuropePMC; PMC3165274; 21705529.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001721.
DR   SILVA-SSU; CP001721.
DR   StrainInfo; 214295; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083308
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Atopobium parvulum IPP 1246, DSM 20469
CC   Culture Collection ID :: DSM 20469, ATCC 33793, JCM 10300
CC   GOLD Stamp ID         :: Gi02317
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Gingival crevices of the human oral cavity
CC   Collection Date       :: before 1937
CC   Host Name             :: Homo sapiens
CC   Body Sample Site      :: Oral
CC   Body Sample SubSite   :: Gingival crevices
CC   Oxygen Requirement    :: Obligate anaerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37 - 45C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Host, Human airways, Oral microflora
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1543805
FT                   /organism="Atopobium parvulum DSM 20469"
FT                   /strain="DSM 20469"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Atopobium parvulum"
FT                   /db_xref="taxon:521095"
FT                   /culture_collection="DSM:20469"
FT   gene            250..1116
FT                   /locus_tag="Apar_0001"
FT   CDS_pept        250..1116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0001"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: rpb:RPB_3269 periplasmic sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50441"
FT                   /db_xref="GOA:C8W8K3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV50441.1"
FT                   /translation="MARDFFPFVEENTNQDEKNTDSNNSLTVRYAARIAVYDDKSAAPR
FT                   VVLVEPKDVRSYLDEIAATVNQLAHEQGGKIPFMVMREIVENFIHARFVAPTISIMDNG
FT                   NTIRFSDQGPGIKEKNRALEFGTSSATEEMKSFIRGVGFGLPYAQQYMVEKGGSLTLED
FT                   NISGGTIVTLSTRRSKDAHIQTLPTQEDAEEMTVSQEEQSISRALHTVPQQPVTQLPNL
FT                   VLTDRAKLVLQYLSEHEWVGATELTSAYGLSTPTWSRELKSLVNIGIIGKIGQKYKLTT
FT                   IGETLLS"
FT   gene            1200..2729
FT                   /locus_tag="Apar_0002"
FT   CDS_pept        1200..2729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: wol:WD0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50442"
FT                   /db_xref="GOA:C8W8K4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACV50442.1"
FT                   /translation="MDASIDSDAIALWQDAIDLLVEENQPEAFIAMLRTCTPIKVEDDT
FT                   LYAETSMRLAYNRILKNLPIVERCLSAAAFEDVILSLTLTKSSTPVTTTSTMTPQEFNA
FT                   WKQKTTPIQAVVPEQIQDFESQEQSLEELKQQTLKRRKSNPLYEETSFNSNLTFDRFVV
FT                   GDENELAHQHALNVANDAKGKANPLFIYGASGLGKTHLLRAVQNYINSEDIERVCVYKD
FT                   ADAFVDDYVNAVRKNASGNAATELNNNYQNIDVLIIDDVQKLAGKAGTINFFFNIFNSL
FT                   IDRGKQIILAADRTPAQLGMGSDGFDDRITSRMSGGIVIGIESPSYEMKLNLIHVFCDR
FT                   AFKERNSSLSVDDMPEEISRYMADKAGQSIRTLEGFCNRCVTGQIKAKESGKNIKQEEI
FT                   DKIADTLWRRVSKTVNIEKVQEVVENIYGINHRDIVGNKRNKEIAEPRHVAIYLAHDLC
FT                   QYTLVNIGKHFGGRKHATILHSIEVIEEKIKEDKSFYDQISQLKKTILEQS"
FT   gene            2964..4064
FT                   /locus_tag="Apar_0003"
FT   CDS_pept        2964..4064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gur:Gura_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50443"
FT                   /db_xref="GOA:C8W8K5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACV50443.1"
FT                   /translation="MKFTVSQSALQTALDIVSKGIGSNTTLPILSGIYLKAFNGMLELQ
FT                   SSDLTISIKHQIAANVEEEGETVVSGKVIQNIVKNLPDAAITFEGGERTLSVICQRSSF
FT                   RLNTLSAHDWAQFPEFNLEKTCELPSQLLSTMVDKVYRVTSKEVSRPILQGISLTVEDN
FT                   TIRLVATDSFRLAVCDSNTDTPAGESFSIIISGEVFHDVLSMRSMTEKVLIGTTDNQVI
FT                   FQFGNTTHISRKIEGHFPDYKQLLPTSCTASVDINVEDFSAALKRVSVIALANPSVRFD
FT                   VDADGKEVKLSASSPDQGESSEHIEAQIEGDSLSIALNYHYVFDCVNAAPSKDLLRLEL
FT                   QGPSQPAIFKSNGKVNYLYLLMPVRL"
FT   gene            4080..5171
FT                   /locus_tag="Apar_0004"
FT   CDS_pept        4080..5171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bba:Bd0003 DNA repair and
FT                   genetic recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50444"
FT                   /db_xref="GOA:C8W8K6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K6"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACV50444.1"
FT                   /translation="MGLKVEHVSLYNFRCFASKEIDLSAQTTIFVGKNAAGKTNTVEAL
FT                   QLLTAGYSFRKPTPSQLLLTDTSEAKIEISLTGDGRKLENTCIITERRRQFSKNGKKCQ
FT                   AADISGTLMSILFNPDDLSMIKGGASYRREEFDDFGRQANKSYFKVFSTYIKTVEQRNK
FT                   LLKSDWPDENLLDAWDLSLARGGAILLHARIHLFERLAKKTCEIYQELSGGEHLEMNYI
FT                   SSIGEISLEASREEISDQFLQALNEIRIDDIRRQQSTKGPHRDDVEFLIEGKEARNFGS
FT                   QGQIRTVVLALKMAEVLLSEEILGEKPLLLLDDVMSELDEDRRKAIMEFAFHDIQTVIT
FT                   TTNLGYFSEEILEKAQIVRFSDE"
FT   gene            5164..5697
FT                   /locus_tag="Apar_0005"
FT   CDS_pept        5164..5697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50445"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50445.1"
FT                   /translation="MNNQNEKPVRGGNETAKDLMSSLLGTFKDSKSMSKNRRAYLAWVE
FT                   ANGEREVKHTTGVFVREIAGREYPVLTVYVDNRMCMIDFLAQREVYRARLSEQGLEFSD
FT                   LEFKLDKYNRHAGKGASSSKIQKQGKKIEKKALPELTTEEKSQISELVSSLSEPLKSTA
FT                   YKAIEASFRQKKSL"
FT   gene            5858..7801
FT                   /locus_tag="Apar_0006"
FT   CDS_pept        5858..7801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bsu:BSU00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50446"
FT                   /db_xref="GOA:C8W8K8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACV50446.1"
FT                   /translation="MAKENKYNGTEIKILEGLEAVRKRPGMYIGTTSASGLHHLVWEIV
FT                   DNSVDEAMAGYCSKIKVTIHPDNSISVEDNGRGIPVDLHPQKKIPTLEVVLTILHAGGK
FT                   FDNNAYKVSGGLHGVGVSVVNALSKKLVAQVKRDGKIYEMVFERGKTVQKMKEIGTSKS
FT                   NGTTITFWPDDMIFETTTYNFDTLRDRLQETAFLNKNLKITLVDERELTPRQVDFQYAG
FT                   GIIDFVKYLNDEKTVLPGLSRPIYIEGKSDPDAPMSQMGEVEVAIQWNTDFSDRTLSFA
FT                   NDIFTEEGGMHLEGFRTALTKVVNDYGTRQGILKEKDPKLEGGDIREGLTAVISVKLPD
FT                   PQFEGQTKAKLGSSYMRTLTNKIVTQGLSEYLEEHPNQAKEILKKASQAAKGRLAARKA
FT                   REATRRKGLLESAALPGKLADCSVRDAEMTELFIVEGDSAGGSAKMARDRSIQAVLPLR
FT                   GKILNVERVQAHRALSSDTITSLITAIGTGVGDEFSLEKARYHKIVIMTDADVDGSHIR
FT                   ILLLTFFYRYMKPMIDAGYIYVAQPPLYQIKPKGKKNGKYIYTDEELALETKKFEDNTK
FT                   YTIQRYKGLGEMDPEQLWATTMEPKNRILLKVTIDDALAADRAVSDLMGNQVEKRKDFI
FT                   QTHAKDVRFLDI"
FT   gene            7921..10626
FT                   /locus_tag="Apar_0007"
FT   CDS_pept        7921..10626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gbm:Gbem_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; Bombesin family protein; DNA gyrase repeat beta-
FT                   propeller; SMART: DNA gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50447"
FT                   /db_xref="GOA:C8W8K9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8K9"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACV50447.1"
FT                   /translation="MDEEYEDDEVEEDSDEFDPETGVNLVTGENSHIISDEAGTRLDLS
FT                   DIHGGTLKPTDLSSEMKTSFLEYSMSVIVARALPDVRDGLKPVHRRILYAMSEAGITPN
FT                   RPHKKSAWAVGEVMGKYHPHGDSAIYDSMVRMSQDFSMRLPLIDGHGNFGSIDGDPPAA
FT                   MRYTEARLTRSAMEMLAELNKNTVDLQPNYDESLTEPAVLPARFPNLLVNGSSGIAVGM
FT                   ATNIPPHNLGEVTDAVCMMIDNPEVTTEELMTVLPGPDFPTGGIIMGTQGIKDAYETGR
FT                   GSITVRAKVHVEQVKSGRQRLVVTEIPYQVNKGLLQEKIAQAVNEKKIEGISDMRDESN
FT                   RKGMRIVIDLKRDAVPQVVLNNLYKKTQLQSNFGIIDLALVDGVPRTLSLREILRHYID
FT                   HQIDVVRRRTEFDLDKAQKRVHILEGLLTAVDNIDEIVHIIRSSQDDAEAKKRMNERFG
FT                   LDEIQGEAILQMRLRRLTGLARQDLVDEISQLRLDIAYYEDLLAHEEKILAVIADELRE
FT                   ISNRYADKRRTQISEQDIQNLDVEDLIAEEDMVVTVTHAGYVKRVPVEIYRSQKRGGKG
FT                   VQGVSLKENDFVENLFVASTHDYVLFFTNLGKVYRLKVHELPVGSRTTKGSAIINVIET
FT                   LAEGEKVKAVITTRDFPEDNYLMFATKQGMVKKTAMSEYDRTRKDGLIAINLKDGDELV
FT                   NVRRVHPGDKVVLCSSDGKAILFDEAEARSMGRGTSGVRGITLKGNATMLGMEITNGNG
FT                   DLFVITEKGYGKRTAISEYPVHKRGGQGVFTITMTEKKGNLVACRVVGPQHEIMIMSEE
FT                   GVVIRVKAGDISKLGRSTQGVKVMNLSGSDVVSAVARMVANKKKAPKHAENQGMLDLMS
FT                   AGARDADEAESVDLGDEEEALDDSLLDDDE"
FT   gene            complement(10804..11310)
FT                   /locus_tag="Apar_0008"
FT   CDS_pept        complement(10804..11310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0008"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   sat:SYN_02150 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50448"
FT                   /db_xref="GOA:C8W8L0"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L0"
FT                   /inference="protein motif:PFAM:PF02577"
FT                   /protein_id="ACV50448.1"
FT                   /translation="MSLKRMDIQTVVVGGGPISSVIVLRLHDPRGVSSLSLPIKIGTIE
FT                   ASAISLGIDQESTERPLTHDLLRSVLDSLDADIKSVRIVGVRGTTFFSQIELISKEGEH
FT                   IYVDARPSDAIALAVRTNAPIFADESVLEIAAAPDFTDVEKDVHAQEFEEFRQFIEGVS
FT                   PEDFS"
FT   gene            11464..11540
FT                   /locus_tag="Apar_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11464..11540
FT                   /locus_tag="Apar_R0001"
FT                   /product="tRNA-Ile"
FT   gene            11629..11704
FT                   /locus_tag="Apar_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            11629..11704
FT                   /locus_tag="Apar_R0002"
FT                   /product="tRNA-Ala"
FT   gene            11891..13030
FT                   /locus_tag="Apar_0009"
FT   CDS_pept        11891..13030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0009"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: msu:MS1583 TbpA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50449"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV50449.1"
FT                   /translation="MSNLTRRNFFGVSAVVAGLGISACKKSDSNTGEKKETDTNSADAV
FT                   GAPEELVKAAKEEGKLIVYGSCEEEYLNAVCTNFKSLYGIDVQVQRLSTGEVAAKIEEE
FT                   NGHPSADVWFGGTTDPYNVTSSKGLLEQYEPKNASHLISDKFKSTNKDWYGIYKGILGI
FT                   LYDKEELKRLNLDVPQDYKDLIDPKYKGLIWSSNYNTAGTAKLIINTVIQKYGHDQGIQ
FT                   YLVDLDKNIAQYTKSGSGPSKAIGTGECTIGIGMLHDGIYQIVDQEHENVGLQIPSSGA
FT                   SYEVGATAIFKGAAHPNAAKLWIEYALSPACVDLAQKNGSYQFLVIDNAKQPEIATEYG
FT                   LDPNNVMDYNFEDAKKHTEQYVKDVMEALGGGDSRFKTE"
FT   sig_peptide     11891..11971
FT                   /locus_tag="Apar_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.319 at
FT                   residue 27"
FT   gene            13169..14878
FT                   /locus_tag="Apar_0010"
FT   CDS_pept        13169..14878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0010"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: msu:MS1586 ThiP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50450"
FT                   /db_xref="GOA:C8W8L2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV50450.1"
FT                   /translation="MAKSQSARLERKKLLGDPILITTIVVLIAFLTLFILYPLAILMVD
FT                   SVVSDNGITLDVFTRILSMPSFDRAITNTLRVGFAVGILSALIGLLFAYVEVYVKLRTK
FT                   FMTGLFRVVSMLPVVSPPFVLSLSMIMMFGKKGLITRGLLGIFDNNIYGFWGIFIVQTM
FT                   SFFPVCYMMLKGLLKNIDPSLEEAARDMGASRWKVFTSVTLPLILPGLGNAFLVSFIES
FT                   IADFANPMIIGGSYDTLATTIYLQITGAYDKQGAAAMAVVLLSITLLMFVVQKFVLEAK
FT                   STSTLSGKATRARMLITDNSVRIPLTILCALVALFVIGMYLCVPYGSFVRSWGSNYELT
FT                   TKWFEQVFTKYHGLQAFSDSFMLSLIAAPITALLSMIISYLVVKRRFRFRGFIEAVSML
FT                   AMAVPGTVLGVGYIRGFSSGVMHTGFLQGLYGTGLILIIVFVVRSLPTGTRSGISALRQ
FT                   IDKSIEESAYDMGADSFTVFMTVTLPLIKDSFLSGLVTAFVRSITAISAVILLVTPEFL
FT                   LITVQINEFAGKGSYGMACAFATILIVITYGSVLLMNWAIKHFGTSRALKEE"
FT   gene            14882..15961
FT                   /locus_tag="Apar_0011"
FT   CDS_pept        14882..15961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0011"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: sfu:Sfum_3496
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50451"
FT                   /db_xref="GOA:C8W8L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50451.1"
FT                   /translation="MATEKKGVRLEHISKIYQDQKTGKDFYAVQDANITIDPGEFVTLL
FT                   GPSGCGKTTILRMIAGFESPDEGKIFLGDEQIDELTPNKRDTAMVFQSYALLPHYNIFD
FT                   NVAYGLKLRKMDKAIIREKVLHILDLVGLEGMEERMTNQLSGGQQQRVALARALVIEPS
FT                   VLLFDEPLSNLDAKLRVDMRNEIRRIQQEAGITAIYVTHDQSEAMALSDNIIIMKKGVV
FT                   DQVGDPQTVYYHPADEFVADFIGESNFLHATIAEKLDSETALCRFEGHEFEVSGCSHLD
FT                   KGKECCIVLRPESARLTDEGTLSCEVVLSRFMGHYQNYHVMVGDTLIKITDFNPRTHKV
FT                   YNVGDHAFVDFTKDEVHVL"
FT   gene            complement(16020..17018)
FT                   /locus_tag="Apar_0012"
FT   CDS_pept        complement(16020..17018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0012"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: pat:Patl_0292 LacI family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50452"
FT                   /db_xref="GOA:C8W8L4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L4"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV50452.1"
FT                   /translation="MPKTTIIDLAKLANVSIATVSNYLNGHFEKMSEATKQRIKKAIEN
FT                   TGYIPSAQAQAMVKKSSGIIAVLILDNTNAWAAQMTNGIEDAALEAGYQTIICNSRFDP
FT                   TLEADWVEKMLSIGADGLLIQPTNQFRAVDRRIAKVGKPVVYFDCDLLTFNTSWIKSNL
FT                   YDGVYSAATYCVENGYEDFLIIGGEPKGRTRIEREYGFIDALEASNKPHERLTIEQNTL
FT                   SISDIKQWLNNHIFPSKKTLVFVPNQWALKSVYTALHAYEKAIPEQVGLLGFNNTDWTD
FT                   LPVKSISTIVEPVYEEGYTACKMLLEKIKDSSLEPEHKLLTCKLNWLKSTI"
FT   gene            17270..18705
FT                   /pseudo
FT                   /locus_tag="Apar_0013"
FT   gene            18834..20114
FT                   /locus_tag="Apar_0014"
FT   CDS_pept        18834..20114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asu:Asuc_0588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50453"
FT                   /db_xref="GOA:C8W8L5"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L5"
FT                   /inference="similar to AA sequence:KEGG:Asuc_0588"
FT                   /protein_id="ACV50453.1"
FT                   /translation="MEKLPIKKAVEGLLKLQDTGRSATLLGIGPMSPNLLQAAFELGRD
FT                   CDFPLMFIASRNQVDLDELGGGYVNAWDQKRFSEDIAEAAQKVGFDGLYYLCRDHGGPW
FT                   QRDEERNAHLPEDEAMELAKKSYLADMLNGFDLLMIDPTKDPFEIGKVIPLDVVLRRTV
FT                   DLIEWCEKERVSRGLPEIGYEVGTEETNGGLTSTDKYHTFIEQLKSELTAKGLPMPTFI
FT                   VGQTGTLTRLTEQVGHYDFEAAFSLSKMAKSYGVGLKEHNADYLDDVTLLEHTPANVTA
FT                   SNVAPQYGTEETRAYLKLCDVEDLLVKEGLLKSDEVSGLRNTLLVKAIETERWRKWMVG
FT                   NQVNLTVEQILADHKLSLDILDISGHYAFNDDEVKAATEHLYKNLAQFNIDGQRFVVDH
FT                   IKRPLRQYVECYRLEGVTTRIREALAE"
FT   gene            20261..20719
FT                   /locus_tag="Apar_0015"
FT   CDS_pept        20261..20719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50454"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50454.1"
FT                   /translation="MSENDERKDGVSPELDMLSTELLGDAFDLLADGQSLNVLLVVEDA
FT                   LGTVASYEFSDDGPEELLEGAHKRVLDLVRQKGNKEAGLEEPVRYALVYEGAIQLLKDG
FT                   GYEDAVLLEFGEKGYKSFSAYSLIYGKGQGDQFVWSDPAPAGELEPLL"
FT   gene            20848..22686
FT                   /locus_tag="Apar_0016"
FT   CDS_pept        20848..22686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0016"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; KEGG: sat:SYN_00939 GTP-binding
FT                   protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50455"
FT                   /db_xref="GOA:C8W8L7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L7"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACV50455.1"
FT                   /translation="MRQDNIRNIAIIAHVDHGKTTMVDQMLKATDAFRENQQVQERILD
FT                   SNDQERERGITILAKNISIEYKGVKINVIDTPGHADFGGEVERVLKMADGALLLVDAAE
FT                   GPMPQTRFVLRHAIDAGLSIMMVVNKIDRDGARPEAVVNDSLDLMMDLGATDEQLEFTM
FT                   EHVVFASGVNGYARLDPNDGNDNMFPLLDMIIDGLPAPDVDIDGSLAMQCVTIDHSDYL
FT                   GRIGIGRVYSGTVHTGDKILVVKNDGSRAMSQVKQLFTFDYLGRKECSEVDAGDIAAIV
FT                   GVDNTDIGDVYTDPENPVELDPIEIDPPTLSIIFEPSTSPLVGREGDIVGGRQLKERLM
FT                   TERENNVTMRIEELPDKTGIEVSGRGILHLSVLMESMRREGFEFQVGRPRVLFKKDAQG
FT                   HTLEPIEQAVVECNPEYAGKVIEVFGNVGGTMSIMDTGETQTHLEFKIPTRGIMGLKTR
FT                   VMNVTHGDAVFYHTFLEYGPFAGDIGSRQNGAMISMSTEKAVAYALGTLQERGQLFVSP
FT                   GVECYEGMLVGERSRPGDMVVNIARTKSLGNQRSSTADISVQLTPPRLFTLEEALEYIM
FT                   DDELVEITPLNIRMRKRILSETERRKWAVRNGMVKK"
FT   gene            complement(22832..23575)
FT                   /locus_tag="Apar_0017"
FT   CDS_pept        complement(22832..23575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0017"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   ecq:ECED1_0164 conserved hypothetical protein; putative
FT                   inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50456"
FT                   /db_xref="GOA:C8W8L8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L8"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ACV50456.1"
FT                   /translation="MPPFFSPYGIDAISVSIPYWLDLLTVIIGAISGILVARDRHLDLV
FT                   GFVGLGLLGGLGGGLIRDTMMQQGGVYMLNSPYAIPAAVFTAVLLFMFPEPLDRFPRML
FT                   EWTDIISVGLFAVVGTDKALVYHLLPFSVILMGSITGVGGGMLRDVFLGDIPRIFQRSN
FT                   LYAFCAVAGTTSYWALVSYVGVTKIWAAIICVAITVGLRRWSLKFNVLSPADVDLTPHV
FT                   MRSVNKLRRKAHKPGKQPKNNISSK"
FT   gene            23703..23793
FT                   /locus_tag="Apar_R0003"
FT                   /note="tRNA-Ser1"
FT   tRNA            23703..23793
FT                   /locus_tag="Apar_R0003"
FT                   /product="tRNA-Ser"
FT   gene            23832..23922
FT                   /locus_tag="Apar_R0004"
FT                   /note="tRNA-Ser2"
FT   tRNA            23832..23922
FT                   /locus_tag="Apar_R0004"
FT                   /product="tRNA-Ser"
FT   gene            24040..25455
FT                   /locus_tag="Apar_0018"
FT   CDS_pept        24040..25455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50457"
FT                   /db_xref="GOA:C8W8L9"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50457.1"
FT                   /translation="MAVSADELNGYRRDRYFARSWALLTMEKGWWKPVLIMALFGLIPI
FT                   VGILALVGYALETARVTAWGINAGPKQKDLKFGTYIATGFKAAVIALAFGLAYSIAFTI
FT                   LAFIPVVNLILIPIFIVVAFVYPLLINVIQVRAAVYGRISAGFAFKNIFEMIKHDVGGL
FT                   FRIFGMGIVLAIVTSIIMGIIGGSAAISMIVNVVTQAIAIAKTQNITSESQLIVIMVAL
FT                   LARGVLQMGPIFLAIGYIGHVLGLIVMLLMQNAIALWMRQYNVSAWGQSNDPLPPFIND
FT                   PRDGAAAAYSAPSPVAPTAPVATAAPAVAPVAVPVTASATTVAPEVPGAAPVPAAPAAP
FT                   VEPVAAPAPTAPVAPAAPVAPAAPAAPAAPVAPAEPTAPVAPTSPAAPVAPAAPAAPAT
FT                   PAAPASPAAPVAPVAPATPVVPEAPVAPAALEPAPASTIVVEPVIPVTPETPEAPAAPE
FT                   DASTQNPEEPAAQ"
FT   gene            25759..26052
FT                   /locus_tag="Apar_0019"
FT   CDS_pept        25759..26052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0019"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: bcr:BCAH187_A5662 ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50458"
FT                   /db_xref="GOA:C8W8M0"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M0"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACV50458.1"
FT                   /translation="MKAYELLFFVDPASTEEVRAGVMKRIDVAITADGGVVDSVEDWGK
FT                   RKLAFEIDDLTEGDYTLINFHADPTQIAELDRVLRINDAVKRHMIVRRVDKD"
FT   gene            26105..26557
FT                   /locus_tag="Apar_0020"
FT   CDS_pept        26105..26557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0020"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: nis:NIS_1165 single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50459"
FT                   /db_xref="GOA:C8W8M1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M1"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACV50459.1"
FT                   /translation="MSINRVNISGNLTRDPELRSTAGGTQILSFGVAVNDRRRNQQTGE
FT                   WEDVPNFIDCVVFGQRAEALSRFLSKGSKVAIEGKLRFSSWETKEGQRRSKLEVVVDEV
FT                   EFLSRNQQGGAPTSQGAPSYAAPTPQAPAPVPAPPDEEFYDADIPF"
FT   gene            26606..26878
FT                   /locus_tag="Apar_0021"
FT   CDS_pept        26606..26878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0021"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: sat:SYN_00643 SSU ribosomal protein
FT                   S18P"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50460"
FT                   /db_xref="GOA:C8W8M2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M2"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACV50460.1"
FT                   /translation="MAQQKQDFQRQPRRKYCQFCKEETEFIDYKDTQLLRKYMTDRGKI
FT                   KPRRVTGTCTQHQHDIALAIKRAREMALLPYTVPVVSSRGGRSRG"
FT   gene            26911..27969
FT                   /locus_tag="Apar_0022"
FT   CDS_pept        26911..27969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50461"
FT                   /db_xref="GOA:C8W8M3"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50461.1"
FT                   /translation="MDRPDSNIPQAPEGYSRPESSSQNFAGPSNQNGGKPRLFEAPTYK
FT                   QGFMLCVIGGVITGFLSFIGAALVAYGMVIAVYCKKGHGWFGPAITSVFITGVVAYLLS
FT                   GPTEAATSVTACALALGVGCAFATEKLTVGVGSLLVGATALALLGYDAFFATIAGTTLP
FT                   ELAQNVFNQYASQVSSASPEIQEGLSTARSLFMLFWPTSYTGMALLYFVIARFGARTVY
FT                   KALTRDPQKLPQFQLMDVPFWMCALTVANLFVYALSSTILPAQDVLQLITLNVFMALRV
FT                   VFALQGLAVLTWFVCEKHCSPALSLSLFVLAGMLEVQLGVMALVGLIDAWANFRKLDRS
FT                   GSQDSEPTINNN"
FT   gene            28002..28526
FT                   /locus_tag="Apar_0023"
FT   CDS_pept        28002..28526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0023"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: dds:Ddes_2022 ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50462"
FT                   /db_xref="GOA:C8W8M4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M4"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ACV50462.1"
FT                   /translation="MKVILLGELRGKGGEGDIVDVAQGYAENFLFPNKIAQPATPGNIK
FT                   QLEERRHNIAKREEQRIADANATKAALDGKLVTVDARIGEEGQLFGSVTTAQIADAIEA
FT                   QLNVTVDRKRIARSAAIKTAGRHNVTIELYRDITATVAVLVGKDDTAPAEEEAEETVAE
FT                   AAVEVEVESAE"
FT   gene            29027..30466
FT                   /locus_tag="Apar_0024"
FT   CDS_pept        29027..30466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0024"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: dvm:DvMF_1353 replicative DNA helicase;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50463"
FT                   /db_xref="GOA:C8W8M5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M5"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACV50463.1"
FT                   /translation="MAQDSFEMNPTQLTALENASMPQDSDAEFSILSAMILSEEIRGEC
FT                   LIRLSSEDFYIPSNQIIFEAIKSLFDNNKPVDVISLADHLKSNGKFERAGGAVRLAELG
FT                   NNPLAMVGWENHAVMLHRDTTLRKMISASAKISALAYNAPEDTKQVVDQAEKLIFDVTN
FT                   RDVQQSEQNIEDIMTNLFDELQQNAGKDAAELGVQTGFATLDNLFQGLRPGQMVVIGAR
FT                   PGVGKTSFALSMAYNAAVSGATVALFSLEMSKIEIAQRLLASESKVDLQTIRSSNIRNE
FT                   QWPTLLEAAERISRLKIIVDDTPGTTVTEIRAKARRMLNKAEKGVIIIDYLQLLSPPAE
FT                   RGRADSRATEVSEMSRGIKIMAKDLKAPVIALSQLNRTLENRNGKRPQLSDLRESGAIE
FT                   QDADIVLLLDRSLSDEEAARDDRPDKDVTNIIVAKNRAGALRDVPIMFMPTSTKFVELY
FT                   QGNNYSESEAAQYAAMTNPAH"
FT   gene            30608..31888
FT                   /locus_tag="Apar_0025"
FT   CDS_pept        30608..31888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0025"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: gsu:GSU3308 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50464"
FT                   /db_xref="GOA:C8W8M6"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M6"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACV50464.1"
FT                   /translation="MPASVLVGAQWGDEGKGKVTDLISGDFDVVCRYAGGANAGHTVIA
FT                   GDTKLALHQVPSGVMYENTYPVIGNGCIVDPEVLLGEIDMLESKGISCDLLKISGNAHI
FT                   VMPYHKDLDGVHEKKLGKNLIGTTKRGVGPTYMDKMNRTGLRIQDMLDEKIFRKKLEAA
FT                   LEYTNPILSLVYGLPTYTVDQICETYLPYADRIRPYIVESSLFLNEELEAGKNILFEGA
FT                   QATMLDIDHGTYPFVTSSNCTAGGAVTGSGVGPTNIDRVLGIAKAYLTRVGSGPFPTEL
FT                   FDETGNLLGEVGHEYGVTTGRKRRCGWYDAVVVNYAARINGLTDLAITKLDVLGCLDEI
FT                   KVCVAYECDGKIYKTVPEHQSVFYHAKPVYETLSGWKCDISNVRNFYQLPREAKDYIDF
FT                   LEQLAGVRVSIITVGPDREQTIDRYWR"
FT   gene            31892..34006
FT                   /locus_tag="Apar_0026"
FT   CDS_pept        31892..34006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0026"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201; KEGG: glo:Glov_2759
FT                   phosphoribosylamine/glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50465"
FT                   /db_xref="GOA:C8W8M7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M7"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACV50465.1"
FT                   /translation="MASSDCSTFAIVCDNPCGLEVSQLEALGVSVIPGALSFDVDQVGK
FT                   FYRGVYESGIHEILSLHVNAGFSESLLTAKKACQENPDISESICLVDSGNMPTAMGIML
FT                   ERLSVARKSGASFEAVCAYAQELAEVVATMYITMNRIALHKSKGKHPGLSLRRRLERLH
FT                   RRISNDMYLYRLVGGRCTEVARSSDFTDLAARISRLMSACFVKRGELKYVVISSGVKRI
FT                   EKHLKKPLKTNEYDAECIAERLASPEFKKYLGEGSVGVACIPKALYQKAGVLMNDTVDI
FT                   LLLGAGGREHALLTKLQESSRAGKIYVAPGNGGMAAQAEIAPVDQNNPDEVVAFAKEKG
FT                   IGLVVIGPEAPLVVGVADAVRQAGIACFGPNKNAAQMEGSKAFAKGVMERANVPTAAWK
FT                   SFTDQKSCESYVRQIGAPVVVKADGLAAGKGVIVATELEQALEGVRECFSGHFGDAGAT
FT                   VVVEEFLEGPECSLLALTDGTHVIPLATAQDHKRAYDGDKGPNTGGMGVYSPVPFVTNE
FT                   ELSQMSAIEQRVVDQLRKEGINYSGCLYGGFMLTKDGPKVLEFNARFGDPETQVVLPRL
FT                   EGDLVSILMACDNSTLRHQQVAWSDSVAVSVVLASAGYPGSYEKGKEITGIEAAQQLEG
FT                   VSVYHAGTAQTEDGKIVTAGGRVLNVTALAPTFEEARARAYEACNLINFEGKQFRHDIG
FT                   LKALQSRSEK"
FT   gene            34022..34867
FT                   /locus_tag="Apar_0027"
FT   CDS_pept        34022..34867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0027"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bha:BH1524 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50466"
FT                   /db_xref="GOA:C8W8M8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACV50466.1"
FT                   /translation="MKNQSDEKNNVQDSARTSSQSSAQFNDVFDDMQPTDPEIIDADTQ
FT                   VTPEVFDSARNDLQSAVDSLTYDGERVAVDDAAYHHSGEPQKRSFVAGTEDARDAFLEE
FT                   KSLTENTVWVGRIFDVNRLRVSLPDGRTALRDVVRHPGAVAIVALTDDGRICLVRQYRT
FT                   ALGRVTVELPAGKLDPGEDPLDCAHRELLEETGMKAGKMAFLTTTATSDGFTDELIHLY
FT                   MATELIFEGSNPDADEFINVDLVPLSELIDAVLDGKIEDAKTIIGALICDSISRRLPME
FT                   "
FT   gene            34874..36721
FT                   /locus_tag="Apar_0028"
FT   CDS_pept        34874..36721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0028"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: bha:BH3891
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50467"
FT                   /db_xref="GOA:C8W8M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8M9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50467.1"
FT                   /translation="MSNRSSRPVFGRSLASASNRNGFGNNASGKHRKSLFASFLSYYAP
FT                   QKHLFILDTICAIILACIELAFPQILRSLTKGLFTQGKDVILASLGFITVGLVVMYFVH
FT                   FLCRYFVISWGHIMGARMESKMREDLFDAYERMSFSYYDRHKTGDLMSRLVSDLFDISE
FT                   TAHHGPEYLIIGLLEIAGSFVILAFINVPLTLVLAGIAAVLVVFNFFANMHMRGIFKEN
FT                   RMRISDVNTQLEDSLSGIRVVKGFAAEDHERKKFRASNSAYLDSKANMYRAMGRYQAAI
FT                   SGMMGVLNTVVLVLGGWMIAQGQMQAIDLATYALYISLFTTPIMNILNFTETFQKGLAG
FT                   FKRFMEILKTQPDIQDAPAAKDIQISAGEIIYQDVHFSYDNAEDVIDGLNLHIESGKTV
FT                   ALVGPSGGGKSTTCALLPRFYDVTSGSITIDGQDIRSVTQHSLRSAIGMVQQDVYLFDG
FT                   TIAENIAYGCPEASAEAIALAAKRANIAEFIESLPDGYNTQVGQRGTRLSGGQKQRISI
FT                   ARVFLKNPPLLILDEATSALDNESERAVQESLSELAKNRTTLVIAHRLSTIMGADEIIT
FT                   IDHGRAVERGTHNELLEKGGIYAHYYQMQFGGAPNPTRR"
FT   gene            36912..37847
FT                   /locus_tag="Apar_0029"
FT   CDS_pept        36912..37847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GE20196 gene product from transcript GE20196-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50468"
FT                   /db_xref="GOA:C8W8N0"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50468.1"
FT                   /translation="MAKDDAERSSFARRQKGALDADAAEELFTKVDETGHPNEERAALE
FT                   RTRRQGGAAAVDVDPLSGSDPSGSNIEKVITKTAVLFVLIFLVIVVLMQVSCGVIRRAN
FT                   TANLTESVTVRTVASALRGGVEWGNGFTQFPEDFSVQEADENTGRVEVTVTDTTSKDVL
FT                   ECYAGSSVQAQAFAINALLNPRINTVVYHVSVHRNDQGELQKSQLFGFLKPGGDATPIF
FT                   TFTFSKTQSSDGVNITMVITGANNTIQEELRDQIATSFTPVRVLGGIVGGDSSSKNNST
FT                   TGTTSTNGSSGTNGNVTNTNGTSNTTSSGK"
FT   gene            complement(37975..38844)
FT                   /locus_tag="Apar_0030"
FT   CDS_pept        complement(37975..38844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0030"
FT                   /product="Phosphomethylpyrimidine kinase type-1"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   cco:CCC13826_1956 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50469"
FT                   /db_xref="GOA:C8W8N1"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N1"
FT                   /inference="protein motif:PFAM:PF08543"
FT                   /protein_id="ACV50469.1"
FT                   /translation="MNETNSVLYQRESSYIPRIAAVHDLCGYGKCSLGIAIPVLSAAGC
FT                   DVCPVPTSLFSAHTKFPTFYMHDTTNMLEDYLDAWQEEGIDLDAIYSGFLGAAEQVASI
FT                   QRLYQEHPKALRIVDPVMGDGGKMYPTYTQELCDAMKSLVNGADILTPNLTEASILTGI
FT                   PYAGQNLTDEQVNELLDALLEMGAKCVVLKGIVRNDNLIRNFVATESERGEIVSELLPY
FT                   MLHGTGDLFASALLAAVMCGQEIADAVEFAGEFVCESMEITREQPNFELRGVSFETKLG
FT                   LITQLLQE"
FT   gene            38961..39422
FT                   /locus_tag="Apar_0031"
FT   CDS_pept        38961..39422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0031"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: hypothetical protein; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50470"
FT                   /db_xref="GOA:C8W8N2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N2"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ACV50470.1"
FT                   /translation="MADQPVVGIIMGSKSDLATMEGCTNELERLGVPYELVIASAHRTP
FT                   DKVHRWAESAAERGIKVIIAAAGKAAHLGGVVAAFTPLPVVGVPMKTSDLGGMDSLLSM
FT                   VQMPSGVPVACVAINGAKNAAIYATQILGASLPEYREKIVQLKAEMADA"
FT   gene            39656..40579
FT                   /locus_tag="Apar_0032"
FT   CDS_pept        39656..40579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0032"
FT                   /product="sortase, SrtB family"
FT                   /note="TIGRFAM: sortase, SrtB family; PFAM: peptidase C60
FT                   sortase A and B; KEGG: bcz:BCZK4288 surface protein cell
FT                   wall anchor"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50471"
FT                   /db_xref="GOA:C8W8N3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N3"
FT                   /inference="protein motif:TFAM:TIGR03064"
FT                   /protein_id="ACV50471.1"
FT                   /translation="MESRNGKHFSSFAAADQPAEDNEVLKTSVEMIPMKSMVSSKKDSN
FT                   KKKPGSKPAKKGFSNILSTILLIVGIALLIAAAIMFGKTQVDYYAQDVINQELAAYTTV
FT                   PEKKDEAPVVDWAGLKAVNSQVVGWIQIPGSQINYPVYQTTDNEYYLHTNAKGEWSIGG
FT                   QIFMDYENNPNGLIDQQTILYGHHMRNGSMFQFIGALNDQNTFNKVETIWYVTPTQTYE
FT                   LEPIFTYHTDEDDDEVRQFNFTSVDEFRSYLKDRLSRAVSSRSDAAEVISRTEHVLTLF
FT                   TCNYTDQYGRTMLICVPKSEAQPKTQ"
FT   gene            40777..42270
FT                   /locus_tag="Apar_0033"
FT   CDS_pept        40777..42270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0033"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: ank:AnaeK_4338
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50472"
FT                   /db_xref="GOA:C8W8N4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N4"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACV50472.1"
FT                   /translation="MELHEECGVFGVWAPDRDVARLTYFALHALQHRGQDSAGIAVGDG
FT                   QTVLIRKDTGLVTEVFNNDDLNAMPGKVAIGHCRYGTAGAKGWESAQPHMSSIDETLIA
FT                   LAHNGTLVNFDSLREELSSRQISFRSNTDSEVAAQLIGYFTHQTHRLRTGIAATMNLIE
FT                   GGYAMVLIRENALYAFRDPNGIRPLVLGYIGEKNQNNWVVASETCALDIVGATYVREVA
FT                   PGEIIRISDNGLSSEMGLSPRQQADCIFEQVYFSRPDSIISGRSVYSVRHQMGRQLAKE
FT                   TPANVDLVIGVPDSGVPAAEGFAQELDVSFATGLIKNRYVARTFIQPTQQLRELGVRLK
FT                   LNALSDVVADKRIVMVDDSVVRGTTSKQIVQLLRDAGATEVHVRSASPKVAWPCFYGID
FT                   TADQDQLVAAKMSTEEICEYIGADSLGFLSIEGLLACVPSRGYCESCFNGRYPVAIPKD
FT                   FHGRFLPENTPDNLNPSFALKFDQVEQQLIDEGLMPSEQ"
FT   gene            42281..43369
FT                   /locus_tag="Apar_0034"
FT   CDS_pept        42281..43369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0034"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: prw:PsycPRwf_1440 phosphoribosylaminoimidazole
FT                   synthetase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo- ligase; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50473"
FT                   /db_xref="GOA:C8W8N5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N5"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ACV50473.1"
FT                   /translation="MTTSADPTKQITYADAGVDVDEGARAVDAIKAAVATTTRPEVIGS
FT                   LGGFGSCFSAAALKDMEEPVLVSGTDGVGTKLAIAQLLNRHNTVGEDLVAMCVDDIVPM
FT                   GAEPLFFLDYVAVGKLKAGAVAEIVGGIAEGCRKSGCALVGGEMAEHPGVMNPDDYDLA
FT                   GFVVGVVDKPKILGPEKVSEGDIILGLPSSGIHSNGYSLVRKVVIEGKTVEELNQPLEE
FT                   LNGESLADAVLRPTTIYAGGLLAALRAGAPIKAMAHITGGGITENLNRALPAHLDAEVD
FT                   RGGEAGPAWSIPPVISYVSNAANLSLDEQYRTFNMGVGMALIVDMDDVDDVAEALSDQG
FT                   FEPFIIGQIIPGTGKVVYNDAD"
FT   gene            43359..43973
FT                   /locus_tag="Apar_0035"
FT   CDS_pept        43359..43973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0035"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: phosphoribosylglycinamide formyltransferase ; K11175
FT                   phosphoribosylglycinamide formyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50474"
FT                   /db_xref="GOA:C8W8N6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N6"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ACV50474.1"
FT                   /translation="MPIKLGVLLSGSGTNLQAIIDAIQAGKLDATIELVVSSRPSAYGL
FT                   KRAEAAGLQTLTLSKETYEDPFVADMVIATELKRYDVDYVVMAGYMRKVGAPILESFPN
FT                   RVLNLHPALLPSFRGAHAIQDAYEYGVKVTGVTVHLANADYDRGPIIAQRPVVVEEGWT
FT                   VNQLEEAIHQVEHQLYPEVLRFFAQDRVHVEGKKVRIELGE"
FT   gene            43974..45050
FT                   /locus_tag="Apar_0036"
FT   CDS_pept        43974..45050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0036"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: psa:PST_4158 sugar
FT                   acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50475"
FT                   /db_xref="GOA:C8W8N7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N7"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACV50475.1"
FT                   /translation="MARSAQIKLNDVATSRVNNLNFIRFIAALMVIVSHCYSVVLGGDA
FT                   GSYLLQLTGDRLSPGGVSVGIFFLFGGFLIARSCEHYPEPKKFFSARVGRLFPELIFVV
FT                   ILTTFVLGPIFSTLSPVEYFTNPQTYKYLLNGALIMVHQLPGVFTNNPSGDVVNAALWT
FT                   LPVEFICYILCFISYKLTKFDKKKFLLLSVPVFILAAVYYVKFSPFQLSVVRAVLLFYL
FT                   GVLIWVLRDRVIISPILGLASIALWFVMVFRGIDNLAMLTVFPVACFYLAYGMGNHFSK
FT                   FGTKFELSYGIYLWAFPIQQALVLYFPSWHPYTNALVAALLATFGAFVNHYVVTEPLRK
FT                   YLKERRQKAHKEQKSSKE"
FT   gene            complement(45198..45416)
FT                   /locus_tag="Apar_0037"
FT   CDS_pept        complement(45198..45416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50476"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50476.1"
FT                   /translation="MLFGRRKVVDKVTQNDDGTTTVEMHDPTKVEMTTDGKVGVNLFDK
FT                   EVVKGKTVGTEKEVTIDLKSLFRRKKK"
FT   gene            45523..45636
FT                   /pseudo
FT                   /locus_tag="Apar_0038"
FT   gene            complement(45727..46251)
FT                   /locus_tag="Apar_0039"
FT   CDS_pept        complement(45727..46251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50477"
FT                   /db_xref="GOA:C8W8N9"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50477.1"
FT                   /translation="MHEVDIKSLQLNPWSLFGDRWALITAGNECDGFNTMTAAWGHFGT
FT                   LFSLRGGSLNTTICYIRPQRYTKVFMDSHDTYTLSFFPDTAEYKKKLAHLGARSGRDED
FT                   KVAHVGLTPKFLEGTTTFEEASLVFVCRKIYVDDLAEENFIDVGIVEKNYPLRDFHTRY
FT                   IGEILKVYVAD"
FT   gene            complement(46274..46390)
FT                   /pseudo
FT                   /locus_tag="Apar_0040"
FT   gene            complement(46515..47288)
FT                   /locus_tag="Apar_0041"
FT   CDS_pept        complement(46515..47288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0041"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sus:Acid_0989 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50478"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV50478.1"
FT                   /translation="MGKTALVTGASSGLGLEFSKIFAENGYDLVVVARNEGRLYQLKGD
FT                   LEETYGITVWVCASDLSREGAALDVFDFCMEEGIAIDCLVNNAGFGDQGDFSNADWQRQ
FT                   HDMAQVNMVALMQMTKCFIKPMLERGGGKILNISSVAAFSAGPKMSVYYASKAFVRSFS
FT                   EAVSEEVRGSGVTVTALCLGPAATGFEKAAGLEASKMFTFFRPASARDVVLSGYRAMMR
FT                   GVTLRYYGAPTKLMNIGSRLVPRIVARKFAKYVNG"
FT   gene            47776..48399
FT                   /locus_tag="Apar_0042"
FT   CDS_pept        47776..48399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0042"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   gsu:GSU0388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50479"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P1"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACV50479.1"
FT                   /translation="MSRVSRREDAFFSMFSEFSVLTVSAAKLFVSFIENFPDDEDLAAQ
FT                   ITNYESLCDDQVGKIISTLNTSFITPFDREDISELALLMDEIVDGIEGVTAHIDMYDIS
FT                   EMRPEAGQMAHLILFASEELQKAFDRLPDYHKDDSVIEHTRATNGYEDQGDVVYRNALS
FT                   TIFRNVTDPIEVIKWKSLMDRLESTLDATKHVANAVQNVIVKNG"
FT   gene            48392..49387
FT                   /locus_tag="Apar_0043"
FT   CDS_pept        48392..49387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0043"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: glo:Glov_0587
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50480"
FT                   /db_xref="GOA:C8W8P2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P2"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACV50480.1"
FT                   /translation="MVSILLIAVLIAAVVFEFINGFHDTANAIATTVYTKALPLRVAIL
FT                   MSATMNFIGALMSEKVAMTIASGLVDIQLQLYVVFAALVGAIVWDLFTWWFSIPSSSSH
FT                   ALIGSLIGATIIFTRTTNHIMWEGVLEKVVIPLFTSPLIGMALGYFIMKLVFELFADWP
FT                   PKKAHGLFHRLQVLSAAFMAYSHGNNDAQKTMGIITLALVTAGLHDPSMGIPLWVKLLC
FT                   ATTMALGTSIGGGRIMRTVGDGVTKLTPVIGFVAEASSTVAIELMTAMGAPVSTTQVIT
FT                   TSIMGAGSARRRSSVRWGVARKIIAAWFITLPATMALGGLIAFLTSFVLA"
FT   gene            49402..50064
FT                   /locus_tag="Apar_0044"
FT   CDS_pept        49402..50064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0044"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dps:DP1932 rRNA methylase homolog (CspR)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50481"
FT                   /db_xref="GOA:C8W8P3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P3"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACV50481.1"
FT                   /translation="MFNLVLVEPEIPANTGNIGRTCVVSGTHLHLVGPLGFSLDDKSLK
FT                   RAGMAYWKSLNVSVYDNWNQFIEKNGLADTSTTPEGVFAHDVGIDAVDKPHLHFLTKKA
FT                   KKTYTQATYRDGDYLIFGKESLGLSEELLAKHADECERIPMLQDSVSLVNREDWSQKHD
FT                   ALDGGGQYSHPVLLQQDICGNFIDPNEFSVSALNVSNAAAIVLYEALRQIGFPGMDV"
FT   gene            complement(50207..50470)
FT                   /locus_tag="Apar_0045"
FT   CDS_pept        complement(50207..50470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aci:ACIAD0111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50482"
FT                   /db_xref="GOA:C8W8P4"
FT                   /db_xref="InterPro:IPR004316"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P4"
FT                   /inference="similar to AA sequence:KEGG:ACIAD0111"
FT                   /protein_id="ACV50482.1"
FT                   /translation="MTKKQINLFVGSIGAFIGVFVFIAYIPQIIANLQGVKAQPFQPLF
FT                   AAVSCLIWVIYGWTKEPKKDWILIIPNTAGVILGGLTFLTAL"
FT   gene            complement(50610..51242)
FT                   /locus_tag="Apar_0046"
FT   CDS_pept        complement(50610..51242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hhe:HH1060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50483"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P5"
FT                   /inference="similar to AA sequence:KEGG:HH1060"
FT                   /protein_id="ACV50483.1"
FT                   /translation="MAFDFKKEFKELYAPKNKPSIVKVPRINYLAVRGFGDPNVEDGEY
FT                   KQSIGLLYGVAYAIKMSKKSTHHIEGYFDFVVPPLEGFWWQEDTQGVDYAHKENFKWIS
FT                   VIRLPDFVTKEDFDWSVAEATKKKKLDFSKVEFFTYDEGLCVQCMHIGPYNSEPETVSL
FT                   MHEYMESQGYVLDITAERMHHEVYLSDVRKIAPEKLKTVIRHPIREV"
FT   gene            complement(51279..51773)
FT                   /locus_tag="Apar_0047"
FT   CDS_pept        complement(51279..51773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0047"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   pfl:PFL_2782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50484"
FT                   /db_xref="GOA:C8W8P6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P6"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACV50484.1"
FT                   /translation="MCLICDRIQMIKEGNNPYFVKELETGYVVLGDNQHFKGYTIFLCK
FT                   QHASELHELNTDFKLKFLEEMSLVGEAVSHAFPCEKMNYELLGNGDSHLHWHLFPRVAG
FT                   DLEEYGHNGKGPVWWYPMEKMYDNSTCPSPEELETLKSKLSIELTKVLSSTEENQGNQI
FT                   Q"
FT   gene            complement(51827..52816)
FT                   /locus_tag="Apar_0048"
FT   CDS_pept        complement(51827..52816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0048"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   bcr:BCAH187_A2522 CAAX amino terminal protease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50485"
FT                   /db_xref="GOA:C8W8P7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P7"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACV50485.1"
FT                   /translation="MQENRMFSDVKLAKRLTPAWLSPFFAALLIVAGQIVGAIVLAVSA
FT                   ALLAVPYFLNNPQIANKLSSPTILQELLGDYYLLLSLFSFIFIAGLFLLWVKFFEQRPI
FT                   VTLGFYKDNWKKELLKGFGLGLLLFSILMLILILSGSYQFVGATFTPYAFGFVLITIPF
FT                   WLIQGGTEELITRGWLLPVMAEKSNKIIAIVVSSSLFGLLHIFNSGFTMFSLFNLILFG
FT                   VLETFYIIKTDNLWGTAGIHGAWNFAQGNLFGVLVSGSAAGSSLLRFIPDNGQEWLTGG
FT                   NFGAEGSAACTLVMLITILILAYQLKKSDKLFVKKSAEKLAEPTSVDL"
FT   sig_peptide     complement(52679..52816)
FT                   /locus_tag="Apar_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.249 at
FT                   residue 46"
FT   gene            complement(52906..53514)
FT                   /locus_tag="Apar_0049"
FT   CDS_pept        complement(52906..53514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50486"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50486.1"
FT                   /translation="MKVHQLIKETCKIAAGDIGKVKANQIAQIAQKRYKALCAENSSDS
FT                   KELRAHSYKRIYPGIAVYETLRAEGISQEKAVWYIREYFQRFAAKRVPLFQWVIKTFGL
FT                   ARKFPRLFKLGVEKSCPPSAGFAYEFPESHGNEVRINMVKCPYFEITKKYGCPEITTAY
FT                   CDSDDAGYGNLHPKLIWGRTKTIGHGGDCCDFLLEYKEK"
FT   gene            complement(53595..54350)
FT                   /locus_tag="Apar_0050"
FT   CDS_pept        complement(53595..54350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA1914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50487"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8P9"
FT                   /inference="similar to AA sequence:KEGG:GBAA1914"
FT                   /protein_id="ACV50487.1"
FT                   /translation="MKIIEFGKQNNDVIMLLHGGGLSWWNYKAEAELLKNRYHVVLPIL
FT                   DGHAGSDNNFISIEKNASRLISFIDKEFGGSVLLIGGLSLGAQILVEMLTQRNSICQNA
FT                   VIESASIIPSKLTNALIKPMFSLSYGLVKKKCFAQMQFDYLHIRKDLFEDYYRDTPQIS
FT                   KANMIAFLEANTSYELKPDFHDNRAKVHILVGENEQKKMFCSAEQLHKALPGSILEIKK
FT                   GLYHGEYSINYPEEYTKELLDMINAQQRP"
FT   gene            complement(54520..55026)
FT                   /locus_tag="Apar_0051"
FT   CDS_pept        complement(54520..55026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50488"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50488.1"
FT                   /translation="MATKNIYVAEADLHLFDDAAKYAGSVSAAVIQALQDFLSIQRNKS
FT                   EGYDKIELNLYEKGVRRKVMFYGMKITRVERPADGGIRIDTIYKTAKGQFAVATKVRKE
FT                   LPNWAQGNPHVWENPQSWSYDFWNLGDRVLNVYPDIESLKEKDAYLAECCESSLSEKPY
FT                   EFLDI"
FT   gene            complement(55301..55492)
FT                   /pseudo
FT                   /locus_tag="Apar_0052"
FT   gene            complement(55616..56863)
FT                   /locus_tag="Apar_0053"
FT   CDS_pept        complement(55616..56863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0053"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; KEGG: bha:BH0687 RNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50489"
FT                   /db_xref="GOA:C8W8Q1"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q1"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ACV50489.1"
FT                   /translation="MGYKTPTCSIARRCGGCEWLSVPYPIQLKRKQAQVEELLAPLASI
FT                   NNVTIEPIRGMDEPLAYRHKAATPFAPGKGRTVRSGFYASGTHQIIASKECLVEDGRAR
FT                   AILNDVAYLAGQFNIHAYQEDRGKGALRHAVVRCGYATDDVMLVLVVNGQRLPHEQEFI
FT                   AALRKAHPELTSIFLNVNQKRTNAILGRETRLLWGSTSMSDKLLNCTFEIGPTSFYQTN
FT                   PQQTEALYQLAIDGALAGSKQTGATLTEASTQTDASAPANNLRILDAYCGTGTIGLCLA
FT                   HVAEAQGVNLLLTGVDQVENNIQMARRNARNNKLEAEFICDDATRYMQALAKDGQNFDV
FT                   IILDPPRAGSTPAFLKATAQLAQKKIVYVSCNVVTQARDLKVLLDSGFAIERVTPVDMF
FT                   PHTKHVECVVVLSRAN"
FT   gene            57034..58002
FT                   /locus_tag="Apar_0054"
FT   CDS_pept        57034..58002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0054"
FT                   /product="Lactate/malate dehydrogenase"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   ent:Ent638_2002 malate dehydrogenase (NAD)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50490"
FT                   /db_xref="GOA:C8W8Q2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q2"
FT                   /inference="protein motif:PFAM:PF00056"
FT                   /protein_id="ACV50490.1"
FT                   /translation="MALISKIGIIGANHVGAHVANALLYQGLVTELYISDTNEVLCKAQ
FT                   VNDLLDAMPFYPHPARVFELDDRYEELAGCDIIVNAAGHVAAAAGNRDGELFVTTDEAK
FT                   KFAKRIADAGFNGVWVNIANPCDVVTTELQYLTGADPYKVIGSGTTLDSARLRHALSGA
FT                   TGYPASCINAWMLGEHGNGMFACWSHVSIGCLTLDEVAAQTGKTFDLSELEQAGRMGGY
FT                   VTYSGKQCTEYSIANGAVEVIKAIVHDTKLITPVSTLLTDVYGVSGFYSSLPAVIGANG
FT                   VEKVFVPELSDSEIEAWRKSCEHVKGNIDQLGWLEVDARID"
FT   gene            58519..59505
FT                   /locus_tag="Apar_0055"
FT   CDS_pept        58519..59505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0055"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   nar:Saro_3197 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50491"
FT                   /db_xref="GOA:C8W8Q3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q3"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACV50491.1"
FT                   /translation="MSTEKIIKSKSGWLFLLIAIALFVIAVLFLANFVISAIAADRNPR
FT                   LEPSVPSIIGALVFFFAGLFVSSGLFSLQPGQARVCVLFGKYIGTVKDEGLRWANPYYA
FT                   KTLSAGNLSTLVTVGDTSSVNVHTSIISTRARTLNGDVLKVNDRMGNPIEIAEVVVWRV
FT                   SDTAKALFDVDDYDSYVAMQAETALRHVASIYSYDHMEDESESNTAITLRSNIEEVSEA
FT                   LQSELSRNLSVAGITVDDARLTHLSYAPEIAQAMLRRQQAEAIIAARKKIVEGAVSMVD
FT                   MALTQLSENGVVEFDEDRKAVMASNLMVVLCGESEAQPVLNTGSLQQ"
FT   sig_peptide     58519..58638
FT                   /locus_tag="Apar_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 40"
FT   gene            59523..59723
FT                   /locus_tag="Apar_0056"
FT   CDS_pept        59523..59723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50492"
FT                   /db_xref="GOA:C8W8Q4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50492.1"
FT                   /translation="MAPRKQYPLRVAPEIWEAVERWAQDDMRSTNAQVEWILRDALKRA
FT                   KRSPKANNTCMNKTEKMEEGN"
FT   gene            59725..60969
FT                   /locus_tag="Apar_0057"
FT   CDS_pept        59725..60969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0057"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcz:BCZK4584 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50493"
FT                   /db_xref="GOA:C8W8Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50493.1"
FT                   /translation="MADNTPQPPVPNAPVSPAAPAPDAPASPAAPAPAVSVPAAPTPTA
FT                   PAAAVASTTPAPAGVTPAASGEVVPVLSVQHFTKKYGSKVAVSDLSIDVMPGDIYGFIG
FT                   HNGAGKTTLIKSVVGAQPFEGGVIFVDSKNVLVDPVGTKQVIAYVPDNPDIYEFMSGIK
FT                   YLNYVCDIFGVPAENRVERITTMANRLGITDSLSNAIGSYSHGMKQKLVLISALLHEPK
FT                   LIVLDEPFVGLDPAASFELKKMLHELADRGSAVFFSSHVLEVVEKLCNKIAIIRQGKLL
FT                   AAGKTDEIRGNASLEEVFLGLEAGAPGVSAEIAQDMATTKDGAAVQPVIPGTPVATTPA
FT                   APVAPTAPVTPAVPATPAAPAAPATSVAPATPAAPAASSAPATPAGSAGPAAPTTPGAP
FT                   VPPGAPVPPSFPKEN"
FT   gene            60972..62816
FT                   /locus_tag="Apar_0058"
FT   CDS_pept        60972..62816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK4583 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50494"
FT                   /db_xref="GOA:C8W8Q6"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50494.1"
FT                   /translation="MANNVPQAPQRPDVPEQNLPLSGDVFIPAQVSAGQIPVLNRSELK
FT                   LPSNLKVFWMLLKVQITMIWTTQVMGARKNFEKKVGANALPIVGGIFAVVGALIMMVYI
FT                   YGVSTGVALAGFTRLLPLAGILFGALPGVILTFVKANGVLFAYKDYDFIMSLPIKKSTI
FT                   IYSRVAALYAAEGIWSFAIMLPVFLAYFTFEAVTIPRLIGALFALVLGPNLAVSAAILL
FT                   AFAVAALAAKLHFKSLGMVIGGIFGLLFMVAYLFFIFTLSFNADKLSAGAAGNFQATVF
FT                   SVASSVGLVYLPSLWIADFFRSGSFVSFLLFVLVSVGAPAVIVAIISRFNDRINALVSE
FT                   DKVQKKFTTKQISTKSVSPFVALIRKEIQTIIGYPAVFVNMLFGCLLMVILAFISLFFN
FT                   TSSIVANFVPASEVPRYLPLARTIFGMATTWFGTSMFCAANSAAISYSLEGRSNWLMAT
FT                   MPVSSRQIFGAKIAVNMLYVAFFSILTQIFFLIPGHITIETALRNVILPLCIVFLVANV
FT                   GLAIDIRRPNFDWTSVIDITKRSLSVTVSSLVGTLGSMIVIGGTFMLMILPVIDSFSSS
FT                   TGMVNETLPNVVFVTLSLLNAVIGALIFNNTVHRGVRI"
FT   gene            63091..65166
FT                   /locus_tag="Apar_0059"
FT   CDS_pept        63091..65166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0059"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain IV; protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: sfu:Sfum_0068 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50495"
FT                   /db_xref="GOA:C8W8Q7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q7"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACV50495.1"
FT                   /translation="MAEKNVSKVKNVVLVGQGGVGKTMLAEAMLHLTGATTRLGGHAGT
FT                   KPTLDYDSQESERGFSISTTIAPITWENTRINVLDAPCYPDFVGDAYSAMSAVETALFV
FT                   VDAASGPGTITTRLWFAAEDLSLSRALFINRLDRPDADYETAMAMLQDRFGSSLGAVTI
FT                   PMGSGEAFSGIIDVVHQKARKLVDGKPEVTDIPAEFQAEAEAARSALTELVVEADDELM
FT                   MRYLEGGEITQEELESLLGKALMERIFVPVFSGSCVHEEGVISLLDAIDGWFPTMSDFG
FT                   RIPLVNGEQLDISPDDERPVAFAFKSLQDSQNGKLTFVKVLAGTISAGDELINARTRKP
FT                   ERLSHLYRMCGKETSDVSIAAAGDIVVVPKLEAMTGDTLSVTGKVEAAAFRFPNSLYRT
FT                   AIEPDERGTEGKLFAFLEKAADADPTLKVERDEDTGQTIVSAIGEAQVAVLLERLEQRA
FT                   GVSAHKVALRIPYRETIRRVASAQGRHKKQTGGSGQYGDCWLRIEPNPDAGYEFVDEVV
FT                   GGHIPRGFIPAIDKGVQETMREGVLAGYPMIDIKVAVYEGSYHPVDSNEMAFKTAARIG
FT                   FQKAVEQAEPVLLEPMAHLEITVPDSYAGSVMGDVSASRGRVEGMSSGTGVSAGETTIK
FT                   ATIPYAEVTDYATRLRSLSRGTGEYTVELSGYEQVPHDIQARLAAEYAERRAAGER"
FT   gene            65966..67723
FT                   /locus_tag="Apar_0060"
FT   CDS_pept        65966..67723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0060"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: glo:Glov_2235
FT                   deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50496"
FT                   /db_xref="GOA:C8W8Q8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q8"
FT                   /inference="protein motif:PRIAM:2.2.1.7"
FT                   /protein_id="ACV50496.1"
FT                   /translation="MYLEHINGPEDVKKLDSKARLTLAQEIRENLLVMESKHGGHFGPN
FT                   FGIVEATIALHTVFNSPVDHIVYDVSHQTYPHKMLTGRKQAYMDPALYDSVSPYTDPAE
FT                   TPHDLFKIGHTSTSISLALGLAKARDIMGGKENIIAVIGDGSMSGGEALEGLNVAGELN
FT                   SNFIIVFNDNQMSIAENHGGMYDQFAELRRTNGTAENNLFKSMGLDYLYVNDGNNIEAL
FT                   IDAFEQVKDMTRPVVVHINTLKGKGYAPAEANKEKWHWHMPFDIQTGQSPASGSSESYA
FT                   GIFAEYALKRAKTDPKFLVLMSAVPGLLGLSQERREELGKHYLDVGIAEETAVAMASGA
FT                   AHAGAHVVWGSSATFIQRTYDQLTQDLSLNQNPAVIMGSGSIRGLMAATHQGLSSISMI
FT                   ANIPNMVYLAPSNAEEYIAMLDWALEQDKHPVYIAISSGPVVHVEGSVRTNFDDLNTYE
FT                   VTRQGSKVAVLALGDFYDLGEKTVEALNSTLGIEATLVKPYFASGVDENLLDNLVKDHD
FT                   VIVTIEDGIIEGGWGQNIASYLGTSSARVLNYGVKKAFYDRVNIADLMRESHLDPELIA
FT                   ADVKQVLGL"
FT   gene            complement(67997..69091)
FT                   /locus_tag="Apar_0061"
FT   CDS_pept        complement(67997..69091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0061"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; 3-
FT                   dehydroquinate synthase; KEGG: plu:plu4115 glycerol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50497"
FT                   /db_xref="GOA:C8W8Q9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Q9"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV50497.1"
FT                   /translation="MKMLRAMREPLKYVQGKNACLEFEKEMGYMGKRFLFVCSNSGYKA
FT                   AHDMIEQSFEGKGDYYRRYEIFGGISSNGEINRMKAIVEEDNIDVVVAIGGGSAVDTAK
FT                   ATAYYAGKRIVILPTVAATDAPCTGLSVIYNDDGSFDKYLFYPQNPDAVMVDTQIIANA
FT                   PVSFLVAGMGDALGTYFEGRASIRTESPSLEGTGITRVGMAVAKECYLTLRDYGSQAIK
FT                   ACENNVVTPALEAICEAAVYMSGVGADNVNCAAAHSFYNGLTSLGGHSAPHGNCVAFGT
FT                   LVQLVLEGVPQEEFDEVQDFCLEVGLPTTLEEIGITTDEQIKKIAEAACVPGETIHNLA
FT                   GDVTPDELYAAIVQADAMGRALKA"
FT   gene            69295..70617
FT                   /locus_tag="Apar_0062"
FT   CDS_pept        69295..70617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50498"
FT                   /db_xref="GOA:C8W8R0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50498.1"
FT                   /translation="MSRLNERQIQERNISLYTWSNYLNSGVLIWTVITLYYLWRGLNYF
FT                   DIALVQSFGAIATAVLEIPTGWVSDHYGHHRVLKLAALSRFLALVILTLANNLFLMIVS
FT                   EFLFALANASQSGAGSAFLFESVSFVTTEDDKSKPYALVLSRITGVQSEIRIAVRLVAP
FT                   LLFDINPLIPFLISIFIYLFSCFLATEYKNSKHVGVSCNVHPLLIECSIKNIFRKIFIN
FT                   IKKFITVFKNLIKNRFFLVLCAVSSISLVMVSNYSQFVAPNLESMGFDIKFYGIVTAAV
FT                   SLGELFGSRLIAFFIKRYSESYESYFSNNLCGSLSIEVRLIFTIALFMAILLLFYGNFS
FT                   SIALCIFVYIAINLLSTMLSILLSKQMNQVANSTNRATLLSVSNQIDEITAVVFDPIIG
FT                   FGLDAAGFGVVYICLGCLAIVILSLILAYCVLQANSKKSFS"
FT   gene            70763..71965
FT                   /locus_tag="Apar_0063"
FT   CDS_pept        70763..71965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0063"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: dal:Dalk_2373
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50499"
FT                   /db_xref="GOA:C8W8R1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV50499.1"
FT                   /translation="MLSSVEIKPDVYFVGALDWNAREFHGYTTERGITYNAYLILDEKI
FT                   TLIDTVKRPFSEELVERIKSIIDPAKIDVLICNHIEMDHSGSVPRILELAPNAEVYASA
FT                   PQGVKELKAFYGENINVNGVKTGDTLNIGKRTLTFVQTPMVHWPDNMVTYSDYDKILFS
FT                   NDAFGQHYASSTRFEDESDYCEVMKQARKYYANIVLPYGRQADSAVTAVKGIGLENIDI
FT                   IAPAHGVAWRSHIADIISKYEEWTSGKLEEKALVVYDSMWGSTDKMAHALLDGFLAEGI
FT                   PVQLIDLKETHISDVMYHFLDSKYVCVGSPTLNSKFLPTVSSFLTYMTGLSPKNDHRIG
FT                   FAFGSYGWAPLGPKMVQAELEVAEFTMPLPAHAIGWIPSDEDLDAVRAQVKDLVEAGKQ
FT                   L"
FT   gene            72773..74116
FT                   /locus_tag="Apar_0064"
FT   CDS_pept        72773..74116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0064"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein; KEGG: glo:Glov_2611 protein
FT                   of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50500"
FT                   /db_xref="GOA:C8W8R2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R2"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACV50500.1"
FT                   /translation="MDIALSIAITLLLTLVNGFFSAAEMAIVSARRGALEADVDEGDLK
FT                   AQLVIDIAADRGYFLATIQVAITLVGFASSAFAATSLSEPFGAWLVSIGVHADLALPLA
FT                   VVVITLIVSFFSVVIGELVPKSIGLANAEAVAKAVVGPMGAFMKIARPLVFITSAAADA
FT                   VTTLMGVDTTNDYQEVTEEELRYIVKDSGDLSEEEKSMIHEVIEMGDTVVREVMVPRVD
FT                   MTAMEDTATISEVLRVMRQTGFSRIPIYHENIDRIVGIAHIKDLLEPVLDQHASEEKIA
FT                   RFVRSADYVPDTKDIIPLLTEMQTSRDQMVIAVDEYGGTAGVITIEDIVEEIVGEIEDE
FT                   FDPDNKYLTQLSDREWLVDGRFSLNDADELGWPVGESEEYETIAGFVLDLAGHLPRPGE
FT                   VFEKDGYVFRVQSMRRRRLSLLRVIAPEPQVDGESEPASENSDISENE"
FT   sig_peptide     72773..72844
FT                   /locus_tag="Apar_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.486 at
FT                   residue 24"
FT   gene            74163..75017
FT                   /locus_tag="Apar_0065"
FT   CDS_pept        74163..75017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50501"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50501.1"
FT                   /translation="MAQLISIKKVVVGPKNLTATVEFSAKAPRLTSEDAEATERVLELL
FT                   PGLSEHLCLGDADARFGLVAKDTEVAHLLEHVTVELLALTNLAGDVSSGKTSLVDSRRG
FT                   LYEIILACPDDVLVAASLSSAVWLLNWAYGNQDEADPDINAIVSGLVALIQSLDGEKND
FT                   ELADSVEPEVDAASEAESVEAEDYAADNSSEDVDDAAAADAAEAEAADAEENNAEVAGV
FT                   DAADSKPADTDVDAAESTTAEAEPADELADATAAENATDDSEVTDVPDDWNMINVPRSK
FT                   PVR"
FT   gene            75075..75536
FT                   /locus_tag="Apar_0066"
FT   CDS_pept        75075..75536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_2325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50502"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50502.1"
FT                   /translation="MSKKSAGFFLGAVFGAAAGAVAGIFLAPRSGEETRALAADAVNDA
FT                   WDSALDSYERTSKVVSTKIDEVKPTVNAKTDELRAKVDLARERMDQLRESLSDAVTSAS
FT                   NTVADAADVVADSFAVPEPTTTTAEAQAVRIENVESHNQENADEGYQEA"
FT   sig_peptide     75075..75143
FT                   /locus_tag="Apar_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.737 at
FT                   residue 23"
FT   gene            75602..76576
FT                   /locus_tag="Apar_0067"
FT   CDS_pept        75602..76576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_0268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50503"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50503.1"
FT                   /translation="MKTTELLGAKVFIPKKPATKGKHAGEERFSKLGKIHNVVFAPFKQ
FT                   GKPSQVVGVMVQKPDIAGMIKQDDAFVTLESLEIIEQGLCVKEPENNVDKAAIMRLNLD
FT                   FDNCILWHGMEARTKSGKSLGYVSGAEFDQTTGMVSVFLVGDGAGSEALVGSFAIKPEW
FT                   LLGYSNGVMVLSDEVTDAQLTGGLAAKAGESYAAVAAKASEATAKAGKAVAEATEKGAF
FT                   ALGKTLAKAKRAIEDATEPDAEDDSERPAPVAAEGVQLEKLSPEEQVVADKAAAKKSVT
FT                   KPAATKSTTKTTANKAAKSFGMQLGRMGKMFSGFKDEFDKASK"
FT   gene            complement(76677..78035)
FT                   /locus_tag="Apar_0068"
FT   CDS_pept        complement(76677..78035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0068"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: gbm:Gbem_3239 natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50504"
FT                   /db_xref="GOA:C8W8R6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R6"
FT                   /inference="protein motif:PFAM:PF01566"
FT                   /protein_id="ACV50504.1"
FT                   /translation="MVKQDHLLKNSRDPQQDVVTSHQNASQNIVDSNPSEMVASKKTNV
FT                   NKSSLKYILLAMGPGLLAAFAGNDAGGIATYSSAGATFGYSQLWTVPLMCFLLIVVQET
FT                   AARMGCVTGKGIASLVRERFGIRLSTLAMGALLLSNIAVTFSEFAGIASSMELFGIPTY
FT                   VSVPISALMVWLLTVGGSYRRIEKILLAISCIFVTYIIAGILAQPDWAEAFRVTIIPQP
FT                   SSDPSYISLLVANIGTTISPYMIFLVASNVVEKNLDTSDIPAQRADNVAGAILAEIITW
FT                   FIMLTTGAVLFPRGISVDSAADAARALEPLAGQYASTLFALGMVGASFLAACVLPGITA
FT                   SAICEAFGWERGADRSWQEAPVYHSIITTVLVISALVVLIPGMSLFGIMMAAQVINGIL
FT                   LPILLIFMVIIAADKHIMGKYANGRIWNALTWFTIVTVIILTIVMFILQAMGL"
FT   gene            complement(78047..79924)
FT                   /locus_tag="Apar_0069"
FT   CDS_pept        complement(78047..79924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0069"
FT                   /product="MgtE intracellular region"
FT                   /note="PFAM: MgtE intracellular region; CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   KEGG: gur:Gura_2041 MgtE intracellular region"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50505"
FT                   /db_xref="GOA:C8W8R7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R7"
FT                   /inference="protein motif:PFAM:PF03448"
FT                   /protein_id="ACV50505.1"
FT                   /translation="MIYLSQLMGNPVLDSEGEKIGSVSDLGIATGEVFPRITSLAFMGP
FT                   GRTPMMISWRKYVDTYDEDVIRLKVPSTEIRFSYLQPNEVLLARDILNKQIVDTRGIRV
FT                   VRVNDLKLSDTSSTQLRLLGAEVGARGLLRSLSPQLERLVTRIARAMGHPMQERIIAWS
FT                   YMDLVERDLSNVKLSVSHKTLDELHPADVADIIERLDSRLRSQVFAQLDDEQRAGAMAE
FT                   FNDDAMAVELIGGLNEKEASRILSEMDPDDAAELVSELSYDRAEKLLRLMGVKEQRAIR
FT                   QLLGYREDTAGRIMTSEALSVPENQNVAYAFEQLRNLDEDFETVRYLYLTDEDNRLSGT
FT                   VTLNRLIVSDPETRLEDIANKNLVTASPEDDQEEVARNIAKYNLLAMPVVSDEGRLLGI
FT                   VTVDDALDVLEEEHAEDLQIAGGGSRDSDNGERGRDLIWFLHRNLWLVFWVAAIILMAF
FT                   SVTAWFGDPLYGICAALCTITMPISLNISENTVNYVTNFFLSDDPGSEDSPSILGYAFR
FT                   SLLLGLLVSGLICLLGAVAHALLQVLMTSYDSTFGIYYGVVLNHIIMQIFAAAAGSTLI
FT                   SFLLTPIFLAVLRYRDQKNLETSGLTLTLISMGISTISFLIILCASTLL"
FT   gene            complement(80378..80923)
FT                   /locus_tag="Apar_0070"
FT   CDS_pept        complement(80378..80923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0070"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: sus:Acid_0971 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50506"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R8"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACV50506.1"
FT                   /translation="MIIIAAVVVIVLLVFWAISIHNNIIRASNKCDNAWAAIDTQLQRR
FT                   NDLIPNLVNTVKGYAAHESKTFEAVTSARAAVANARTPEEKMQASGTLSNALTNLFAVV
FT                   ENYPELKANENFLELQSELADTENRLSYARLSYNDVVMNYNNIIAVFPNNLLAGGRSPR
FT                   TSFQVTDESTRQAPNVQF"
FT   gene            complement(81200..81290)
FT                   /locus_tag="Apar_R0005"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(81200..81290)
FT                   /locus_tag="Apar_R0005"
FT                   /product="tRNA-Ser"
FT   gene            81481..81981
FT                   /locus_tag="Apar_0071"
FT   CDS_pept        81481..81981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0071"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   pne:Pnec_0542 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50507"
FT                   /db_xref="GOA:C8W8R9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8R9"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACV50507.1"
FT                   /translation="MSDEEQEPLTPQAALDQKYMKLALEQAELAAQIGEVPIGAVVVCG
FT                   GEVVAVAHNRREIDNDPSAHAEFLAMQKASKKLGRWRLSGCTVYVTLEPCLMCAGLMVN
FT                   ARIDRCVFGAFDPKGGATGTLFDVSSDSRLNHEFAVLGGVLAEEASAQLKAFFKERRQI
FT                   NKL"
FT   gene            complement(81984..83303)
FT                   /locus_tag="Apar_0072"
FT   CDS_pept        complement(81984..83303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0072"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="KEGG: glo:Glov_1090 protein of unknown function
FT                   Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50508"
FT                   /db_xref="GOA:C8W8S0"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S0"
FT                   /inference="similar to AA sequence:KEGG:Glov_1090"
FT                   /protein_id="ACV50508.1"
FT                   /translation="MKQLRPYPQVIVTKKAARALAGGHPWVFEGEVIRVEPSPESGEHA
FT                   QNGCIVDVFEENGTYQGTGLLSEMSKIRVRIVTRNANDRLNEAFWSRKISWAWKHRKTI
FT                   MGNRALPGTESDTNCCRVIFSEADGFPGLIVDRYENVLVAQVGTVGMERLRNVIYPLLL
FT                   EVLSSDGQVIDGIYERNDSPSRLKEGLPQYKGWWTGTSPDENGLIAESSLTSPSTHVLA
FT                   TENGLKFNLDLENSQKTGFFLDQKYNRRAVRQLAQGHRVLDCFCHVGPFGLNATAGGAD
FT                   FVRCVDVSQTAIDLARQNAELNGLADRIDFTCANVLEYLPELARDRTQLKAEGGPFDLI
FT                   ILDPPAFTKTRDKVRSAMRGYKEINATAMKLLPRGGYLATCSCSHFMTRDLLAQAIAEA
FT                   AHHTNVQLKQIEERQQAPDHPILWGVPESHYLDFFIFQVI"
FT   gene            complement(83388..83768)
FT                   /locus_tag="Apar_0073"
FT   CDS_pept        complement(83388..83768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0073"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="PFAM: protein of unknown function DUF1304; KEGG:
FT                   bba:Bd2510 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50509"
FT                   /db_xref="GOA:C8W8S1"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S1"
FT                   /inference="protein motif:PFAM:PF06993"
FT                   /protein_id="ACV50509.1"
FT                   /translation="MSILSTVGAIAAILAGLLHVFIFYMESIAWTSEKARSTFGMTKEE
FT                   ANNTKEMAFNQGFYNLMLAIETLFGVCFMFFGNVIGKPLAIFGVLSMFSAAALLFFSSP
FT                   DKRSAAIKQGTLPLIALILLFL"
FT   sig_peptide     complement(83706..83768)
FT                   /locus_tag="Apar_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.358 at
FT                   residue 21"
FT   gene            complement(83810..85162)
FT                   /locus_tag="Apar_0074"
FT   CDS_pept        complement(83810..85162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0074"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: ade:Adeh_2955 DEAD/DEAH box
FT                   helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50510"
FT                   /db_xref="GOA:C8W8S2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S2"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACV50510.1"
FT                   /translation="MEITFAELGLNEQILAGVTTLGFSVPTPVQTAAIPAVLAGKDVVA
FT                   SAQTGTGKTAAFMLPTLQRIAVEKHDKAEKPDGKRNAAAERNAVAERNAKRGTGKRNAY
FT                   PRALIVTPTRELAAQIDNVAKSVCASTGQQAVIVTGGAHYKHQIAALQKGCDVLVATPG
FT                   RLIDLLDKKHTSLEDIQVLVLDEADRMLDMGFWPSVHRIMEQLPKAHQTLLFSATLPAS
FT                   ITSTIDALLKDPERIEIARTGQTAATIEQHLCSVTQGQKPQLLKALIDSFDPAPERVLV
FT                   FCRTKSRVDSIYKNLKAAGLKVDVMHADRPQKARAKALDRFRSASIQILVATDVMSRGI
FT                   DIQGIDVVINFDVPLDPEDYVHRIGRTGRAGATGQAYTFMGPDEVTPLREIEYFTKALV
FT                   PAWDLPGFGYETGRIILQASRSTSKTTRSMFSGSRARGRNFGFSGRYGRHT"
FT   gene            85209..86192
FT                   /locus_tag="Apar_0075"
FT   CDS_pept        85209..86192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0075"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="KEGG: bha:BH2280 homoserine O-succinyltransferase;
FT                   TIGRFAM: homoserine O-succinyltransferase; PFAM: homoserine
FT                   O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50511"
FT                   /db_xref="GOA:C8W8S3"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S3"
FT                   /inference="protein motif:TFAM:TIGR01001"
FT                   /protein_id="ACV50511.1"
FT                   /translation="MPINIPDGLPAKKTLQEERIFALEEEVAEHQEIRPLRLAILNLMP
FT                   KKIQTETQILRLISKSPIQVTCDFMRISSHESKNTSADHLVTFYSTFDDFKDKNYDGLI
FT                   ITGAPIEDLKYEDVDYWDEFCRIVDWSQEHVFSTMYLCWGALAGLYYLHDIPKKILGAK
FT                   LFGIFPQRLCDEYCFLTNGFDEVHYMPHSRHAAIETSALVNHPELAVLSEGFTSGPALL
FT                   VTRDFHEIFVTGHFEYDRDTLAEEYWRDFHKGLPIRLPENYFPDNDPEKQPLFTWRAHA
FT                   NLLYRNWINWVYQMTPYNTNKIPAAITDLHQRVVEADPDARMTGRF"
FT   gene            86322..86882
FT                   /locus_tag="Apar_0076"
FT   CDS_pept        86322..86882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0076"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: swd:Swoo_0963
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50512"
FT                   /db_xref="GOA:C8W8S4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S4"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACV50512.1"
FT                   /translation="MKVVIASDIHGAADYCEKLMQVIEEEQPKYVLLLGDLLYHGPRND
FT                   LPANYAPKRVIEMLNSISDKVIAVRGNCEAEVDQMVLDFPCMADYNILFDKDPKTGKQF
FT                   TIFFTHGHVFGPGIHNSVDKWPQMPSLDAFVYGHTHRKVNMQSADHPEVTVFNPGSVGI
FT                   PKDGTHSCGIYEDGKFRHVILGE"
FT   gene            complement(87003..87722)
FT                   /locus_tag="Apar_0077"
FT   CDS_pept        complement(87003..87722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0077"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bsu:BSU05850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50513"
FT                   /db_xref="GOA:C8W8S5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACV50513.1"
FT                   /translation="MNKYDLIVQDIKQDISLGTYPAYSRLPSVAQLCQQYEVSKITINK
FT                   ALEVLEQQGLIFRRKGSGTFVKKLEEGTQIRPSKEVSGQMEGFMAEHTARGERVKSIVY
FT                   TFEVQHPSEYIAKALDISPEDFVYRIVRVRIVDDVSQVIEYTYMPIGLIPNLKMKHLEH
FT                   SIYAYIENTLELRIANAHRVIRAVMPTTLEAERLSITPNEPLLEVEQIGYIDDGRAFEY
FT                   SVARHAHGYEFMTISMH"
FT   gene            87861..89258
FT                   /locus_tag="Apar_0078"
FT   CDS_pept        87861..89258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0078"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG: bha:BH3918
FT                   beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50514"
FT                   /db_xref="GOA:C8W8S6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S6"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACV50514.1"
FT                   /translation="MQYQLPKDFFFGGAMSGPQTEGRWQDDGRIPSIWDTWSNLDITAF
FT                   HNRVGSYGGNDFSSRMEEDFELLKSIGMDSVRTSIQWSRLLDIDGNLNPEGERYYHQLF
FT                   ATAKKVGIEIFVNLYHFDMPEYLFNRGGWESREVVEAYAHYARIAFETFGKEIRYWFTF
FT                   NEPIVEPEMRYTVGGWFPFVKNYSRARAVQYNISLAHALGVREYRRAKAAGFMLEDSRI
FT                   GLINCFAPPYTKDNPSEADLEALRMTDGVNIRWWLDLVTKGELPQDVIDTLQSRGVDLP
FT                   IRPEDKLILADGVVDWLGCNYYHPERIQAPAKDTDENGIPNFADPYVWPEAEMNVSRGW
FT                   EIYPQGLYDFAMKVRDEYPELEWFVSENGMGVEREDLKKDENGVIQDDYRVDFVRRHLE
FT                   WIARAIQDGAKCRGYHYWAIIDNWSWANAFKNRYGFIEVDLEDNYNRRLKKSAKWLKQI
FT                   ATTHIVD"
FT   gene            89282..90721
FT                   /locus_tag="Apar_0079"
FT   CDS_pept        89282..90721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0079"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; PFAM: phosphotransferase system EIIC; KEGG:
FT                   ent:Ent638_1308 PTS system lactose/cellobiose family IIC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50515"
FT                   /db_xref="GOA:C8W8S7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S7"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACV50515.1"
FT                   /translation="MAKDNGQASFLDKFAEVSAKVGNQVHLRSLRDAFATVSPIYILAG
FT                   IAVLINNVLFPLIFANDPVTLANFKVWGAAIAQGTLSFSAVILAGIIGYCLARNKRFEN
FT                   AISCVVIGIAALIIMMPQSIVATAGAVLHATNAANAAAAAVTLPVAEVAKLLPNDYAVT
FT                   GVDVTGAFSSSFTGTNGLFGAIIIGLLSTTIFIKLSSVKQLKVNLGEGVPPAVADSFNT
FT                   MIPMMLTLSVFGIASALLAVCAGTDLMTIIATSISAPLKGLMNAGPFAVIVIYTFANLL
FT                   FCLGIHQSTISGVLIEPILTMLIVDNMATFAAGQPIPQDHYMNMQIINTFALIGGSGCT
FT                   LMLLFDTFIFSKNKASKDVAALSLLPGIFNINEPVIYGYPIVFNLPLMIPFVLVPDLFI
FT                   GLTYLLTNLGWISPCVAMVPWTTPVFLSGWLATGGDVRAVIWQIVEVLLAMAIYLPFMK
FT                   ISERAQVKQAEALAEKAQDAE"
FT   gene            90798..91094
FT                   /locus_tag="Apar_0080"
FT   CDS_pept        90798..91094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0080"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: plu:plu2754 PTS system,
FT                   cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50516"
FT                   /db_xref="GOA:C8W8S8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S8"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACV50516.1"
FT                   /translation="MKILLACNAGMSTSLLVQKLQKEAASRGLDAEIIANPLNKALELI
FT                   DGADVFLLGPQIAYAKADVEAAAGSIPVAVIPMVDYGRMNAAKILDDALELIK"
FT   gene            91150..91485
FT                   /locus_tag="Apar_0081"
FT   CDS_pept        91150..91485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0081"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG:
FT                   bcy:Bcer98_3752 phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50517"
FT                   /db_xref="GOA:C8W8S9"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8S9"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ACV50517.1"
FT                   /translation="MALDDGMTATQEAAFEIIATVGTAKSMYIGAIQKAKAGDIEGARA
FT                   DVLAGTEIFNEGHGTHLNMLQQSAIDNSNVEFSLILLHAEDQLMQAESFRIIAEDFIDV
FT                   YEKLLKK"
FT   gene            complement(91647..93119)
FT                   /locus_tag="Apar_0082"
FT   CDS_pept        complement(91647..93119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmv:BMASAVP1_0601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50518"
FT                   /db_xref="GOA:C8W8T0"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50518.1"
FT                   /translation="MNCPNCGVEIDEHTNFCPNCGQKLSDAADVADVADTADVADAVDV
FT                   SDAVDVADTADVADAANVEKTDAPAESTGPTPETAPDNSTTATEVIAPAESDTPTETVT
FT                   DPDATILAEHPADDAADDATDEESTTFINDPDRINVFTTDDLDSTAISHFDPSQFTVIS
FT                   NGPSSVERKQTKDGSDTLRKVAFGLLAAVLVVGALAIVWVIHSHQDDAARRNAVQQRIA
FT                   SYQEQIKSVDVNPTSDSSRVELLNQYEKLDQIEEQITGDQKNGQFRLPNGTDDSSVNVL
FT                   NSSISDGQKKIRDWFEADYKRRLAANSFNDTDSATTLDLKSVANRLVELQALLGDIENE
FT                   KEIWGNDTGTNSTYDSYHSRVSDQIKKGESLKSGVTEKNKNEQEKKDKDKKSEEDRKKA
FT                   EKWVGTYSGTGTDGKSMEVVIQKDGTVLWRIGGQPEVRGTWTGDESKLELNFNGQVSGR
FT                   SEPFTLSSTDGGKTVSISSQSSTWNTDTLSRK"
FT   gene            93207..93344
FT                   /locus_tag="Apar_0083"
FT   CDS_pept        93207..93344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50519"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50519.1"
FT                   /translation="MFLVLGTAVDAESGVIWHKAARLNLRLKAEKPLLLHNVLQSSCPK
FT                   "
FT   gene            complement(93286..94287)
FT                   /locus_tag="Apar_0084"
FT   CDS_pept        complement(93286..94287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0084"
FT                   /product="aspartate/ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="KEGG: bcr:BCAH187_A1928 aspartate--ammonia ligase;
FT                   TIGRFAM: aspartate/ammonia ligase; PFAM: aspartate--ammonia
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50520"
FT                   /db_xref="GOA:C8W8T2"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T2"
FT                   /inference="protein motif:TFAM:TIGR00669"
FT                   /protein_id="ACV50520.1"
FT                   /translation="MTKIPEGYRSSLSLYDTQKAIEQVKNVFLTKLCAALKLSRVTAPL
FT                   IVDPLTGMNDNLNGVEHPVAFDLPNVGKDAEVVQSLAKWKRYALWRYNFAVGRGLVCDM
FT                   NAIRRDEQPDNLHSIYVDQWDWERIITQDERNTDTLEDAVCRIVEAICGTLDELKWHYP
FT                   QLNTQLSREVTFVTSQELEDLYPTQTSKQRENLFVREHPTTFIVGIGGALNSGQPHDFR
FT                   SPDYDDWSLNGDLLFWDETLDCAVEISSMGIRVDAEVLKSQLAIAGCEDRLKLPFHKML
FT                   IDGELPFTIGGGIGQSRLCMLLLEKAHVGEVQASIWDKKTEERCAEAGVSLL"
FT   gene            94610..95041
FT                   /locus_tag="Apar_0085"
FT   CDS_pept        94610..95041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0085"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: hhe:HH0210
FT                   starvation-inducible DNA-binding protein Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50521"
FT                   /db_xref="GOA:C8W8T3"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T3"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACV50521.1"
FT                   /translation="MLNDKLNVLLANYAVEAHKIHNFHWYVSGPSFYNVHTDLDEVYGA
FT                   MYDQLDEVAELILMNGGSPLGSMDSFLKNATLSEAAEGFKSPQEIFKAILADYEAIRTL
FT                   AAEIKKDADAEDNFLVSAAMDEHIALLSKTIWMIKQSNK"
FT   gene            95323..95814
FT                   /locus_tag="Apar_0086"
FT   CDS_pept        95323..95814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50522"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR031989"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50522.1"
FT                   /translation="MSLTRREFIYAGASSLFALGLVGCGNSDTTSTSTSDAQKEDQKKS
FT                   EEKQPEKYAVTIGTLTQIADYNGDPAAKITFNFTNNSDETTSFMSSVRVEAYQDGQQLE
FT                   VAVITSGEVNWESTAKKIKTGTSLDVEQAYKLISSSDVEVEVYPLFGKDKLAAQTFSLQ
FT                   "
FT   sig_peptide     95323..95406
FT                   /locus_tag="Apar_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.391 at
FT                   residue 28"
FT   gene            96620..96787
FT                   /locus_tag="Apar_0087"
FT   CDS_pept        96620..96787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50523"
FT                   /db_xref="GOA:C8W8T5"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50523.1"
FT                   /translation="MESKQACGWSCRLRILPILFMLLGCVFVVYGASRGEVQTVLGKAV
FT                   RICLECVGIG"
FT   gene            96798..97784
FT                   /locus_tag="Apar_0088"
FT   CDS_pept        96798..97784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0088"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pca:Pcar_1070 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50524"
FT                   /db_xref="GOA:C8W8T6"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T6"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV50524.1"
FT                   /translation="MKVLSGIKSLGKKVWKFVTKRGFVQACAAFLTNPHLPNFVKGTIY
FT                   TGPAKSVCVPGLNCYSCPAATGACPIGAFQAVVGSSKFSFSYYITGILILIGTLLGRFV
FT                   CGFLCPFGWVQDLLHKIPFPKKFSTKKLKALRYLKYVILIVLVWALPALIQNAVGMGEP
FT                   YFCKYVCPQGILEGAIPLSLADSSIKAALGKLFTMKFSILCTIVLLSIMFYRPFCKWIC
FT                   PLGAFYSLFNRISILQYRVDKNTCVSCGKCARTCKMDVDITKNNAALECIRCGECIKVC
FT                   PVHAIDAKLLLINKKIEHSEKIATAKHLADCQTASSKKQPLKAESTD"
FT   gene            97858..98505
FT                   /locus_tag="Apar_0089"
FT   CDS_pept        97858..98505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0089"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   nma:NMA0493 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50525"
FT                   /db_xref="GOA:C8W8T7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T7"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACV50525.1"
FT                   /translation="MKKFVTKSLTYVVGLVMAVTLAGCSVGGTGNAGNTGNTTAPTAEQ
FT                   QNSGAVPPEAASKLHLKDGDTFPDFKATDISNGTTYDNKVFGQNKVTVMTFWFNGCTGC
FT                   IQEMPMLQELAETYKDKGVNVLGVNAEAAYTDDAKKEALDILKKQGVTYGNLALDPHSD
FT                   GGHVIEGLTAFPTTMVIDQNGKLVGDPITGGATKLQGSELQKRVDQALAQTK"
FT   sig_peptide     97858..97956
FT                   /locus_tag="Apar_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.598 at
FT                   residue 33"
FT   gene            98683..99363
FT                   /locus_tag="Apar_0090"
FT   CDS_pept        98683..99363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0090"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: glo:Glov_0998 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50526"
FT                   /db_xref="GOA:C8W8T8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV50526.1"
FT                   /translation="MKILVVEDEKELLASIGEGLELDGYYVDLVDNGTQALEMAQLEQY
FT                   DLILLDLNLPGIDGLDLLRTLRSEHSETKVLILSARSSVSDRIVGLDAGADDYLIKPFA
FT                   FGELEARIRTLLRREYIHGEASLTLGELRFDTTARQVFVGDAQVNLTKKELAILEYLMR
FT                   NAGAVVSSEELMAHAWDSNVDLFSNSVRVHIFSIRKKLREALGYDPISNKVGEGYCFKK
FT                   DSDD"
FT   gene            99356..100516
FT                   /locus_tag="Apar_0091"
FT   CDS_pept        99356..100516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0091"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sus:Acid_6896 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50527"
FT                   /db_xref="GOA:C8W8T9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8T9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV50527.1"
FT                   /translation="MIKISEITPKPMRSIRAQLTFLMVALLVCCCVVLTWLVYRSTSEL
FT                   LELAAANAINKGALSIVLDVGAIERSILFDALGILFFVIIAGSCAAYLLAGHYTKPVQQ
FT                   LSAHMKEIGPDTLSDSIEIEGGGEEVQELVKSFNQMTDQLDEAFAMQSRFSVSAAHELR
FT                   TPIAVLRTKLDVFKKKKRKQNEYDELVDTMETYIDRLSAIIANLLELTETSELGEVEDV
FT                   SLDAVITTVVDDLEPVAQNNMVNVQVNTQIDAHSDTPSEAQNLTVKGNANLLYRAIYNL
FT                   VENAIRYNHKEGSVNIAMETEGQECLVTIADTGVGIAPEQRELVFEPFYRVNKSRSREF
FT                   GGAGIGLSLVKTILKRHGASITVSENTPQGSVFTIRIPLVDAIDSE"
FT   sig_peptide     99356..99463
FT                   /locus_tag="Apar_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.509 at
FT                   residue 36"
FT   gene            100639..101307
FT                   /locus_tag="Apar_0092"
FT   CDS_pept        100639..101307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0092"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="PFAM: Transaldolase; KEGG: vpa:VPA1569
FT                   fructose-6-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50528"
FT                   /db_xref="GOA:C8W8U0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U0"
FT                   /inference="protein motif:PRIAM:2.2.1.2"
FT                   /protein_id="ACV50528.1"
FT                   /translation="MEFILDTADIDAVKQLDELLTIDGVTTNPSIITRSGKQPEQVIKE
FT                   FVEYLLPDQKFFVQVVSTDYQKMLEEARYICGLRPENTYVKIPVTRNGYKAIKQLKSEG
FT                   LGVLATAIYSADEAFLAAMNGADYLAPYVNRMCNYGDGIGQVFDLMQMLETHGLNSKIL
FT                   AASFKNTEQVHALISAGIDAVTLPPDIVYTMMDHPGTKIAVDEFSVAWREAYSRDTLLE
FT                   "
FT   gene            101349..102767
FT                   /locus_tag="Apar_0093"
FT   CDS_pept        101349..102767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50529"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50529.1"
FT                   /translation="MRDLLSLQSKIQDVYVRQIYCEAVASYNAQAYRSAILTAWLAVYV
FT                   DLMKKIESIGGNKIAEEFQTKVNKMRLEKNDSARIKSALDIEKGIISTAKDLSLIDEAE
FT                   EKFLRELHECRHKCAHPTTDDTVYIFEPTEEQVRYLLSGVIDNCLSFSALPKNNQIIQI
FT                   LMNDLSKDFPLEQDLFEFYKSKYIDKIPQNTQRQLIKIIAIEAVCPSSKEKWAECGLEI
FT                   SSPDLIAKRCMQILKCINTFSKDLLIEVFTNQSKKLSNGDSSYRFVGVFSSFDFFRDHL
FT                   DRDLYFICKAKFNKAIESEYDKPWELLLNGFPYDQELREESEKLFNSDYFLSHEKNLTE
FT                   LSKNGDLDNDELKKLVDCCIDKLEKSSSYSEADYLARLIVELAPVLEGNDILKISAILF
FT                   KNNQVFESFSMDRLIKNIALNSMKKETANYWKEFAENGMEKKKPELLNPDLSPSYDSVM
FT                   KWIYNRAIEELKKS"
FT   gene            102983..104887
FT                   /locus_tag="Apar_0094"
FT   CDS_pept        102983..104887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0094"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: gme:Gmet_3532 chaperone DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50530"
FT                   /db_xref="GOA:C8W8U2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U2"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACV50530.1"
FT                   /translation="MGKILGIDLGTTNSAMAVLEGGEPTIIVNAEGDRTTPSVVGFRTD
FT                   GDRIVGKAAKNQAVTNPINTVFSIKRFMGRKFDEVQSEIKTVPYKVKAGTDGRAVVEIE
FT                   GVDYTPEQISAMILAKMKADAEKYLGEPVTDAVITVPAYFNDAQRQATKDAGKIAGLNV
FT                   QRIVNEPTAAALAYGLDKKDQDHKVLVFDLGGGTFDVSLLDLADGVVEVLATNGDNHLG
FT                   GDDWDQRVIDWLADKFNSDNGIDLRKDPMALQRLKEAAENAKKELSSAQQAQINLPFIT
FT                   ADASGPKHLDYTLTRAEFERITRDLLDRCKAPVTKALQDAGLQLSDVSEVILVGGSTRM
FT                   PAVQDLVKSMTGKQPNMSVNPDEVVADGAAVQGGVLTGDVSGILLLDVTPLSLGVETLG
FT                   GVVDKVIDRNTTIPTSSTKVYSTAADNQTSVEIHVLQGEREMASDNKSLGKFNLTGIPA
FT                   AQRGIPQIEVTFDIDANGILKVTAKDKATDKSQEITISGSTALSDEEVDRMVKDAESHA
FT                   EEDKKRKDEIEVRNQVDSLAYSTEQTVKDLGDKVPKDQKKAVEEAVAEARTALDGSDIE
FT                   AIKKAGEKLTEVGQKLAEIVYADAQAQTAGNNDAASNSSEPDVVDADYEVVDDDKNQN"
FT   gene            105012..105860
FT                   /locus_tag="Apar_0095"
FT   CDS_pept        105012..105860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0095"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: scl:sce0004 chloroplast
FT                   GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50531"
FT                   /db_xref="GOA:C8W8U3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U3"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACV50531.1"
FT                   /translation="MATADQNKVDTTFDNENNGDETVGAVGVVGDGSASQTLDGNESAA
FT                   NGAVGADRTMTEEEMVAEAIRRGEETAEAEIAADAERAAQERDCLQNELNSVSDQIESA
FT                   KQQAAEANDRFLRLQADWDNYRRRTAQERLDERQRATEKLVVDLLPVIDDLERAIEHAD
FT                   NLTDPAAKQFVEGVDAICKKLVGVLNKEGVEVVNPVGEAFDPLSHQAVSQIEDTEAYDE
FT                   TVAQVYQKGYRMGGKDIRTAMVVVTHGGPKRPAEAEATDGVAADNADAADSAEATDGAA
FT                   E"
FT   gene            105893..106825
FT                   /locus_tag="Apar_0096"
FT   CDS_pept        105893..106825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0096"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: chaperone DnaJ domain protein; heat shock
FT                   protein DnaJ domain protein; SMART: heat shock protein DnaJ
FT                   domain protein; KEGG: chaperone DnaJ domain protein ;
FT                   K05516 curved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50532"
FT                   /db_xref="GOA:C8W8U4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U4"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ACV50532.1"
FT                   /translation="MAGSKTFYDVLGVKRDASKSDIQKAFRKLAAKYHPDRGGDEAKFK
FT                   EISEAYNTLSDDKKRQEYDQMLAFGGIPGGGFGGRQGGYTYTTNVNGANFADFFSGFGG
FT                   GAGAGAGGFDFADIFGGRVNRPVAGSDLTMSVNVSFDEAFKGTSRKATYRVPSTGEEQS
FT                   LTIKVPAGAYDGMKLRYKKKGEYGVNGGPRGNLVVTINVAAHPVFSRDGADVRMKLPVS
FT                   IYEAALGTSVDVPTPDGTTVRLKVPTGTQSGKTFRFKSLGAPRVKNPTTRGALYVSVDV
FT                   KVPTKLSKKERDALQALLDADERSYREER"
FT   gene            106825..107298
FT                   /locus_tag="Apar_0097"
FT   CDS_pept        106825..107298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0097"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: cha:CHAB381_0975 putative heat shock
FT                   protein HspR"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50533"
FT                   /db_xref="GOA:C8W8U5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U5"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV50533.1"
FT                   /translation="MARKKDDGRNKPLYMISVAAELTGMHPQTLRVYEQKGLINPGRSR
FT                   GNTRLYSRADIDRLNLVSKLTDEGINLAGVVRILDMRERALEKDDLIDELRERIRVLED
FT                   ELHEYHMRERITSLVRYSETNPEMVMQRLLGMPSSAPSDANAAEDNSAESKES"
FT   gene            107464..107805
FT                   /locus_tag="Apar_0098"
FT   CDS_pept        107464..107805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50534"
FT                   /db_xref="GOA:C8W8U6"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50534.1"
FT                   /translation="MDSIVTARVPVEVKNQVSEVLESLGSNTTKLINAAFEYVLVTGKL
FT                   PDAHEGASLESSAKGSSRQLSEKDKEQLSALFGKISVPAPASFWNDLGDSSYKEAISEW
FT                   RSKDYEALD"
FT   gene            107789..108235
FT                   /locus_tag="Apar_0099"
FT   CDS_pept        107789..108235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0099"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: glo:Glov_1224 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50535"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U7"
FT                   /inference="similar to AA sequence:KEGG:Glov_1224"
FT                   /protein_id="ACV50535.1"
FT                   /translation="MKLLIDANVLLDVFLCREQFVADAKKLFIMKQFKDAELWIAAQSY
FT                   TDLYYVGAKAHGSDRMQKILKEVFPLLNVCSIDGADISYALDEQWKDFEDCLIWRAAKK
FT                   IKADYIVTRNVADFTRSDIPVLTPGEFFSTMEAEQNLVYEEVEF"
FT   gene            108428..111010
FT                   /locus_tag="Apar_0100"
FT   CDS_pept        108428..111010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0100"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: ank:AnaeK_0413 ATP-dependent chaperone ClpB;
FT                   TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2
FT                   domain protein; AAA ATPase central domain protein; Torsin;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   Clp domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50536"
FT                   /db_xref="GOA:C8W8U8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U8"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACV50536.1"
FT                   /translation="MRLDKWAVTAQEALQAALGIAGDAEASEVTPTHLLKALLDSNERN
FT                   LRSILEKIGADPDSIATQVDQAISKAPKVSGAQIGIGNDLLKVINEAEKLATKLGDSYV
FT                   TSEHLLTALANDNTDAGRILRDAGITAKRVEEVYNDLRGDERVTSQDAKPQFEALEQYG
FT                   RNVTDLARQGKLDPVIGRVEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAERIV
FT                   SGDVPSTLRDKELVELDMSALVAGAKYRGEFEDRLKSVVKEVAKSNGQIILFIDELHTI
FT                   VGAGASEGSMDAGNILKPALARGELRAIGATTLDEYRKYIEKDAALARRFQTVLVSEPT
FT                   VEDTISILRGLKEKYEQHHRVRITDSALVAAADLSNRYISDRFLPDKAIDLVDEAASRL
FT                   RMELDSMPAEIDAVDRQLTQMQIEEQALMKEEDAASKERLENLRAEIATTQEKLDGMKA
FT                   NWQNERGAIDLVQDLKSQIEEAKTQMERVTREGNLAQASELRYSTIPELERKYDEAEKA
FT                   LLAKQEDGGILKEEVTTDEIAEVVSSWTGVPVSKMMQGEMDKLKNLEDQLHLRVIGQDD
FT                   AVSAVAAAVRRSRAGLADPNKPLGSFFFLGPTGVGKTELAKALAELLFDDERSLIRIDM
FT                   SEYMEKFSVQRLIGAPPGYVGYDEGGQLTEAVRRHPYSVILLDEMEKAHPDVFNILLQV
FT                   LDDGRLTDGQGRVVSFKNTIIIMTSNVGSQFIAGAGEEGLTEESRKQVMEALRSSFRPE
FT                   FLNRIDDVVVFQPLGLEDIERIVDIQLKDVRSRLANERMTLELSEAAKQSLALDGLDPV
FT                   YGARPLKRLIQRRVVDQVANLIIAGELSEGDTVLIDTDENGNLVARKK"
FT   gene            111023..111262
FT                   /locus_tag="Apar_0101"
FT   CDS_pept        111023..111262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50537"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8U9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50537.1"
FT                   /translation="MDKKPTATVTSTGAVSKDTAPENDVSLKKAPKSKNADLKKKQEVD
FT                   PEFARAQNEDDDGYDPYSDRRPVSEPLFERDPWS"
FT   gene            111583..116928
FT                   /locus_tag="Apar_0102"
FT   CDS_pept        111583..116928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0102"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding; Ig
FT                   domain protein; glycoside hydrolase family 2 TIM barrel;
FT                   coagulation factor 5/8 type domain protein; KEGG:
FT                   sus:Acid_4901 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50538"
FT                   /db_xref="GOA:C8W8V0"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V0"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACV50538.1"
FT                   /translation="MTSRLRKVSAICAALAFVLGVFYIAQPTYAEEQPAEVRSQSTTQM
FT                   NSAPENVNVNIINDTTNRVQNFNSNWKFKLGDASGAENTTYDDSSWESVNLPHDYSIDQ
FT                   PYSQSGEAESAYKPGGEGWYRKTFEVASNLQGKRFRLDFDGVYMDSTVWVNGHMLGTHP
FT                   YGYTPFAFDITPYIKPGEQNVITVRVNAQTPSSRWYSGAGIGRDVDLVVTNPVHVSKDG
FT                   VKATAPNLASEVGGSVTTQLTTSVTNSSDSPVNVQVVQTVFARGTSPQQAIASVTTERS
FT                   INANTTDTFNASAITSSSPALWDIDNPNLYTVRTEVKVDGNVVDTYDTTFGYRYFSFDA
FT                   EKGFLLNGMPVKIKGVCMHHDQGALGSVSTADAVRRQVQILKNMGANAIRTSHNTPSRE
FT                   LIEACNEQGVLLDYEFFDGWTAAKNGNSKDYARFFSTVMGESELIGGDANKTWAQFDIE
FT                   ASVARDYNAPSIVMWSLGNEMTEGTYGIYGLAQVQNSLIAWTQAVDPTRPVTTGDNRLK
FT                   RGSNELNPQGISDAGGIVGMNYAGGSTYDSIHSQHPDWKLIGSETASSINSRGIYSTHS
FT                   RDNSSQQLTAYDYSRVNWGHYASQAWYDVLTRDFVAGEFVWTGFDYLGEPTPWNGVDPG
FT                   AKGRWPSPKNSYFGIIDTAGLPKDSYYFYQSQWNDAVHTLHLLPAWNGDAVKKNRDGTV
FT                   DISVYTDAHAVRLYFTPAGSTEKQDLGLKTFTTKTTPTNGFTYQIYEGADKSTDEFRNL
FT                   YLTWQVPYADGTITAEAYDEAGNVIDTSSWDGRQSLTTAGQPKKLSVSANRSSMSANGT
FT                   DLTYLTVDVVDENGNRVPNANNKVTFDVFGSGKLAGIDNGSAPDHQSYRDANRDAFSGQ
FT                   VVGIVQAGTKAGEVTVRVSADGLEPTEVTIPVTPANTSDDTPQKTVGSLFYSRYYYVKT
FT                   GSSLTLPKTIQARYTDGTASDEPVVWDLYDAEKLNSAGTFTVSGTVAGVRATVTVTVLD
FT                   NIAALMNYSTTTPVGQNPILPDARPAVQADGTVLRANFPVTWNAVPEGSYNQEGTVTVT
FT                   GTANVFGRDMSVTATVRVQRETVTLGENVAPVASVSQDIPEDKQSDTLSAITDGSTSVA
FT                   ANQGGGANPTCWTTYKNAQAGNQTASITFRYATQQRIGQARVHFFVDSYSARLPKPGST
FT                   IIEVSENGEDWTRVDAQETVGQAQGRVTPYTYNFAPVTATYVRFTITNSDEVLAGRKPC
FT                   TGITEVELFSAVGSFTTNNTASFDSLSVNGKQVSEDALAAGEYNTPALLTNVEAQTKDN
FT                   AALTVLPPYQNKVKMLLESEDHTSRSTFTVNLGVDQPITGDSDAQDYPVDKMLVSAGSE
FT                   VEDRYVSPNEGKVLLAFDGNPSTYWHSTWAPSSTDDHWVQMELDEPTTIEALRYLPRPN
FT                   SPANGTVTEALVEYSDDGVTWHEAGRATWTSPTSPDYTPDWKIVKFNQPVTAKYFRLTG
FT                   VHTYADGGRNDKFMSAAEIRLRTTKETTDISHARIEAPSTLTVDSVSESNPAMFNPSDV
FT                   HVYVPSTKSGESRRTRRSVTDETELRYGIDYVLEYENNTSEGTATVRARGIDSYAGTTA
FT                   PTPFTVALTQVVVDSVSVASTPTKTAYTVGEKLDPSGLKLTLAMSNGTSQEVTYSEDNK
FT                   DDFTFDPSAEAAFDTAGTHEITVTYQGKSATFEVTVTQATNPANPTDPTNPTNPSDPTN
FT                   PTNPADPSNPANPTDPSNPDGNQSADNGANNVNSNTDQGNSSKKKRTSALPGMGDPVTL
FT                   VAACGLLTIGITCAGGGYWVRRRRH"
FT   sig_peptide     111583..111675
FT                   /locus_tag="Apar_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 31"
FT   gene            complement(117082..117645)
FT                   /locus_tag="Apar_0103"
FT   CDS_pept        complement(117082..117645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50539"
FT                   /db_xref="GOA:C8W8V1"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50539.1"
FT                   /translation="MDTSNNFENNVSPADQSPHSDTQQEFEYAESLEQEAQPANEAKLH
FT                   ATGTQNFSSPEASEYKDEDAAKQPYVRHHRPHKTVEPISDFTLPGEKLEIPENQAAGFE
FT                   SSKGAYAKKGWRKPKNEIAHLRKDIHYGQYLQVPKGQRDIFVRKERRSNAGSLIAAIIV
FT                   LAIIAAVVYFLWTWMSANWGIAIR"
FT   gene            117921..118355
FT                   /locus_tag="Apar_0104"
FT   CDS_pept        117921..118355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0104"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   bcr:BCAH187_A2372 heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50540"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V2"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACV50540.1"
FT                   /translation="MKNVVPYDRIARNLSTWPFGAIDSFFDAPYSALSSVSSDAFVMNV
FT                   EDAGQSYVVTAELPGVSKEDIDVELNEGRLSITATRKESEEEKTKNYLHKESSEWQATR
FT                   GVYLKDAAREGLSAKLDGGILTVTVPKQDQQASVTKIAID"
FT   gene            complement(118615..119457)
FT                   /locus_tag="Apar_0105"
FT   CDS_pept        complement(118615..119457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0105"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pau:PA14_51250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50541"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV50541.1"
FT                   /translation="MNPTFHLHILASGSKGNCTLLETPDGLIMIDCGISRKEILRRSKE
FT                   LNVNLSTIVAIFITHEHTDHVVGLPVVSKTFDVPVFATTGTAAALTGRKSCQNVTFTLI
FT                   DQAGSVHIDAAPDIEINTFPTSHDVCEPMGMRFDFLAGPDRRIVDSVGYCTDTGILTPE
FT                   ALECLSDVRILAIESNHNEHMLLTGPYPYMLKQRVHGDSGHISNEYTAQALSQLVGPNT
FT                   RCVVGMHLSHENNRPSVAVKTLAEAIGAKPLNEAFTEAQTPDGSLTVCVASQDWPMSL"
FT   gene            119701..121170
FT                   /locus_tag="Apar_0106"
FT   CDS_pept        119701..121170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0106"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50542"
FT                   /db_xref="GOA:C8W8V4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V4"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACV50542.1"
FT                   /translation="MALLHMAATESLDLGDGLGLAHVAKERLHVLHVNHLLREDDADAD
FT                   QHFVQETCDSLDIPCTVLRADVAKLARERDGNVEEIGRRVRYDAARELAQKLCAEQGVS
FT                   RQKAKILTAHTADDRTETFMMNVMRGSGMSGLTSIPRHRGLIYRPLLNYTHEQLKDWLK
FT                   ARNLDWHEDATNTDTHYLRVYMRHNVLPLLKARNPLLVQTVCKIADLMTDEDDYLEAKA
FT                   ARKLRQITLRKGESLLVLDALKLSSTDVVIARRVVRIVARQLIPEAWLEFRHVDAVLEA
FT                   VAAGAGVANLPQNLEARVRLGTVTFSFTGAARSVVSVDDAETSNKAAGTVHVTATFGEH
FT                   LAVPGTLELADGRVLSARILPVEHGFDVVSYATTHSQEWLGESVLLDVQACGVDPIHGG
FT                   SLWVSGLEAGDTMQPLGMHGQSKKISDLLGEAGVPVESRSMMPIVRTNIRGYVVWVAGI
FT                   RPDERVKCTQDTKHLLELNIYSGHKPFERSQ"
FT   gene            121170..121718
FT                   /locus_tag="Apar_0107"
FT   CDS_pept        121170..121718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0107"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: bsu:BSU00680 hypoxanthine-guanine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50543"
FT                   /db_xref="GOA:C8W8V5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V5"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACV50543.1"
FT                   /translation="MAELHPDIQEILLEEQDIKDIVKRVGAEITRDYADKNPLVIAVLR
FT                   GAVVFMADIMRAIKCPLSIDFMAVSSYGDGVKSSGVVRIVKDLDTKIEGRHVIIVEDVL
FT                   DSGLTLSYLVRMLKSRNPASIEIAAFLVKDIEGKRPAIDPCYVGTHVPDKFVVGYGLDY
FT                   AERYRNLPFVGVLKPSVYE"
FT   gene            122006..123190
FT                   /locus_tag="Apar_0108"
FT   CDS_pept        122006..123190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0108"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   glo:Glov_2600 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50544"
FT                   /db_xref="GOA:C8W8V6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV50544.1"
FT                   /translation="MVNQTSLAYGTEKSAIREIAGYAAQRRAEIGAQNVFDFSIGNPSV
FT                   PAPEAVRTSIEAAMQLPPQQVHSYTPAVGIPQAREAIAASLRRRFGNYAAQADDLILTC
FT                   GAAASVSMAINSIVSPGEEVIVIAPYFPEYRVWIDHAQATCVEVLADKKTFQIDIDAVC
FT                   SAITPKTRAVIINSPNNPVGAVYTRENLDAFADMLRKRSSELGTDIYVISDEPYREIVF
FT                   GDIEVPWVPDVYERTIVCYSYSKSLSLPGERIGWVLVPASNPEQKEIYAACAGAARLLG
FT                   FVCAPALFQRVIIDCVDEPADVEAYAKNREVLTDGLTKLDYEYIQPDGAFYLWVRAPGG
FT                   DAQAFCNVAKQFELLPVPSDSFGCPGWLRVSYCVAYQTCVDSLAAWEKALAAMK"
FT   gene            complement(123777..124589)
FT                   /locus_tag="Apar_0109"
FT   CDS_pept        complement(123777..124589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0109"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: ppr:PBPRB2022 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50545"
FT                   /db_xref="GOA:C8W8V7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V7"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ACV50545.1"
FT                   /translation="MRITCDVHTHSLYSRHAYSTVEENVRVAAERGFELLGVTDHFSSM
FT                   LYDQQTIKNFQFFMNTAIWPETWHGVRLLHGTEADIVDLEGNLFAYDITFDQGINGDKL
FT                   RQPHILGEHILATCDYVVASIHSKQWAAGASQKQITQMYVNALDNPHVLILGHLGRSGL
FT                   DFDIPALVRECRDRGKLIEMNEATHDEGQREVAIKRCRVIAETCAELGCKISFGSDAHI
FT                   ATRIADAHSVIKQLEEIDFPEELMACRDAQTFLDTIANAKIPASKQGY"
FT   gene            complement(124691..125470)
FT                   /locus_tag="Apar_0110"
FT   CDS_pept        complement(124691..125470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0110"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="3.1.11.2"
FT                   /note="KEGG: bcz:BCZK3496 exodeoxyribonuclease III;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50546"
FT                   /db_xref="GOA:C8W8V8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V8"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACV50546.1"
FT                   /translation="MSQTQEYKLISWNVNGLRAVLKKEPSFTEIFETINADVFALQETK
FT                   LQEGQVELDLPGYVQTWNYADRKGYSGTAVFSRETPLQVIRQIGCPVADDEGRVCALEF
FT                   EKFWFVCVYTPNSKDQLARLDERLEWDQHYRDFLAELSKQKPVITCGDFNVAHNEIDLK
FT                   NPSSNRQNAGFSDEERESFTKLLDAGFTDTFRYRHPDITGAYSWWSYRFNARKNNAGWR
FT                   IDYFLVSDRIAEQVKSASILSEIYGSDHCPIELSIEL"
FT   gene            125674..127146
FT                   /locus_tag="Apar_0111"
FT   CDS_pept        125674..127146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0111"
FT                   /product="dihydropteroate synthase"
FT                   /note="TIGRFAM: dihydropteroate synthase; 2-amino-4-
FT                   hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase;
FT                   PFAM: dihydropteroate synthase DHPS; 78-dihydro-6-
FT                   hydroxymethylpterin-pyrophosphokinase HPPK; KEGG:
FT                   bbr:BB1461 dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50547"
FT                   /db_xref="GOA:C8W8V9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8V9"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACV50547.1"
FT                   /translation="MLRQSYNTWQCGAHTISLARPRIMGVLNVTPDSFSDGGKNFDPEA
FT                   AIARGLQMLDEGADIIDVGGESTRPGHTPVLPTEEAERVVPVVRALVAAGAIVSIDTRH
FT                   AEVAKMCVRLGVSIINDVTGFTDPEMVAVAAESDCGCIVMHWNKEGLGARVERKQVQLD
FT                   DMRPSRPTGSAAARAAATGTETRTLSSQRRFTLPEEAPIMRQIMGFLGDQARGLMRAGV
FT                   SKDRICIDPGPGFDKFADEDVVIQRATRSMVSMGYPLLCAVSRKRFVGAVSGVTETTQR
FT                   DAATHAICIAAITNGARILRVHDVAGTAQAINAYWAMTEHDPRQGFVALGSNVGDRVGY
FT                   LARATQLIDEIPLTCVVSVSHAYETEPAYGIATPVVNAVAEIRTELHPLVLMDKLLEVE
FT                   NALNRTRKKGEEGHGPRTIDCDLLWVEGEQHAGKHLTLPHPRMGERDYVLVPMEDLMHD
FT                   PVRFFSHGDVDIVPPDQRVGHVTEDLGAITWE"
FT   gene            127137..127847
FT                   /locus_tag="Apar_0112"
FT   CDS_pept        127137..127847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50548"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50548.1"
FT                   /translation="MGVAQEALELARGGAQTGEFVFRASDVQEDSVQGQKVCLELASPS
FT                   TGEKPLEVATVVRLGVSMPYVPAVPYVVALGVCQFLRAADDNFGIYWPYDICYKDQVVA
FT                   SIKATAGYQEGMFTVVSVAANAEALNSVFDVADNKELLAKKVSELIVQSVGTWEQQVKH
FT                   TQSFAGPIALILSDYFDVVPLLGQQVNKVYPSGNVALTARFGGIDVWGHAILVDENGKE
FT                   ILVSEDEASVVPAV"
FT   gene            complement(127883..128665)
FT                   /locus_tag="Apar_0113"
FT   CDS_pept        complement(127883..128665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0113"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: bcy:Bcer98_0061
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50549"
FT                   /db_xref="GOA:C8W8W1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W1"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACV50549.1"
FT                   /translation="MFLSIDVGNTQTAIGLFDNEGTMVRGWRMPTDQSDTSDILHGRLF
FT                   TFFQKDGLNLDDIEAGGLSCVVPIITRAWKRCFELLLNKPLTSINALSTDKIRFNIPHP
FT                   ELVGADRIANSVAATERYGYPVIVVDFGTATNLDVVDKDGVFRGGAISPGIMISANALF
FT                   ARAAKLSSIPIKAPETVLGNTTESAVQAGIVVGAAAQAEGLVTRTLKEPGIEGATVIAT
FT                   GGLANTVSEATDIFDVVDPQLTMRGIYLIWKQSVEVTK"
FT   gene            128907..129326
FT                   /locus_tag="Apar_0114"
FT   CDS_pept        128907..129326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0114"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: ade:Adeh_0689 50S ribosomal protein
FT                   L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50550"
FT                   /db_xref="GOA:C8W8W2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W2"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACV50550.1"
FT                   /translation="MKQGIHPEYVECTVRCTCGNTWTTRATVPEMRLDLCDKCHPFYTG
FT                   QQKLVDTGGRVQRFADKFGGAANATLEAAKAAKEAKAAKAAEQEAARKAAAEAKAAEKA
FT                   KRAAEFAKNAPVAEPEPEAEAEAEAEAPATEEAAE"
FT   gene            129463..131730
FT                   /locus_tag="Apar_0115"
FT   CDS_pept        129463..131730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0115"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dal:Dalk_1998 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50551"
FT                   /db_xref="GOA:C8W8W3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W3"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACV50551.1"
FT                   /translation="MESLYTKYRPQTFEQVVGQKHVVGTLKRAVLEQKLSHAYLFCGPR
FT                   GTGKTTMARLLAKAILCHEAPGHLPDGTCEDCQLIAAGQHPDVFEIDAASNTGVDNVRE
FT                   EIISRASYAPVCGKGKVYIIDEVHMLTSAAFNALLKTLEEPPSHVTFIMCTTDPQKILA
FT                   TILSRVQRFDFRSIAADEMAEHLISVCKNEGFTYEDAAIDLIVRYARGGMRDALSSLEQ
FT                   LSVYGGGVISEQTVRDVLGQSSGSLINSAALALAQRDISSLFTTVNTLFEGGKDLLQFT
FT                   RELAAHVRDLYVATAVGVDSPALANSSASTEQLTKEAQAFGSVDRLSRVLTVLGDAANQ
FT                   MRTAVNQRLVLEVTFTKLARPNTELSLEALADRVAVLEQQLANGVVSAPVVQNSAAPVH
FT                   ASTPAAPAAPQPTSAPAAAPVVAHTSTPVPTPVAAPAPAPTQQSAPELPSQPEPKPTAA
FT                   TVPVSAPAPVAAATSSQPAPVPKEVDQSDALLARQWKEVSKVCTSKNAAHAALLVSSTL
FT                   ESDDGSELVITLPKGSSFAMRMLSTPAVSDFVKECVAQVIGPRRIKYVESSLAATAISR
FT                   EKRAAQAAPAPTPVAPVALVASSAFESVAQPASAAAPAQAPASAQASAPVVSIPAAPAP
FT                   ETSYSMPWDEPVPGGAPVEASNYNQVPYSDDDVAVVLDDSVKDTVPTPQPTAASVPETE
FT                   QTSTPKSDPIPASPEDVATRSALPPELNSVADMLERVFGPAVSLSVEKKPDTEIPADPA
FT                   SK"
FT   gene            131826..132164
FT                   /locus_tag="Apar_0116"
FT   CDS_pept        131826..132164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gme:Gmet_3421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50552"
FT                   /db_xref="GOA:C8W8W4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W4"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV50552.1"
FT                   /translation="MARGGFNMGGMNRNQMMAQARKMQEQLLEAQQKASLMQATASAGG
FT                   GAVKVTASGDLRLTNITIDPEAIDPEDIEMLQDMILAAVNDALESAESQASAQMSAVTG
FT                   GLNIPGLF"
FT   gene            132168..132779
FT                   /locus_tag="Apar_0117"
FT   CDS_pept        132168..132779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0117"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: mxa:MXAN_1930 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50553"
FT                   /db_xref="GOA:C8W8W5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W5"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACV50553.1"
FT                   /translation="MAFDTTNDGRALQRLLDELGRLPGIGPKSAQRIAYHLLEVDSEEA
FT                   RRLAQVILELKQQVHFCPICFNYATRNECDICLDSSRDRSKICVVSEPKDVSAIERTGA
FT                   FHGLYHVLGGVISPMDKIGPEQLHVRELLSRLADGTVTEVVLATNPDVEGETTATYLSR
FT                   TINPLGVRVTRLASGLPVGGDLEYADEVTLGRAIEARREV"
FT   gene            132782..133453
FT                   /locus_tag="Apar_0118"
FT   CDS_pept        132782..133453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50554"
FT                   /db_xref="GOA:C8W8W6"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50554.1"
FT                   /translation="MANHMRTSSSGENTPEASSVDMKNISTLRAGQGAQIPQSPRQADN
FT                   TPEPPNRKSVIILVVAAIVALTALFFIVRCATSTKDESTNQQPKQTQSAYADEKQQDEQ
FT                   TVDGSVTFQGIKYSLEKQSDGKTAVVRTSDSGTKSVLFEVEGTPTSLILFNGTILVPEN
FT                   RDSGWDVVACALVDGSLPTLIADKDGKTVGGNGTITAATLDGTTLKVTDSTGNITSVAL
FT                   Q"
FT   gene            133722..133798
FT                   /locus_tag="Apar_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            133722..133798
FT                   /locus_tag="Apar_R0006"
FT                   /product="tRNA-Asp"
FT   gene            134044..134757
FT                   /locus_tag="Apar_0119"
FT   CDS_pept        134044..134757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0119"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; KEGG: mxa:MXAN_2679 HAD-superfamily subfamily IB
FT                   hydrolase, TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50555"
FT                   /db_xref="GOA:C8W8W7"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W7"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACV50555.1"
FT                   /translation="MPAESSITESTSDSIKKIAVFDFDGTVISGQSGFLFSAYLLRRHL
FT                   SSVSRTLKLMWWGARYKLHLPQRQEEARELVVGALTQYSIEFANAVMHDFHREVIEGMY
FT                   RPQALEEVRRRQAEGCCVLLVSATFEPIAELAAKKLGVDAFLATKMQVGADGHYTSKVD
FT                   GPVIEGAQKLVSATEWCNQHYGKGNWELAYAYGDHYSDATLLSAAQTPCAVCPGPTLTR
FT                   LANKRGWTILNWEND"
FT   gene            134833..135429
FT                   /locus_tag="Apar_0120"
FT   CDS_pept        134833..135429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0120"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   hha:Hhal_0540 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50556"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W8"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACV50556.1"
FT                   /translation="MEISRKTDYAIRMLSSLVRNPKKLLSVRDAAEENDIPYSFARSIQ
FT                   HDLVIAGVIVSTRGARGGMMLAIDPTQVSVLDIVEAVQGPVFISNCEWAGPNNEPCPRH
FT                   NSCYFGPLWCSAEKTLRNFFASVTLHQVVVEGLMPEMVGEFQLVKNENAQRNEQIIQNA
FT                   ADAIEAEITAGTFDNLLDGEVVSAEKKPYEFNRAW"
FT   gene            135534..136535
FT                   /locus_tag="Apar_0121"
FT   CDS_pept        135534..136535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0121"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; helix-hairpin-helix
FT                   motif; SMART: HhH-GPD family protein; KEGG: gsu:GSU1613
FT                   A/G-specific adenine glycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50557"
FT                   /db_xref="GOA:C8W8W9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8W9"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACV50557.1"
FT                   /translation="MKKKISHTKTNEDLDTVSDISTSLSDELAVTFKKTELTTELRAFV
FT                   ESVAKKGRELYRDLPWRRTYDPYAIWISEVMLQQTQVSRVDGRWQRWLEHFPTVDALAA
FT                   AAPSDVLEEWQGLGYNRRALSVHRAAQAISEAGGVFPQDQKELVKLPGIGPATAAGIRA
FT                   FAFNLHGVYLETNVRTVFLHELYPQAEGVPDSELIPLVELTCPASVSTAAGTDTANAAT
FT                   TELTPRSWYYALLDYGAYLKKTIPNPSRRSKSHVKQSRFEGSHRQKRAELLRVLLAHKD
FT                   EGGAEFETLHQELCQIEVHAGRETLDEQVTLGLLEELAKEGFCQKNDEYWLP"
FT   gene            136691..137236
FT                   /locus_tag="Apar_0122"
FT   CDS_pept        136691..137236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0122"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: gbm:Gbem_2313
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50558"
FT                   /db_xref="GOA:C8W8X0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X0"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACV50558.1"
FT                   /translation="MAVEFENSQTKKNLEAAFAGESQASIKYGFYAKQASKGGYEQIAD
FT                   IFNETSGNESVHAKLWFKYLHGGKMPETAECLKDAAAGENYEWTTMYADFAKVAEEEGF
FT                   AEIAAKFRLVGNIEKAHDERYTKLLERVESGEVFEREGVKVWKCLKCGHLHVGASAPKV
FT                   CPVCGHPQAYFEEQALNY"
FT   gene            complement(137433..138104)
FT                   /locus_tag="Apar_0123"
FT   CDS_pept        complement(137433..138104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0123"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: dds:Ddes_0198 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50559"
FT                   /db_xref="GOA:C8W8X1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X1"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACV50559.1"
FT                   /translation="MPRESKKTKVERGVELCRRMHKLYPSVQSALDYHDAFTLLISVML
FT                   SAQTTDAAVNKVTPELFRRWPDAPSMAAANIVEVGEVIQTIGFWRAKAKHCVETAQILL
FT                   TEYGGEVPGTMEDLVTLPGVGRKTANIVLNKMFNVVDGIAVDTHVYRISKRMRLSSAST
FT                   PLAAEKDLLALLPHELWKDVNEEWIHFGRETCTARNPKCVGCPMSDICPSYEQPNRWFK
FT                   G"
FT   gene            138305..141748
FT                   /locus_tag="Apar_0124"
FT   CDS_pept        138305..141748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0124"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bsu:BSU00550 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: DEAD/DEAH box helicase domain protein; transcription
FT                   factor CarD; TRCF domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50560"
FT                   /db_xref="GOA:C8W8X2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X2"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACV50560.1"
FT                   /translation="MFINRVAAQLLSAPELEKLKRELSCGSDATLSLSQSARPLMLAAL
FT                   WSQNPRPCLLVVAGEDAADRTARSLAAWLGNDAVLRYPNRKDYPWSDATPDDAIIGARC
FT                   RAIAKLSAGEKVIVVASAHALMRRVPPVGSGYFLPATFTVGDDVPFEDVASLLVGMGYA
FT                   DTGEVDAPGTFHIHGDTVDIFPAQATSPVRIEFFGDEIDRIRRMVAATGQTIGAIDEVT
FT                   VAPARELAFTKEAIRRAEEALYTRAQENSAIAADLELIQRGAQAPALERYLPVLYGGTA
FT                   SPLEHISSETLVVLAEPRSLFDDCQRAFDEISSSAAASKVKLDGLYTDPKAMDFGSQQR
FT                   LSFSSLLRTGAAVTSELSVVQPSIAGSDTKLLGRVRQLVQDRDAVVFAVPDRAAREHLK
FT                   LLFSDESIPFEESLGTSLENEPDQNGVYVPLKRGRVTFTDAPVPAGIIIPTANLSVLSV
FT                   SDLTARSARNKKRSKRIDPTTVTFPFKPGDYVVHATHGIAHFTAIVRQEVAGRERDYFL
FT                   LEYANDDKLYVPLEQVDRITRYVGPDGNNPRLTRLNTADWSRATNKARKSAKKLAFDLV
FT                   DLYTRRASVPGYAFSLDTPAQEEMESSFPYQLTPDQESAVADIKLDMEARKPMDRLLCG
FT                   DVGFGKTEVALRAAFKACQDARQVMILCPTTILAQQHYETFFSRFAPFDLKVSVLSRFV
FT                   TPAQQRKALEGFADGTIDVLVGTHRLLSADVNPHDLGLVIIDEEQRFGVQHKEQLKNMR
FT                   EQVDVLTLSATPIPRTMQMAMSGVRDMSLILTPPPGRKPVQVTVGEYNPDLVSAAIRSE
FT                   LEREGQVYYVSNRVTTIDEAVARVEEAAPEARVGVAHGQMSAREVENVMLAFQEHEIDV
FT                   LVATTIIESGIDNSHTNTLIIEDSQRLGLAQLYQLKGRVGRGRQQAYAYFMFPAELPLT
FT                   EEATERLTAINEFQDLGSGMRIAMRDLEIRGAGSLMGAEQHGNLSSVGFDLFTQMLGEA
FT                   VAEARGESAELEQTEVTINLPADFFLDEDYLPEVDRRVLVYRRLAAATELSDIDALQQD
FT                   TENSFGALPLAGKNLFDRARVRIRAQRLGATSVSLTNGRLVYLGVEIPREQALKLKGRG
FT                   AIVYPKSHKLAYPFHRNEEQLMPAALGVLEELGGDDEVEE"
FT   gene            141751..142833
FT                   /locus_tag="Apar_0125"
FT   CDS_pept        141751..142833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0125"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; KEGG: mmw:Mmwyl1_3508
FT                   oxidoreductase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50561"
FT                   /db_xref="GOA:C8W8X3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV50561.1"
FT                   /translation="MSQTAGQMSQSATSSAHNTASTMQSAMSDGDAIFTAPHLKWGVIG
FT                   CGVIANQMAEALASVGRTIDGVANRTQEKAVAFAQKHHVKRVYDSIDDLLASDEIDAVY
FT                   LTTPHNTHIIYLRKALQAGKHVLCEKSITLNSAELLEAEELARQNGVQLMDACTILHMP
FT                   LYKELVGRVEAGEFGPVNLIQENFGSYKEFDMENRFFNPKLAGGALLDIGVYSLTLARL
FT                   FLKSQPHDVLSMMNPAPTGVDQTDGILLRNAEGQMVVLALTLHSKQPKRAMISADKAFI
FT                   EIMEYPRADVATITWTDDGKQEKVHVGRTADALAYVLADLEAAVAGDASAQAQLEVSKD
FT                   VMELMTSLRNDWNFLYPEEQ"
FT   gene            142839..143741
FT                   /locus_tag="Apar_0126"
FT   CDS_pept        142839..143741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0126"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: bsu:BSU00580 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50562"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X4"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACV50562.1"
FT                   /translation="MTSNEKIAQLATVVDEETKARPGAPQTHPEFDRLVRTIWRLRQED
FT                   GCPWDKEQTHQSISKNMIEEAYEAVEAIAEGSPEHLEEELGDVLEQVVLHSQIEADGGV
FT                   DSAGEGDRAAGFNIDDVCRALNQKLVRRHPHVFGPEAGSTSSAAAVLDVWESVKAEERA
FT                   SAEDTVHTEGLLDSVPQSLPALMQAQKISKRAAKMGFEWESVADVWDKVAEERAEFEAE
FT                   APGTQQKMDEFGDILFALINVARWEGIDAEEALMSACRKFRARWSYMEKVAAEKGFSLD
FT                   EKPELQEDLWQEAKRYLNV"
FT   gene            143919..144797
FT                   /locus_tag="Apar_0127"
FT   CDS_pept        143919..144797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50563"
FT                   /db_xref="GOA:C8W8X5"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50563.1"
FT                   /translation="MSQDTTKKSGTKRKTTPTKRSVEPLKETTAERPSGAVKISPTKKA
FT                   EKPQVDKKSQSGQKSVESKKTKTTLKAASSQENHKDVKPTRSARAQKSERGQRSEGIQK
FT                   PHFSVASLVEIKDKALDFARNHTKLVTFLGIVIFLIVGLYSPVRGYYHAVREHDELLFN
FT                   QQKLEEETKRLLQDVQRLQTKEGIIDEAHKQGMVSKDEESARVEGLEKKKDENTVQHPD
FT                   YPWYIKVGDFIFGFSPENSGNTEAPKSANSDDPTSAPAPGESHEQKNSGESGSSEGSGG
FT                   DSSKPENGNSH"
FT   gene            144797..145840
FT                   /locus_tag="Apar_0128"
FT   CDS_pept        144797..145840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0128"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: ank:AnaeK_0692
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50564"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X6"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACV50564.1"
FT                   /translation="MLLAAIDIGTVTARLALAQVEDGRVIRMAKYTQIVNLGEGVDKAK
FT                   RLLPEAIHRCVGCVSSYVDHAKKEGAEAVVCTLTSAARDAENAPDLGMGLASLGLEPMI
FT                   IPGEIEGALTFLGVSHDFENHRILVADSGGGSTELVVGTLVGQSVAQGTNQQLEDQQLD
FT                   GQQLDINFVESVDLGCRRLTERFNLSSDHLSAEDIDGAHQMADQMMSEAISRAQKQCAV
FT                   PELLVGVGGTATSLIAIRDHLDPYDPSKVHLNHISLDEVSQIEGLLASKTLKEREDITG
FT                   LQAKRAPVMLAGTILLAELMKSSGFKHLVVSESDLLFGLVVTASAVYQGKQSPVIWKPI
FT                   LRPLNEK"
FT   gene            145864..145948
FT                   /locus_tag="Apar_R0007"
FT                   /note="tRNA-Leu1"
FT   tRNA            145864..145948
FT                   /locus_tag="Apar_R0007"
FT                   /product="tRNA-Leu"
FT   gene            146099..147838
FT                   /locus_tag="Apar_0129"
FT   CDS_pept        146099..147838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0129"
FT                   /product="UbiC transcription regulator-associated domain
FT                   protein"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; Transketolase domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   gme:Gmet_0551 transketolase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50565"
FT                   /db_xref="GOA:C8W8X7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X7"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACV50565.1"
FT                   /translation="MSFETGVFPVLVSEDEAVESLPPQVRGGLNASSATPLHVQLSDLM
FT                   RVKILSEDWKAGTYIPSEAEFMAQYGVSRGTIRKAIQSLVKEGLLLTQKGRATQVISNT
FT                   VRHAAGNTVLSFAAALRDGGFEYRTEVLFKQVVPADQAVAEHLEIPIGSDVLFLRRVRS
FT                   VSDRPVVCQESWSNLLVCPQLEEADFENESLFDAVERISKKEIARSRMRYQSQIADKDH
FT                   ADYLQCSPNEALLVLEQVIELSDGNCIEWSQTWLAPHQSVVGVSEQVDGSIGPLDISSV
FT                   RQSEHSTSNIVALKNDIKQRTQLELDLRHEALSVRRGIVELAHRYSSTPFHIGGACSVA
FT                   DIVSVLLSKVMQVGNRDCEWELRDRLILSKAHTSLALFPALLRAGMISQEDIDRGVFGP
FT                   DAVLFKHPLRDSQRGFEISGGSLGMGLGYAAGLGLSFRRKDLPSRVFCILGDGECDEGS
FT                   IWESAAFIGHNQLSNVTVIVDQNRMQLDGPCASILDTGSIARKFDAFGFESIEVDGHDV
FT                   LALYDALKEKASKPRVIIAHTIKGKGFSFAENNVSFHDACVTDDLYEQALSDLKVAEEA
FT                   CSC"
FT   gene            147832..148887
FT                   /locus_tag="Apar_0130"
FT   CDS_pept        147832..148887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0130"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: gdi:GDI3010 putative transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50566"
FT                   /db_xref="GOA:C8W8X8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X8"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACV50566.1"
FT                   /translation="MLDTSSKPACISAEESQMLADMNTKEVFGWVMGKLAEDDELLTVA
FT                   VADYGRRLNLDRFRELRPEGYIQCGIAEQNLIEVASACANEGFHVFAPCYATFVTSRTL
FT                   DQIRINLGMMKSPVMLVGVAAGCESATTGPSHMALEDIAVTRTIPGLSVFNPCDNAQLA
FT                   ATLMELAKNPRPAYVRMTSCDGVNLHPNGYVFDASGVEKLFESPRVEGASGVAGASELE
FT                   DAVQLRRVSVLATGAITSRVVEAAQRVADQITTARTNIKVYGVSSIKPLDTSLTQICQY
FT                   SDVVITVEEHSILGGFGSAVVEQISASGTCPQVIRVGMPDKYLEADVHHNILARAGLSV
FT                   ESLQEVFIANC"
FT   gene            complement(148933..149007)
FT                   /locus_tag="Apar_R0008"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(148933..149007)
FT                   /locus_tag="Apar_R0008"
FT                   /product="tRNA-Glu"
FT   gene            complement(149076..150104)
FT                   /locus_tag="Apar_0131"
FT   CDS_pept        complement(149076..150104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50567"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8X9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50567.1"
FT                   /translation="MIKHSANDMFSEQVDRLVAKCAQEKNIFSEAARYELKLAVEASPE
FT                   DFIADEEEKAFAQYANAIGKYQTEITKEIDSDADFFSSRMDLLNFLHNQITNIIENPAL
FT                   SSTSINLESQRILAQISNNHPAAILNDLLELQKEFDPIFRPKLEQAKQEQGDAWSFAEA
FT                   RPLLRLYAQIAQVATDCACFKLSKKACEDLLFFSPTDLLGARFTLAYVLARLEDEEGLR
FT                   KLDESCGYQSNAWIRLAFTLLFFKLNRMSAAKRALKGFINLGEGAAYALLRPSFVDLYI
FT                   PCRVNFTPDTFAENVIAVHEAEAIIADVPEFISWAESVPGVIQSARDYAFKAGLDWWEN
FT                   EE"
FT   gene            complement(150101..151282)
FT                   /locus_tag="Apar_0132"
FT   CDS_pept        complement(150101..151282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0132"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50568"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50568.1"
FT                   /translation="MAFDPVKEDYQRLILRFARTQVSDEGSIAMLMKDFNWRFSNDRNS
FT                   LPQTDEDRAFNLVAQAAEIVDYRLPFVEESQAQTLIEQGKHLLNQAIQLDSNCFDAQRM
FT                   LYASNSKLFDAYYQFLVEKLPEVEAACYQKAQESSQGLPVEQAGLAQRLAINPYKRWLA
FT                   ALSSRALICGRNKDAITYGEKLLELDPADAADARFTLALAYAKLEDEDALKKLIDKYRK
FT                   LDPPRRADDPWTLLAHLSIHFKKHELVKAEHYLDLLIERYPEATLCCFVQKDLPEGEFS
FT                   RLNVLPYSEDELIIAIAEATVLLQEGNDLIGRGVLGRWIADQVRARDPKTVELAEKELQ
FT                   MQANALLASTDSFPDGPLAGGAAPSDPSFPGSPRPSGPHIDGPNNPHSGGDTE"
FT   gene            151570..152784
FT                   /locus_tag="Apar_0133"
FT   CDS_pept        151570..152784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0133"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   alcohol dehydrogensae"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50569"
FT                   /db_xref="GOA:C8W8Y1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y1"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV50569.1"
FT                   /translation="MGRFTNPRDLYFGEGARHEVKNLKGKRAVIVSGGSSMRRGGFLDD
FT                   VENDLKSAGFEVAHIEGVESDPSVETVMNGAAKMSEFQPDWIIAIGGGSPIDAAKAMWI
FT                   KYEYPETTFEDMCKVFGLPELRTKAHFCAISSTSGTATEVTAFSIITDYQKGVKYPIAD
FT                   FQITPDVAIVDPELTYGMPVKLVAHTGMDALTHAIEAYVSTAASMYTDGDALHAIREIV
FT                   EWLPKSYAGEKEGRQHMHDAQCLAGIAFSSGLLGIVHSMAHKTGAAFSGGHIIHGCANA
FT                   MYLGKVIQFNARDERAKARYAFIAKEILHLEGNTEDELVEALVQKIRDINDALNIPQGI
FT                   KNYGEGGTKSETSIIDEKEFFEKAPEVARLAIEDACTLSNPRKPTQEEMEQLLKCVYFD
FT                   LPVEF"
FT   gene            153037..153678
FT                   /locus_tag="Apar_0134"
FT   CDS_pept        153037..153678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0134"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: bcr:BCAH187_A2002 deoxyribose-phosphate
FT                   aldolase; TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50570"
FT                   /db_xref="GOA:C8W8Y2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y2"
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /protein_id="ACV50570.1"
FT                   /translation="MEINGLIDHTNLKQNATAEDIKKLCAEAKQYKFATVAINSCWVSL
FT                   AHAELEGSGVGITSCVGFPLGAASTAAKVAEAKQSVADGTTEIDMVINGGHLVAGDDDY
FT                   VISDIKAVVEAAGSVPVKVILECCLLDDEQIVRACKDCMAAGAAFVKTSTGFSTGGATV
FT                   HDVALMKQTVGDTCKVKAAGGIHNKADAEAMVAAGADRLGCSSGIAIVTE"
FT   gene            complement(153709..154593)
FT                   /locus_tag="Apar_0135"
FT   CDS_pept        complement(153709..154593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0135"
FT                   /product="(Formate-C-acetyltransferase)-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sew:SeSA_A4819 pyruvate formate lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50571"
FT                   /db_xref="GOA:C8W8Y3"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y3"
FT                   /inference="protein motif:PRIAM:1.97.1.4"
FT                   /protein_id="ACV50571.1"
FT                   /translation="MTFTATETALGATHPTGCVAPVNKIIPFSLVDGPGSRTAVFLQGC
FT                   NIRCAYCHNPETQVECISCQACVKPCPAHALSMANGKVVWDNSICINCDNCIKVCQHKS
FT                   TPKIELLSAREVADRCISNMPFIRGITTSGGECMLRPDFLYELFTYCNAAGLSCLIDSN
FT                   GTIDFTEYRDLLALSDGVMLDVKAWDDQWYEHLTGENGVIVRKNLAFLAEQNKLEEVRV
FT                   IVTEGWNDAEAAVDGIALTLGEKVGQTRIRLMKFRHFGVRGPMENSPSPSDERMREIES
FT                   QARSLGFGEVVVS"
FT   gene            complement(154613..156115)
FT                   /locus_tag="Apar_0136"
FT   CDS_pept        complement(154613..156115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hiq:CGSHiGG_05855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50572"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y4"
FT                   /inference="similar to AA sequence:KEGG:CGSHiGG_05855"
FT                   /protein_id="ACV50572.1"
FT                   /translation="MSEFMDIITSDNLSYKQKVLHLAQAAENSEHPIKTTAEFDRLFKA
FT                   HAIDDMCEGNAPYRPRYICPDYQVFAQNGSEFLRFDKPENLDDLLWGLATLYDNVPSVT
FT                   SRPVYVGQLDKIIDPFLEGMTDDEIKPRLRRFLNHIDRTVASGYCHANIGPEDTRAGRL
FT                   LLEVERELMNAVPNFTLKYDPEITSDEFMRLAVKTTMVCSNPAFANHRIHKETYPGEYT
FT                   VVSCYNVLPMGGGAYTLSRVLLPGLAKLATNVDDFMNNLLPTATSEVLNFMNERVRFIV
FT                   EDSNFFETSFLAKEGLISRDRFCGMFGVAGMSECVAELLHLDSSRTYGKDDEANELADQ
FT                   IMVKIADQVNSFDAVYSEVFGGRFTLHAQAGFSDQKGVTPGVRIKVGDEPANLYDHIRH
FT                   SARMHRFFNSGVSDIFPAEPTAERNPDAVIDVVKAAFSIDDKYLSFYSSEGDLVRITGF
FT                   LAKRSEMKKFQSGNVVLQDTAHDGLGNFTANHLADRKVRMSN"
FT   gene            complement(156246..156977)
FT                   /locus_tag="Apar_0137"
FT   CDS_pept        complement(156246..156977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0137"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; KEGG: tgr:Tgr7_2797
FT                   transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50573"
FT                   /db_xref="GOA:C8W8Y5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACV50573.1"
FT                   /translation="MNVLTYLDSLDSDVRKKIIKWASRVPANRLSHCRQIRLNSGQTLV
FT                   HMLDRVDNVYILCRGTVRTTSHNSAGSTYVIDEYHAPVAFGEMEVISESSFYLGSLTAT
FT                   SGCEFISVPREDYLQWIRSDPEALLARSRWIIKNLTRQSGYERSLLTWSGTKRLMYMLS
FT                   ELTRDQIHRGVVEWPFTVRLTRQELADKIGTSTKTVARGIDELKARGMVSVQHGKIVIT
FT                   ERQFQRLDDAMKHEGETHILD"
FT   gene            complement(157251..158177)
FT                   /locus_tag="Apar_0138"
FT   CDS_pept        complement(157251..158177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0138"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   slo:Shew_2724 indigoidine synthase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50574"
FT                   /db_xref="GOA:C8W8Y6"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y6"
FT                   /inference="protein motif:PFAM:PF04227"
FT                   /protein_id="ACV50574.1"
FT                   /translation="MSNLKDFLVVSDEVKEALEQNKPVVALESTIISHGMPYPQNVETA
FT                   LKVEQIIRDNGAIPATIAIINGQMRAGLSADEIDYLGKKGREVAKVSRRDLPVIIAEKK
FT                   DGATTVTTTMMIAHMAGIDVFATGGIGGVHRGAETTMDISADLEELAQTPVMVICAGAK
FT                   SILDLGLTLEYLETKGVPVLGYQTEELPAFYTRKSGFSVDYRVDTPAELAEIFTTQQQI
FT                   GMNSGLLVTNPIPEQYAMDKDTIDAAIEKALAEAKANGIHGKESTPFLLAKVAEITGND
FT                   SLESNIQLVFNNVALGAKVASEVCRRK"
FT   gene            complement(158252..159334)
FT                   /locus_tag="Apar_0139"
FT   CDS_pept        complement(158252..159334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0139"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: PfkB domain protein; regulatory protein MarR;
FT                   KEGG: slo:Shew_2725 ribokinase-like domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50575"
FT                   /db_xref="GOA:C8W8Y7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y7"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACV50575.1"
FT                   /translation="MLTNREQMIFNWIKEQPSITQKEIAERAGISRSSVSVHISNLTAK
FT                   GAILGRRYILSERPYFIVIGAANMDIAGRPETSLVAGDSNPGKVTISFGGVGRNIAHNL
FT                   ALLDSDVRLLTAFGEDYRARELKEGCLDCGIDIDASITVPGASTSTYLFIMNEHGEMQE
FT                   AINDMQIYEYVTPERIEERLDVIQHAAACVIDTNLPQQTIEFIAKNVTCPIFCDPVSSI
FT                   KAQKLKKVLGKLYTLKPNRLEAEMLSGIKITDDASLEAAAHELLATGLKRVFISLGEKG
FT                   LLCADHEKTIRLPLLPAKLINMTGAGDAMMAGITWAYTQGMTLEQTGLVGMAASSIAIE
FT                   GEETINSQLNVEEVIKRAGI"
FT   gene            159752..160942
FT                   /locus_tag="Apar_0140"
FT   CDS_pept        159752..160942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0140"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="KEGG: bcy:Bcer98_2786 phosphopentomutase; TIGRFAM:
FT                   phosphopentomutase; PFAM: Phosphopentomutase domain
FT                   protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50576"
FT                   /db_xref="GOA:C8W8Y8"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y8"
FT                   /inference="protein motif:TFAM:TIGR01696"
FT                   /protein_id="ACV50576.1"
FT                   /translation="MPKRVFVVVLDSFGIGEEPDAAAYGDEGSNTLCACATSGVLNIPN
FT                   MTKLGLLNIDGALDTVYDVDLKPIESPMGAYARMQEKSAGKDTTVGHWEMAGVISPKKF
FT                   PTYPDGFPQEVIEEFEQKTGRKVLCNKPYSGTDVIRDFGKEHVETGALIVYTSADSVFQ
FT                   IAAHEDVVSPEKLYEYCRIAREILQGEHGVARVIARPFEGEWPYQRTSRRHDFSLEPTG
FT                   TTMLDRLKENGFDVLSIGKIYDIFAHRGMTEFEFTTCNADGIQKTIEATSKDFNGLCFT
FT                   NLVDTDMIYGHRNDPVGYSNALSYFDEHIPQIIKGLREDDLFIITADHGCDPVTPSTDH
FT                   SREYVPLLITGPKVKPNTNLGTTTTFADMAETILDYFGVEQLGVGTSHLSEILKEN"
FT   gene            160942..161652
FT                   /locus_tag="Apar_0141"
FT   CDS_pept        160942..161652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0141"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1; KEGG: purine
FT                   nucleoside phosphorylase ; K03784 purine-nucleoside
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50577"
FT                   /db_xref="GOA:C8W8Y9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Y9"
FT                   /inference="protein motif:TFAM:TIGR00107"
FT                   /protein_id="ACV50577.1"
FT                   /translation="MATTPTPHNAAVEGQIAKTVLMPGDPLRAKLLADTYLENVEQFNT
FT                   VRNMFGYTGTYKGQPVSVMGSGMGMPSIGIYSYELFNFYGVDNILRIGSAGGLAPEVKL
FT                   RDIVIGMSSSTDSNYPSQYGMPGTIAPTADFGLLSKAVAGAEKLGYPVRVGNILASDVF
FT                   YTADNSHSKWASMDVLAVEMESAALYLNAMYAHKHALTLLTISDLPLTGEALTAEERQT
FT                   SFTQMMEVALSVVA"
FT   gene            161820..162893
FT                   /locus_tag="Apar_0142"
FT   CDS_pept        161820..162893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0142"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   bcy:Bcer98_2443 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50578"
FT                   /db_xref="GOA:C8W8Z0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z0"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACV50578.1"
FT                   /translation="MNKNVSRRSFVTGATGAGALAALAGLAGCNQKKDDGGQKSSGEKK
FT                   KKLTMVTDTGGVNDQSFNQSAWEGMTELKDKNGWDVSYLESKQDSDYATNLDKAVDAES
FT                   DLVWGIGFAMADAVVKAAKDNSNTQFAIIDNANDSEVANLTGVMFRAQEPSFVVGYIAA
FT                   RTTKTGKVGFVGGISSALIDQFEYGYRGGVAYANNENNTNVEISAQYAESFSDAAKGKA
FT                   IANSMYSDGCDVVFHAAGGVGTGVIEAAKDANKLAIGVDRDQAYLAPENVLTSALKRVN
FT                   VAIVEISEKILKNGQKGGSTISLGASEDAVGIAEDHHLMADDTYKAATALLDKIKAGSV
FT                   VPPASKDDLDKYVKSLS"
FT   sig_peptide     161820..161894
FT                   /locus_tag="Apar_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 25"
FT   gene            163045..164574
FT                   /locus_tag="Apar_0143"
FT   CDS_pept        163045..164574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0143"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcr:BCAH187_A3838 sugar ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50579"
FT                   /db_xref="GOA:C8W8Z1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50579.1"
FT                   /translation="MEVSSDYAVQMHGITKVFGSFKALDAVDLNVRKQTVHAILGENGA
FT                   GKSTLMNVLYGLYSADEGEVYLNGERVSISDPNDAIAHGIGMVHQHFMLVENFTVTENI
FT                   VLGNEVTKTGGILDPKRAREKVLEIVEEYGFDVDPDAKIEDISVGMQQRVEILKALYRG
FT                   ADTLILDEPTAVLTPQEIEKLIQIMHDLVSKGKTIIVITHKLKEIMSSADECTIIRRGK
FT                   YMSTVDVSKTSETELATLMVGRNVNLHVEKKPATPGEVVLSIKDLHVKDERGIEQVNGF
FT                   NLDIRAGEIVGLAGIDGNGQKELADAINAMVKPESGTITVKNEEIQGTTPKTVIDHAVA
FT                   TIPSDRHRWGLVLPFTVAENMILERHNEEIFGKGIALDLAKMKEFSQKLIDEFDIRPAE
FT                   CSDHQAAGLSGGNQQKVIIAREVSSNPDVLIAIQPTRGLDVGAIEFVHKALIRERDRGA
FT                   AILLISFELDEIMDVADKMAIIYAGKNVGEFDQGTITEEQAGLLMAGGDAE"
FT   gene            164571..165773
FT                   /locus_tag="Apar_0144"
FT   CDS_pept        164571..165773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0144"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcz:BCZK3549 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50580"
FT                   /db_xref="GOA:C8W8Z2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV50580.1"
FT                   /translation="MSTLTKIMRKPITSAIVAIFVGLLVASIILVVAGYDPISSFEALI
FT                   SGMVGKPKYISNVIIKATPLLFTGIAVAFAFRVGLFNIGAEGQYIVGTILAVIVGYSLD
FT                   LPPVLQIPVVVLVGTAGGAGIGAIIGWLKAQFGINEVITSIMFNWISLFLCNFVVSLPQ
FT                   FHQPNSTSSYPINESGYTTLFYGMKNSEDGAEAIRNIPVIGDAIMRTDANIGIVVAIIA
FT                   AFFIGWLLMRTKVGYEMRAVGFNRDAAQFTGINVKKNLTLCMAISGALCGLAGALTITG
FT                   IAPHSIATLAAFENNGFNGLSVAFIANCNPVACIPASFLFAGLLYGGQTVQQVVGAPSE
FT                   IINIVIGTIVFFMALGGVIPMLADHLDHKRAQKAKEEEAKLAAQVSDASDPSQEEANNA
FT                   H"
FT   sig_peptide     164571..164675
FT                   /locus_tag="Apar_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.461 at
FT                   residue 35"
FT   gene            165763..166686
FT                   /locus_tag="Apar_0145"
FT   CDS_pept        165763..166686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0145"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bcb:BCB4264_A3887 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50581"
FT                   /db_xref="GOA:C8W8Z3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV50581.1"
FT                   /translation="MLTNLILLVSVTLMYSTPLIFGALGGVVSERSGVVNIGIEGMMGV
FT                   GAFAGVAGSYLTGNPWIGFLCAGIAGGLIALLHAIASITFNADQTVSGVAINLLAPGIA
FT                   LFACRLLFDGAAMSPAVDKLPKLFGEGAFNNTPYSSLNVDITVVLALLTALLVWFVLYR
FT                   TKWGLRIRSVGEHPHASETLGISVRKTRYLCVIVSGVLAGFGGASVTLAIISQFTQTAI
FT                   SGQGFIALAAVIFGKWKPLNTYAACLLFGFTQALAILLGGGATPIPSQIIAMLPYFITI
FT                   ITLVLFVGKSVAPKADGVPFIKGSRA"
FT   sig_peptide     165763..165840
FT                   /locus_tag="Apar_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.534 at
FT                   residue 26"
FT   gene            166686..167231
FT                   /locus_tag="Apar_0146"
FT   CDS_pept        166686..167231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0146"
FT                   /product="cytidine deaminase"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; Cytidine and deoxycytidylate
FT                   deaminase zinc-binding domain protein; KEGG: bha:BH1366
FT                   cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50582"
FT                   /db_xref="GOA:C8W8Z4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR013171"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z4"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ACV50582.1"
FT                   /translation="MAEVKGSCHVSNEALVQLAIEARNHAYVPYSHYAVGAALLCSDGT
FT                   VYGGANLENAAYTPSNCAERTAFFRAVFEGHRDFVAIAVVGGPEGEAPTAWCTPCGVCR
FT                   QVIREWCDPATFRIVLGKADVAPREYLLQDILPMGFGPEDLGESSPAGASSDDAVKGTT
FT                   GHEHGCTCGCDKHSKSNQ"
FT   gene            167367..168692
FT                   /locus_tag="Apar_0147"
FT   CDS_pept        167367..168692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0147"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="KEGG: bca:BCE_4154 pyrimidine-nucleoside
FT                   phosphorylase; TIGRFAM: pyrimidine-nucleoside
FT                   phosphorylase; PFAM: glycosyl transferase family 3;
FT                   Pyrimidine nucleoside phosphorylase domain; Glycosyl
FT                   transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50583"
FT                   /db_xref="GOA:C8W8Z5"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z5"
FT                   /inference="protein motif:TFAM:TIGR02644"
FT                   /protein_id="ACV50583.1"
FT                   /translation="MRMYDVIEKKRDGGELTDAEIDYFVSGYVAGDIPDYQASALAMAI
FT                   FYKGMTAHETAHLTMAMAESGDMMDLSAIPGIKVDKHSTGGVGDKTTLVVAPLVASLGV
FT                   KVAKMSGRGLGHTGGTLDKLEAIPGLSIEISEPDFFKQVSEIGVAVAGQTGNLVPADKK
FT                   LYALRDVTATVDSVPLIASSIMSKKIASGSDCILLDVKCGSGAFMKDVDSAIELADAMV
FT                   SIGEHVNRTTAALITGMDRPLGKNVGNSLEVIEAVATLKGEGPKDLTDVCIELAANMLN
FT                   LAGKGSVDDCRKLARQQIANGEGLAKLAQMVKAQGGTDEVIFDTTKFEAAPFRRDIVSE
FT                   TSGYITSMNAELVGISSVALGAGREKKGDPIDPSAGIILERKTGDYVEKGDVIATLLTG
FT                   DESRLDEGERIFREALAFGESAPELEPLFFARVSKDGVERFA"
FT   gene            169275..169982
FT                   /locus_tag="Apar_0148"
FT   CDS_pept        169275..169982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0148"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: bca:BCE_3136 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50584"
FT                   /db_xref="GOA:C8W8Z6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50584.1"
FT                   /translation="MTQTMSVPAVLSVCKLDRRTARTRAALRKALAEEIDATGDLTSVT
FT                   VTGVTERAGLTRRTFYSHYKDIPDLVLHIEKEALAELRPAVEQLARVNLAELREAIDSY
FT                   KPCPGATEMLRSIRKHGFYLRPLLGNGGDPAFQEKLKHLVHEVIAQRALHDLDPRALGS
FT                   FFDYYLTFAISAEVGVLIRWLIGGMRESDEQMAGLMTGLMFVAPGDLYGKPIKLDVPRF
FT                   ALATLVLGEENND"
FT   gene            169975..174729
FT                   /locus_tag="Apar_0149"
FT   CDS_pept        169975..174729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0149"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   ccv:CCV52592_1797 CoA-substrate-specific enzyme activase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50585"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z7"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ACV50585.1"
FT                   /translation="MISPKFELVENGAELVPNVPLDLSQAHLMLGIDVGSTTVKLSVID
FT                   EDGTLVYANYERHHTDVRATARSLFVKAQKYIGDTPMYAAITGSGGMLLAQWLDLEFVQ
FT                   EVIASKRAVETLIPQTDVAIELGGEDAKIIYFDNGIEQRMNGTCAGGTGAFIDQMASLL
FT                   KTDATGLNELAKDVKQIYPIASRCGVFAKSDVQPLLNEGAAPADIAASIFQAVANQTVS
FT                   GLACGHPIRGYVAFLGGPLQYLSELRRRFYITLNLDDEHIVLPKNAHLFVATGAALAGE
FT                   SDRPITFTQVMEALDNLKDLQGSEVARLDPLFATQQDYDDFKTRHDQEVVPKGQLANYH
FT                   GRVFIGIDAGSTTMKAAVVGEKGELLYTWYDNNNGDILGTARKIMDSIYDEMPSDCIIG
FT                   HVTTTGYGEGILIEALRADSGEIETVAHLRGAKAFVPDVDFILDIGGQDMKCLQVKDGV
FT                   IEHIMLNEACSAGCGSFIASFADSMKMDVREFATAATKAKLPVDLGSRCTVFMNSRVKQ
FT                   AQKEGATIGDVAAGLSYSVIKNALFKVIKLRDFSEIGEHCIVQGGTFMSDATLRAFELL
FT                   TGRDVIRPDIAGVMGAYGAALLARDRAGIDGVSTLLDRESIDNLQVKLTNTHCRICPNS
FT                   CMLTINDFGGGHRFITGNRCEKGAGKKRGAKKNQAPNLFAYKNKLLFDRESLPVDEASR
FT                   GTVGIPRALNMYENYPFWHTFFTKLGFSVILSDQTTAKTYDAGIESMPSESACYPAKLS
FT                   HGHIMNLLAKDPDFIWMPCIRWERKEDDSATNHYNCPIVMSYPQALGLNVDELSDPSIQ
FT                   YLAPFIPYDKKNELKRRLYELISEQREKDAQAGKGRFRGEHITRAEIDAAVEAAWQEDS
FT                   NFKDQMHRAGDEALAWIEEHDAHGIVLAGRPYHNDPEINHAIPELVSSFGFAVLTEDSI
FT                   AHKMLPERPIRIVDQWMYHSRLYRAARFVASRNDLDLIQLFSFGCGLDALTTDQVQEIL
FT                   EASGKIYTMLKVDQVSNLGAARIRIRSLMAALNEQQAELERLAAAGLVTEAVPQGVRMA
FT                   DGSLEKARSASSSRRAPVYREAESAAYEKVRYTKEMQEAGYTILAPQMAPIHFELVEEL
FT                   LKGAGYNVVLLPSVDQGAVDMGLRYVNNDICYPSILVTGQIMEAVLSGKYDLTKTAVLI
FT                   SQTGGGCRATNYIALIRKALKDAGHPEIPVISISAASGLDEDNPGFKLFKPDLLIKAVY
FT                   ALLYGDLIMQLLYRVRPYEAVKGSANELYDQLMADMRSKINRISRKEFYKQCQRTIELF
FT                   DSLPVVNDRQKPRVGVVGEILVKFHPTANNELIKVIESEGCEANVPGLVDFFLFGLSNA
FT                   INTHKELGTTFKSRMTHIAGIKMVQGLRAPINKMLEKSERFEPYPNIDELAEKAGQILS
FT                   LCNTMGEGWLLTAEMCDLIETGTPNIVCAQPFACLPNHVVGKAVIKRLRQMHPESNIVA
FT                   VDYDPGASEVNQLNRIKLMISVAKENYKNGVNGEFKLENADDPVTNDATMPYTGRDKYG
FT                   LDSVVREGGHSCSSHHVSALEATGANLGDHGRTASDHGKDYGSIRLSEEQIAAIERAKK
FT                   KAGVK"
FT   gene            complement(174758..175768)
FT                   /locus_tag="Apar_0150"
FT   CDS_pept        complement(174758..175768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0150"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: ppr:PBPRB1561 putative ribose operon
FT                   repressor, RbsR"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50586"
FT                   /db_xref="GOA:C8W8Z8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z8"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV50586.1"
FT                   /translation="MTRVSIRDIAAETGYSPATVSNVLNEKGNVGAKATNIILEAITRL
FT                   GYSRSTQISRIIFAIARVNGHIVDESTFQSAVYTGIERAARRLGLPSAMVTLDLPDPVT
FT                   SRKNIAELEQNEGAGIVLLATEIVSDDQFSLLEEFSLPLVIVDSWSDKLPFDCVVTANE
FT                   TAAYRACTLLVEHGHEVIGYVGHVERCKNYPLREHGMRRVLDDMRFPFAEENRVLVDSA
FT                   PEEAYHQLVDWLEQKRNSLPTAFFCESDSLAATVVRALHELDIEVPSDVSVVGFDDDRI
FT                   CKLIQPSLTSVHVPKHEMGEIAVKRLIDQTTDAHYAPCISQLHTTVVSRKSVKQL"
FT   gene            176020..176301
FT                   /locus_tag="Apar_0151"
FT   CDS_pept        176020..176301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0151"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: oan:Oant_4121
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50587"
FT                   /db_xref="GOA:C8W8Z9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W8Z9"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACV50587.1"
FT                   /translation="MKKVVVACGSGIATSTAVEAKVKDLLDSNGLAGAYTIVKCSIGEA
FT                   VSQCADADILIATTEAPASITCPYVSGVPFLTTIGKAAAEQQILDILK"
FT   sig_peptide     176020..176082
FT                   /locus_tag="Apar_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.952 at
FT                   residue 21"
FT   gene            176372..177796
FT                   /locus_tag="Apar_0152"
FT   CDS_pept        176372..177796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0152"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: vei:Veis_2223 PTS system galactitol-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50588"
FT                   /db_xref="GOA:C8W900"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:C8W900"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ACV50588.1"
FT                   /translation="MEVVISFFSFLQGLGVAVMMPIILTIIGCALGAGFGKSLKAGLMV
FT                   GVGFIGLNLVINQLFGTAIGPAVQEMIHRFGLTLNVIDVGWPAGAAIALGTTIGLVIIP
FT                   LALIVNLLLVLVNFTQTVNVDIWNYWHYAFVGSLVANVTNNIMLGFAAAIIDEVILLVL
FT                   ADATAKDVQKALNMPGVSISQGFSLAYAPVAMGLNWLIDKIPGVRDIDIDVESMQKRFG
FT                   VFGEPLFIGTVIGLIIGCVAYFDAADIAGSITKILTIGVTLGSVLILIPRMAALLMEGL
FT                   LPISEAASNFIQQRVKNRGNIWIGLDSAVAVGHPVTLSLALICIPLMVLFALLLQPVGN
FT                   QTLPFVDLAAGTYMLAVAVPVCKGNGFRGLIIGIVSVIIGLLISTALAPLITQSATQAG
FT                   FDIAAAVGSTGVAGSSLITVLSDGGSPLSGLFVLFSSINPIVGVVVTGAIAVALAVWNR
FT                   SRILKEAAAMHEAQEA"
FT   gene            177900..178472
FT                   /locus_tag="Apar_0153"
FT   CDS_pept        177900..178472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50589"
FT                   /db_xref="GOA:C8W901"
FT                   /db_xref="UniProtKB/TrEMBL:C8W901"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50589.1"
FT                   /translation="MSTPESSSTSKRSSADAAAIAVATATKPVTYTYNRRRYVIDVLLP
FT                   NYVSIVVLIAAIILFALGFIRWLMLFLAVVCLYSILNAFLAHAYPEQVILAPDSITFVT
FT                   GKHKSTYKLSQITQIRVREASQGLRSYVRINKATPLQGRFYLTCADMTDAEGNDAREVY
FT                   KLLLDLEAKLDPNGLRVRARNQQQKGE"
FT   gene            178475..178948
FT                   /locus_tag="Apar_0154"
FT   CDS_pept        178475..178948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0154"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: oan:Oant_4120
FT                   putative PTS IIA-like nitrogen- regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50590"
FT                   /db_xref="GOA:C8W902"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C8W902"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACV50590.1"
FT                   /translation="MATTDAELLKPELVFFDIEAKDAFELFNQLETRLSNLGYIKDTWK
FT                   EAISTREKNYPTGLAFPAGEIAIPHTDPVNLEKPYIAIVKPSSPINFEPMGGDGDTVPA
FT                   KLVINLGIMRDGGQVEMLQSLMGIFMDEAKSADVFGQTTAEGMVAAFSKYLSE"
FT   gene            179005..180267
FT                   /locus_tag="Apar_0155"
FT   CDS_pept        179005..180267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0155"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="KEGG: bcb:BCB4264_A3843 peptidase T; TIGRFAM:
FT                   peptidase T; PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50591"
FT                   /db_xref="GOA:C8W903"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C8W903"
FT                   /inference="protein motif:TFAM:TIGR01882"
FT                   /protein_id="ACV50591.1"
FT                   /translation="MPETMSNQLPDVAERFMRYVQVDSQSNPENDTVTPSTPAQHEMAR
FT                   YLGEELKALGCTDVTVDEHAYVTGTFAASKGAESAPALMLCSHLDSVIDAPASGIKPHV
FT                   VYYEGGDLVAGVVNGKTIATTQEQVPDLKDFVGMDIICSDGSTLLSADDKAGVAEICAL
FT                   LKRLGDNPELAHPTLKIAFVPDEEIGHGASLLDLEKLGAAYGYTVDGEALGEFNYECFN
FT                   AAHADVYFKGVMVHPGSAKDVMVNAITVASEFQQMVPAFERPEHTEGYEGFYHPIAIEG
FT                   SASEVKLSYIVRDHDSQIFANRQQVLQDIAAFLNKRYGENTVRVEIHQEYRNMAEKFDG
FT                   YEFLIDYALEANREVGIEPKPVAARGGTDGAQLTFRGLPCPNIATGGYNAHSVREFIPV
FT                   PSLKVTVDLLEKLVAKFATRG"
FT   gene            180487..181029
FT                   /locus_tag="Apar_0156"
FT   CDS_pept        180487..181029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50592"
FT                   /db_xref="GOA:C8W904"
FT                   /db_xref="UniProtKB/TrEMBL:C8W904"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50592.1"
FT                   /translation="MLSVFFGIIAVAAPITAAILEHSGNVGISERRHSHHDTYVTPAAL
FT                   TRSLIIDMAFVSAIAVILGWLCYVNVFTPNPDIVMAFFASFSTVMFMAWYILSRYKVSL
FT                   FDDEMVIVPFVGSEININYQDIKRMEWAGDRRGSGFRDLLIWTSDTSKVRLSGMIGLDQ
FT                   VLLKIDRFDVLAHSSTR"
FT   gene            181155..182012
FT                   /locus_tag="Apar_0157"
FT   CDS_pept        181155..182012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0157"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: eca:ECA1906
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50593"
FT                   /db_xref="GOA:C8W905"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W905"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACV50593.1"
FT                   /translation="MIKLVLSDMDNTLVPFGNRRVSDFTRKAIHTLLEETDIAFGPCTG
FT                   RDYVELMRLFSLDEACMQTGVMSTGKRVLYRGKTISLSIFDHKTLQGVADALADEKNMF
FT                   LVCYPEKTNLFNPAYVVGPLDKDILADYERKLVFVSGIVDQVPDDVDFVAATIACPGTE
FT                   KDMERCQKKVAAACPDVYTMSVVPQWFDVLPKGISKLTGFETLLERTGISPEEVLVFGD
FT                   GENDVEILSKVPHSVAVANAIPEVKQVAKHHVGASADDGVAHALLELVRATKAGETPRF
FT                   MMEN"
FT   gene            182014..182811
FT                   /locus_tag="Apar_0158"
FT   CDS_pept        182014..182811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0158"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: vha:VIBHAR_06933 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50594"
FT                   /db_xref="GOA:C8W906"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W906"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACV50594.1"
FT                   /translation="MIKLIASDMDGTLLDQNSEVPPETFELIEELHKRGVHFVASSGRR
FT                   YDTLRWLFQPVADKIDYVASLGTQVYVENEVIDREVFSSASIRALFELSSEFDCIHLVV
FT                   YDRTHTYLLDDQSSFVRELDKDLPNAERVFDPPSPDVSIIKAAVCCDSRARSMDMAMIL
FT                   EREMGDRLSFMPSGETWIDVVPRGVNKATGLEQIRRYYGISRNEIAVFGDSMNDYAMLR
FT                   YAGTAYVMDNARYALKTIATKVIAPNTEQGVQKEMRRILEELA"
FT   gene            183038..184099
FT                   /locus_tag="Apar_0159"
FT   CDS_pept        183038..184099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vsa:VSAL_I0829 N-acetylglucosamine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50595"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W907"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50595.1"
FT                   /translation="MSIVSTKDIAYSNKRAVIQALCEKNALSRVELARELSLSPSTVTT
FT                   IVHDLLQSKLVEESSERVVTAGRSKTLLQLAPEFGLLGLIRVSRQKQELVLVDMALNEW
FT                   ARTTLSEEFPSGETLLEGTKVALTNLIVDGAILKGIGVLLEGDVQESELSVMYSTGHDS
FT                   ATISLVQALESTFRVVVKQFEQSDFALSQVESADNIDDIASYFHLSFGTRIVAQVVCNN
FT                   VLLPMKEGLNADVTQQLVTADGLQLDKLMNLVRTVQSLFSFDAVVVSVPEEDSSTSSFK
FT                   ADALSKALSTPAILAQKFAQFENFPKLIVTRMTSRNLLKDAVSALRLVCLCPETVQLWK
FT                   RVLVSGWHPVSSA"
FT   gene            184288..185589
FT                   /locus_tag="Apar_0160"
FT   CDS_pept        184288..185589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asu:Asuc_1063 anaerobic C4-dicarboxylate
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50596"
FT                   /db_xref="GOA:C8W908"
FT                   /db_xref="UniProtKB/TrEMBL:C8W908"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50596.1"
FT                   /translation="MVQGILILLVFVAVAALMMTKKIPTLLALPLMAILICVIAGVPMF
FT                   GKDGDGKEIGWLTSVFEAGTVRMGAAIMAVIFGAWLGQLMNKTGVTETIIKKSAELGGD
FT                   KPLVITLIMSVAVAVLFTTLSGLGSIIMVGSIVLPILISVGVPAASAACIFLMSFTTGL
FT                   ALNIANWTTFAKLFNLDIAQVQGFEVYLAVATGIATLIMIIVEFKRNGIKFAFSAPVTE
FT                   QSNSKQLTGVAGGLAMLTPLIPIVLVAFLKVPVTPAFTVGILWCLLFTSKSFSKAMNLL
FT                   AKTCYDGVTDAGPAIILMVGIGILYLAVTNPTVKAVLNPFLLGIMPQNLIAYIIFFAVL
FT                   SPLALYRGPMNMFGLGSGIAALIIGLNTLNPLAVMGAFLAAERIQAGGDPTNTQNVWTA
FT                   NFCEVDVNTVTRKMLPYLWVVSIFGVILSGVLYF"
FT   gene            185681..187828
FT                   /locus_tag="Apar_0161"
FT   CDS_pept        185681..187828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0161"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   bpy:Bphyt_6536 5-oxoprolinase (ATP- hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50597"
FT                   /db_xref="GOA:C8W909"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C8W909"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ACV50597.1"
FT                   /translation="MKVRIGIDVGGTFTDAVAIDNDTYEIIGTVKTPTTHTAEAGVAAG
FT                   IVQVLHDVMEQHSIKPEDVVFIAHGTTQATNALLEGDVAQVGIVTLGSGLQGAKSKSDT
FT                   NVGDIELAAGKFLRTKNAFVDTSSDVEAGIKSAIEQLFSDGSTSYVAAEAFSVDDPTNE
FT                   NAVIAECSDRELPATATNDISKLYGLAIRTRTAVVNASIMPKMLEAANMTDKSIREAGI
FT                   ESPLMVMRCDGGVMTVDEVRHRPILTILSGPAAGVAGALMYEKLTDGLFFEVGGTSTDI
FT                   SCVKDGKVMVKYAEVGGHKTYLSSLDVRTVGIGGGSMVQISDGKAVDVGPRSAHIANLD
FT                   YEVYTNAEKIVNPRLVAVRPMDGDPEYAAIECDDGLRVCLTMAGAANLAGFVPEGDYAC
FT                   GSVEAARAAWAPLAENMGVSVEEAAAQVLAFAAKKNGAVAEQLMKDYGMDPRTTVYVGG
FT                   GGGASTVVSHLAKSMGHTFRIAKNAPVISTIGVALAMVRDMVERSVTNPSDDDIVSVRR
FT                   EAEARAIKMGAAPGTVEVTVEVDTQRHVVRAIAVGATELRSKDVNATRLSADELKKLVI
FT                   ENLGEGAENVSEVAHSSELFAYTATTTEKKLFGLLTKKRTALRLIDSEGVIRLQRPNAE
FT                   VLQETISSWRKGVTALVEDLTVYNDGGANLPNVYVVVGKRIIDLSGMTSLEQILSLAAV
FT                   ELGGYSSDEPVIIAATLRLGD"
FT   gene            187835..188488
FT                   /locus_tag="Apar_0162"
FT   CDS_pept        187835..188488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50598"
FT                   /db_xref="UniProtKB/TrEMBL:C8W910"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50598.1"
FT                   /translation="MQNAKHTLARKSANLEAESISDSASRFPFPTRELALKELSWDRYV
FT                   MRIPEEDKKRIVDLAWSKGECAAHMVFEESNGQSDFFQICKDAGMTIIKKDIDCVYGNQ
FT                   RYFSDYVSGTKEITLYEQSCALWAKQNQLDLHEAQNLILMHEFFHVLETTRLGLTSKEY
FT                   TVPLFTIGPFKLGKTGIHALSEIAAHAFTNTYYGLLNSSSGLNSVSDTGGSNDS"
FT   gene            188478..189857
FT                   /locus_tag="Apar_0163"
FT   CDS_pept        188478..189857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shl:Shal_3319 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50599"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C8W911"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50599.1"
FT                   /translation="MIHKEITWNNLRIPVVGSFDVVIIGGGVSGSACGIRCVNEGLSTL
FT                   IVDKSNLLGGSATRALVCPMMPTYVRHLPVLSSIEQELLASGDATRDNYTTMIWFAPER
FT                   LGEVYEQLYAAKDGQILYDTSLVAVVLSDSDGEKTITHAILASTEGLIAVAAQTWIDAS
FT                   GDAVLSRAAGVPVAAGDKDGINQVCSLRFTMGGIDVERYRDYVLSLDDHFSPLVDGYFF
FT                   ESAMVAGKNFKLEPKFREGIEAGILEEEDLRYYQIFSLPGKPGCMALNCPHIASMRTNT
FT                   TGAARSNATIEAHARIRRLVTFLQRMMPGFEQSYLMEQASLLGVRESWRVEGQVMLTEE
FT                   DYVNQARFDDGLVRGDWYIDVHSNKGGLFHKNTYKQGDYYEIPFRSMVTKHISNLGVIG
FT                   RCISTTFLMQASVRIIPTVTDMGDAMGTACVLAKRTSTPLAKLDGAAVRAEVEQMKALN
FT                   L"
FT   gene            189904..189979
FT                   /locus_tag="Apar_R0009"
FT                   /note="tRNA-Val1"
FT   tRNA            189904..189979
FT                   /locus_tag="Apar_R0009"
FT                   /product="tRNA-Val"
FT   gene            190158..191543
FT                   /locus_tag="Apar_0164"
FT   CDS_pept        190158..191543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0164"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ban:BA5084 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50600"
FT                   /db_xref="GOA:C8W912"
FT                   /db_xref="UniProtKB/TrEMBL:C8W912"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACV50600.1"
FT                   /translation="MNLLTKIAVGNVRRNLSDFGVYFAALATGACLMYSYAASGDYLFA
FT                   LVNDESVRSLFVAEANYSLAFGILPFLVFLNVTSYANKFLIRRRLPEFAQYELAGLEKK
FT                   DVIRILRYETILVSGSALIGGIVIGIAISPFVEMIVSWSYALPMKFVVVASPLGAIVTT
FT                   IIFFITMLVLSRGSKRILKKSTLLQMMSAKKENDSSKPLSISRAIFDACIGVLLLAIVY
FT                   VVCAQAPFAFIGFMIPFGACAIFGSFFVFRSTLVLLPRILKKIPGIWYRGLTAFSVRQA
FT                   EGVARNASKAMTCSAALSSVGMCMFVFAVVLRTQIFEVISSQDMSASDVSGPFGVIVFT
FT                   CSFYAVVLLVFSSVILAVQQLSLAADNKERYYKLYELGASREILSKSLLTGVLCNFLLP
FT                   GIFTVIHAIFGLNVIRFMSVEMFQTAIEPSIWPVALLTLFGFVVYFFITYIGAKKNALS
FT                   MHI"
FT   sig_peptide     190158..190271
FT                   /locus_tag="Apar_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.818 at
FT                   residue 38"
FT   gene            191706..192467
FT                   /locus_tag="Apar_0165"
FT   CDS_pept        191706..192467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0165"
FT                   /product="ribonuclease PH"
FT                   /note="TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2; KEGG:
FT                   hap:HAPS_1298 ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50601"
FT                   /db_xref="GOA:C8W913"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C8W913"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACV50601.1"
FT                   /translation="MKSDSTLQSNASSQPLRSYNRAWDQIRPVTLERNLMKNADGSCLV
FT                   SFGDTRVLCAATIEEGVPAWRRASRAGWVTAEYAMLPASTNQRTKRERANRKGRSMEIE
FT                   RLIGRSLRSVVDLNRLGEYTITLDCDVLQADGGTRTASITGAWVALHDALFSLVEKDVL
FT                   SRLPLTGQVAAISMGVVDGQVLLDLDYPEDSHADIDMNLVGTESGQIIEVQGTGEGGPF
FT                   DREKLNQLLDVGQAGIAHLVELQNQVTGFRE"
FT   gene            192470..193120
FT                   /locus_tag="Apar_0166"
FT   CDS_pept        192470..193120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0166"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   gsu:GSU1794 HAM1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50602"
FT                   /db_xref="GOA:C8W914"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C8W914"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ACV50602.1"
FT                   /translation="MSQDNATNQNTKAVFDPNKTIVVATGNTHKLVEIEAILSKVMPGI
FT                   SFVALGQLGDFPDPEENGKTFRDNALIKAMAALDEVDCVAAIADDSGLCVDALDGAPGI
FT                   YSARYAGEHGNDAANNKKLLAELADVADAERTARFHSTVALVYRDGRVLVGEGDCEGVI
FT                   GHEPKGCNGFGYDPLFWPNDAPGKAMAELSPNQKNAISHRFHALQNLSEQILH"
FT   gene            193275..194009
FT                   /locus_tag="Apar_0167"
FT   CDS_pept        193275..194009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0167"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="TIGRFAM: glucosamine-6-phosphate isomerase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   swd:Swoo_0943 glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50603"
FT                   /db_xref="GOA:C8W915"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C8W915"
FT                   /inference="protein motif:TFAM:TIGR00502"
FT                   /protein_id="ACV50603.1"
FT                   /translation="MRIVRTRDYEDMSRKAANVISAQIILKPNCILGLATGSTPIGTYT
FT                   QLAEWNKKGDLDFSQVSTYNLDEYRGLSHEDPQSYHYFMRKNLFDLVNIDIENTHVPDG
FT                   SNPNVAEACSEYDALVAAAGYPDLQLLGIGHNGHIGFNEPDDHFSKGTHCVDLTESTIQ
FT                   ANSRLFDRMEDVPRQAYTMGVQTIMSARSILVVANGEDKAQAVYDMCYGSITPQCPASI
FT                   LQLHTNCTVIADEAALSLCPAQ"
FT   gene            194242..194532
FT                   /locus_tag="Apar_0168"
FT   CDS_pept        194242..194532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0168"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   bcu:BCAH820_0048 veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50604"
FT                   /db_xref="GOA:C8W916"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:C8W916"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ACV50604.1"
FT                   /translation="MENEIPPVNRVDEIHQKLLELQGQKIKVKANMGRSRIIERTGVLV
FT                   NAHPSLFIVEVGERRGRTARQSYQYVDVLTGTVELFDVETGERLFDFEFEE"
FT   gene            194549..195451
FT                   /locus_tag="Apar_0169"
FT   CDS_pept        194549..195451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0169"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="PFAM: GHMP kinase; GHMP kinase domain protein; KEGG:
FT                   rce:RC1_3179 4-diphosphocytidyl-2C-methyl-D- erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50605"
FT                   /db_xref="GOA:C8W917"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C8W917"
FT                   /inference="protein motif:PRIAM:2.7.1.148"
FT                   /protein_id="ACV50605.1"
FT                   /translation="MNSTLMTASTSYSGRQSAQVPCKINLHLGIHTQKNQRGYHKVDSL
FT                   MVPVAIYDTVTVNDAPELTVTHDPTLCVIPERTTTWKAAVLLAHKLGISPDVSIDVHVH
FT                   IPEKAGLGGSSADAAATLRLLAERWGVDSLDPLVVDVAKSVGADVPFFLDPRPSLMLGA
FT                   GDTLEEAYTPTCDAPLVIVLPAEKGILTQAAYDQFDVAPEPPASYEALASLFTSGEKTV
FT                   QQVADLLFNNLAPAAKILEPHVAEVEAWLKQQPGVLGAQVSGSGSSSFALCESQDAADA
FT                   IADAAKAMGWRGYSTQCEL"
FT   gene            195620..195696
FT                   /locus_tag="Apar_R0010"
FT                   /note="tRNA-Pro1"
FT   tRNA            195620..195696
FT                   /locus_tag="Apar_R0010"
FT                   /product="tRNA-Pro"
FT   gene            196055..197524
FT                   /locus_tag="Apar_0170"
FT   CDS_pept        196055..197524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0170"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: spq:SPAB_00632 ascorbate-specific PTS system enzyme
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50606"
FT                   /db_xref="GOA:C8W918"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:C8W918"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACV50606.1"
FT                   /translation="MPVVEFFVNVLSTPAILVGLVALLGLALQKKPVEDLIKGTLKTIV
FT                   GFLVLSAGASFLQSGSLLAFGEIFNFAFDMQGVVPNNEAVVSLALGEFGQATAIIMCIG
FT                   MVLNIVLARFSRFNYIFLTGHHTLYMAAMLAIILHVGGLSGWMLYISGACLLALIMVLS
FT                   PAYCQPTMRKVTGSDSVALGHFGGVGYWLAGMVGKLFASDRENSTENIKFSKRLIFLRD
FT                   NTVSIGLTMIIMFMVITGVAVSRGLLTMVPAGTTAAEFASNPQYAGFQHLADLLNIGTE
FT                   TTTNWIVWAFTRGLSFAGGVYIILSGVRLIIGEIVPAFKGIAQKLVPGAKPAIDCPIAF
FT                   TYAPNAVIIGFLSSFVGGILGLLILGVINAQIAAVALILPGVVPHFFCGATAGVFGNAE
FT                   GGIKGCIAGAFVHGLLITFLPALCMPVFTLMGFTSATFSDADFSVMALIFGNVALNVQG
FT                   AILTGICVLCFCLPIIFNFVAPKKAVEQKSE"
FT   gene            197690..197974
FT                   /locus_tag="Apar_0171"
FT   CDS_pept        197690..197974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0171"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: stm:STM2343 putative
FT                   cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50607"
FT                   /db_xref="GOA:C8W919"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W919"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACV50607.1"
FT                   /translation="MAIQKILCCCGSGLGSSLMVEMQIQDVLNELGISGVEVEHSTVSD
FT                   VTPGAADLFIVARDLEDFIADIPDSEKIILSNILDKDEMKEKLTEKFGL"
FT   gene            198078..198899
FT                   /locus_tag="Apar_0172"
FT   CDS_pept        198078..198899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0172"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   transketolase domain protein ; K00615 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50608"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8W920"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ACV50608.1"
FT                   /translation="MDVDLKQVAREVRKSILTQVFTAKSGHPGGSLSATEILTYLYFKE
FT                   MHVDPTKPNCCCRDRFVLSKGHVTPALYGVLAERGFFPKEELKTFRALNSRLQGHPNMN
FT                   DTPGVDMSTGSLGQGVSTAVGMALAGKKFNKDYRVYALLGDGEIEEGQVWEAAMFAGNH
FT                   QLDNLTLIVDNNNLQLDGTLEQINTPQPIGEKFKAFKFHVIEVADGHDFDQLAAAFAEA
FT                   RTIKGQPTVIIAHTVKGKGVSFMENQVGWHGKAPNQEQYEQAMKELEGEVA"
FT   gene            198901..199842
FT                   /locus_tag="Apar_0173"
FT   CDS_pept        198901..199842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0173"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: pca:Pcar_2719 transketolase,
FT                   C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50609"
FT                   /db_xref="GOA:C8W921"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C8W921"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACV50609.1"
FT                   /translation="MADVQKIATREAYGKALIELGKEHDDLLVFDADLAEATRSGKYGE
FT                   EYPNRFVDCGIAEANMIGMAAGVAATGHKVFATSFAMFTSGRAFEQIRNSVGYPHLNVK
FT                   IGATHGGLSVGEDGATHQCNEDIAVMRTIPGMTVIIPSDAVEAEAAVKAAYDHDGPVYM
FT                   RFGRLPVPVFNTNPDYHFELGKGIVLKEGTDVTLVACGLMVPVALEVAEQLAAEGVNAE
FT                   VINIHTIKPLDTKLIAASATKTGKVVTIEEHSVIGGLGSAVCQALSENTPVPVKVIGVQ
FT                   DTYGESGPALQVLAKYGLDTPSVLVSVKEFLK"
FT   gene            complement(200277..201224)
FT                   /locus_tag="Apar_0174"
FT   CDS_pept        complement(200277..201224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0174"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   oan:Oant_4803 3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50610"
FT                   /db_xref="GOA:C8W922"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W922"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACV50610.1"
FT                   /translation="MDISQVKNVVVAGGGVLGSQIAFQTAYRGYKTTIWLRSEASIERA
FT                   RPKIEHLREVYLNTLEAMKTNPKAYAYGLIAQDEITPEKLDQLKEQVERAYSNLKLTSD
FT                   WDEAFGDADFVIESVAENPEQKIEFYTELAKHLPEKTIVATNSSTMIPSMFAAATGRPE
FT                   KYLALHFANEIWRNPIGEVMGHAGTAQENFDMVVKFAASIRMIPVKVLKEQPGYLLNSM
FT                   LVPLLVSAEQLWANGVGDVEDIDRAWRIGTGSPKGPFQILDIIGLVTAYNVALMNPAAK
FT                   DPESVQGRIVALLKEKIDKGETGVAAGKGFYEYK"
FT   gene            201563..201856
FT                   /locus_tag="Apar_0175"
FT   CDS_pept        201563..201856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50611"
FT                   /db_xref="UniProtKB/TrEMBL:C8W923"
FT                   /inference="similar to AA sequence:KEGG:RPE_1573"
FT                   /protein_id="ACV50611.1"
FT                   /translation="MIDGTYKIQMDSPVGAKEGTAVLITSGEKLTGSLTAMGVQIDIEN
FT                   GKVTDNSFTFGGKLESFVGPVIFAVGGSVEGNTIQGIAHIANRDFVFTGTRE"
FT   gene            202008..204767
FT                   /locus_tag="Apar_0176"
FT   CDS_pept        202008..204767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0176"
FT                   /product="type II restriction enzyme methylase
FT                   subunits-like protein"
FT                   /note="KEGG: prw:PsycPRwf_2393 type II restriction enzyme
FT                   methylase subunits-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50612"
FT                   /db_xref="GOA:C8W924"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W924"
FT                   /inference="similar to AA sequence:KEGG:PsycPRwf_2393"
FT                   /protein_id="ACV50612.1"
FT                   /translation="MPCDKKELLEFVSRWQGRGYEKGDTQQFWLQLLRTIGYLKVDDVL
FT                   FEFHVSSGGFIDVWIPDAGVLIEQKALGIDLDKEELRQGKQKTPLTQALDYVDELPRLE
FT                   QPRFVITCNFSTFRVYDRDAHGRSQLPNNAFEFTLDELASHPEYLAFINDPTNSRLEKE
FT                   KTVSIKAGDLIGKLYDKLREGYIDPDSEESMHALNVLCVRLVFCLYCEDAGLFGKDAFY
FT                   NYLKDVPANRIRTALKNLFHALDTNLSDRDPYDLEVKAFPYVNGGLFRDDSEIPNFTDE
FT                   TKSFLLDEVSSHINWSQISPTIFGGIFESTLNPETRRSGGMHYTSPENIHKVIDPLFLD
FT                   DLKEELKSICTEEGTTPRKRENALKRFHEKICSLTFFDPACGSGNFLTETYTCLRKLED
FT                   TVLNELRKGQTGFSLGDEEETGKRVSLNQFYGIEINDFAVTVAETALWISRLKANGETS
FT                   MFYDAGGDDFPLSEKAHIVEGNALRIDWNSVLLASECNYIMGNPPFVGYSNHSAEQQKD
FT                   RASLFGKVKTVDYVACWYKKAADYISNFPIHCAFVSTNSICQGQQVQPVWEPLFNSGIH
FT                   IDFAWQTFVWSSEASIQAHVYVVIIGFSRFGYQNKTLYLRDGVKKLCSNINGYLMDGPN
FT                   IFIDKRNKPICNIPPMIGGGKPSDAGNLILEPYERDKLLLEEPAAEKWIKPFSMGNEFI
FT                   NNKERFCLWMVGITPSELAGLPLVSKRVEAVREMRLASSKAATRKKAETSWLFDEIKEP
FT                   TSENFIVIPVVSSERRFYVPTGFVNNGLIPGNKLFFIDDATLYDFGVINSQFQNAWMRT
FT                   VAGRLKSDYSYSNTIVYNNFVWPEATVEQKDAIEKTAKAILDTRSKYSNQSLAELYNPD
FT                   KMPSDLLAAHKANDVAVEAAYGVDFDGDEEKIVAHLFKLYAEKLRCLT"
FT   gene            complement(204941..206914)
FT                   /locus_tag="Apar_0177"
FT   CDS_pept        complement(204941..206914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0021 putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50613"
FT                   /db_xref="UniProtKB/TrEMBL:C8W925"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50613.1"
FT                   /translation="MPTDFNEKRAIYFPREDLMASYYFNRAVEILRDSSVEDISNINDA
FT                   IEIYQCKLIYEHNTSYFSDTCPIISSKSVNKIFSEACRTTTITLNEQGLSRTFNEIEIQ
FT                   YIEQFWDFIFLLKFWEITLEEDMQNFLKNHPNQIPKLIENNQVSTKYDKILSEAMETNF
FT                   KIAAKCIISAFAIYKNEKIFLPKSLTNNRINQIMLNYLGDKQSEINANYTEVLSNWPAC
FT                   ANSKYNPSPEVRTTAKRINQSLTSEIISDKNGGVRYGSSVYFCKKQKVCKKYKFENNIL
FT                   NCSFSQQWLQKYTNYASILNNFIYVFDFLDKDNLISSSSHSRDIPTLLKIFGPHYHNQY
FT                   KITSKAYLDIFLKIGEISGYHKILKDQGIRLESAIEWFFNDYINKEFNITGFSISLPTD
FT                   ETSLLDKCKAIGPEIERILKAFILYTEYHSIDTNYFPFITIKDFTEIPSLFNRKYLIED
FT                   IEFIQPASLLLSDQSLLAYSPTHPEGGRNLFSLMNKFDLTVKDFHKTSYPSIDYLVENK
FT                   FIQFNENKFLRPTPQSNLLAVIWMRGSANFSDFSFDEIESLVSKKIIKYTDRFFSPDEA
FT                   DYLAYLFNNAKFSNSLALRNKYNHGSGAITDFNNQEMQYDYCMMLAALISILLKINDEL
FT                   SRFTHKGGIDGDYLIDWPLEKE"
FT   gene            207146..208333
FT                   /locus_tag="Apar_0178"
FT   CDS_pept        207146..208333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0178"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: ppr:PBPRB0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50614"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C8W926"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50614.1"
FT                   /translation="MQKLQKRFTAFLSMFMALVLSFMLVGCNVAPSQQENKPAEQTQQK
FT                   ELTTGALAATHETKFGGIYLDITIEDFNKMGFEFGDSVDVTFSNGYKLIDIPYYNGYYT
FT                   KTGEALISGYPGYPHIDVCVNNGDPLWETAGLKEGDTGTVTLHEKQKYATVQKALGATY
FT                   TKNRSDYASDEVFANFRAMRGGNMAENVMYRSASPIDNQNNRAPYAAELAQKCGVQYIL
FT                   DLADSNEEIEGYYQKADYDVSWHKGLYEAGNVTALDLNANYRSKKYAERLVAGLREMIK
FT                   HEGPYLTHCTEGKDRTGFTCALLEGLCGASYEEMRDDYMATYDNYYGISEKNDKARYDA
FT                   VVDVKFNDIALCVGGQPLGGSLDGLDYAAGARKYLTDAGMTDAEVDQLIAKLTKK"
FT   sig_peptide     207146..207226
FT                   /locus_tag="Apar_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.519 at
FT                   residue 27"
FT   gene            208482..208952
FT                   /locus_tag="Apar_0179"
FT   CDS_pept        208482..208952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0179"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG: vbsC;
FT                   vicibactin acetylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50615"
FT                   /db_xref="GOA:C8W927"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8W927"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV50615.1"
FT                   /translation="MEFTIKEIVDKKEKATIAQDILNDLPEWFGMPESTKEYVDDSQDK
FT                   PFLACFINDESVGFIVLNATSKDCADIFVMGIKKKYHHKGIGTKLNTAYEALAKRLGYT
FT                   FSQVKTVAMGHYKEYDITNQFYISMGYKELECFPTLWDEWNPCQIYIKYLGD"
FT   gene            208989..209516
FT                   /locus_tag="Apar_0180"
FT   CDS_pept        208989..209516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0180"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   lpn:lpg1613 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50616"
FT                   /db_xref="GOA:C8W928"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8W928"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV50616.1"
FT                   /translation="MKIYYDHGKLKIRSMLEGDAQAIIEVFQSYGWNNKIETYLGYFRD
FT                   QETDIRNVYIAEYDDKIAGYCTLLFDAQSGPWKKEGKPEISDLRVFDAYQQKGIGNILL
FT                   DVIEKDVARFSDEITLAVGLHYGYGNAQRLYVKRGYVPDGSGVWYNSEVLEQYAECCND
FT                   DSLVLYMNKKLR"
FT   gene            209902..212400
FT                   /locus_tag="Apar_0181"
FT   CDS_pept        209902..212400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0181"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: bha:BH0548 O-sialoglycoprotein endopeptidase;
FT                   TIGRFAM: metalloendopeptidase, glycoprotease family; PFAM:
FT                   GCN5-related N-acetyltransferase; peptidase M22
FT                   glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50617"
FT                   /db_xref="GOA:C8W929"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C8W929"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ACV50617.1"
FT                   /translation="MLAIKNDTSVVLAVDTSTDMLACTVARLTKRNADAAVAAAADGAS
FT                   AADGGFNVEVLASTDHLCRRQANVELVSSVQEALVAADLTMADVDAVIAGRGPGSFTGV
FT                   RIGVATAKGISCGSGLPLYGASALDAMAFSAWKVGVRGTVGVVADAMRGEVYPGIYLLD
FT                   DAGAHRTFPVETVFKADACVEEWSSRTDKDQFTLTGNGLVKYRERFERAGFSTYTDEAT
FT                   WFPTGEGLVRAVCMPEYQQAGAGDPALVLPIYTRLSDAEESERKRLGLKEPATVALTGV
FT                   DDELANIHLQLRPMTVNDLDQVAELEAATYAKAAHSTWSKQMFYDELSGVGRSWWLAHD
FT                   RGTVIGFAGGRLAGAQFEVEEVVVTPERRRQGIASKLVERVAYDAQMLGASAITLEVEE
FT                   DNAPAQGAYSKLGFTEVGRRPGYYGSDCAALLMTAQLPLAVGAGFEARNPEPHTSVRPW
FT                   PIVAGERSEETLAALREAGDLILSLESSCDETAMCIMDSHGVVCANVVATQIDFHARFG
FT                   GVVPEIASRKHTEAIVGLFEETMARAGAHFGCDTLVPSDLAAVGVTAGPGLVGALVVGV
FT                   AFAKGFCVATDLPLIPVHHLEGHLLANLFETPDLEPPFVASLVSGGNTMLVHVRAWGDY
FT                   VVLGSTIDDAVGEAFDKVAKALGLGYPGGPVISKLAAQGNPKAIHFPRAMMHSGDYSFS
FT                   LSGLKTAVITYIEGENRAGRAINLPDLAASFEQAVIDVQVAKAKTAVEETGVSDFCVGG
FT                   GVAANPALRAAYKETFGKMGVRVTVPPMSVCGDNAAMIAVGALRSYRTQGFSPLTLDAN
FT                   PNAQLGLWSSDAAPVIPSGM"
FT   gene            212411..214441
FT                   /locus_tag="Apar_0182"
FT   CDS_pept        212411..214441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0182"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD synthase;
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pca:Pcar_2216 NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50618"
FT                   /db_xref="GOA:C8W930"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR041856"
FT                   /db_xref="UniProtKB/TrEMBL:C8W930"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ACV50618.1"
FT                   /translation="MQDGFIKVASITPRVRVADVAFNVESCLAAIEEAAGNRGAKVVVL
FT                   PELCITGYTCEDLFWQDALLDAAERGLVSIAARTADVDALLLLGLPVRVASKLYNCAAV
FT                   LFRGELLGLVPKRYVPMYNEFYEGRHFVSGPKTVTSVDFGLLGEVPFGTNQLFACDTIP
FT                   ELVVGAEICEDLWVPMPPSNSHAVAGATLICNLSASPALAGKSAYRRQLVAQQSARLIC
FT                   GYAYASAGEGESTTDLVFSGHNLVVENGRVLADSGVFGEGIAVSEIDVLSLAADRRRTS
FT                   TFEVAPTPEDYKHLTTYFSLEFDGEGEDSAHDAASCGHDGEGSEISVRTPLTRFVDPHP
FT                   FVPAMDDARATRCEEILSIQAHGLASRLAHTGSDHAVIGISGGLDSTLALLVTVRAFDQ
FT                   LGYDRSGIVAVTMPGFGTTDRTYTNAIELVQSLGADLREISIVDSVLQHFADIDHDQDI
FT                   HDVVYENAQARERTQILMDVANQVGGMVIGTGDLSELALGWATYNGDQMSMYGINASVP
FT                   KTLVRYLVDYCADTYEEQGEDEIAHVLRDVLDTPVSPELLPSAADGSIEQKTEDLVGPY
FT                   ELHDFFLFHVLRHGSGPLKVLRLAECAFGTDTDHEVYDHETIVHWLKVFYRRFFSQQFK
FT                   RSAMPDGPKVGSVSLSPRGDLRMPSDASSSLWLSELESLDA"
FT   gene            214707..214997
FT                   /locus_tag="Apar_0183"
FT   CDS_pept        214707..214997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0183"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: ppd:Ppro_2803
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50619"
FT                   /db_xref="GOA:C8W931"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C8W931"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACV50619.1"
FT                   /translation="MNLKPLGDRVLVKPAPKEEKTSSGLYIASAAQELPQRGEVLAVGT
FT                   GKLDQNGNRIALDVKVGDQVFYGKFGGTEVKVDGEELLLLRADDILAILED"
FT   gene            215060..216697
FT                   /locus_tag="Apar_0184"
FT   CDS_pept        215060..216697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0184"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: rso:RSc0642 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50620"
FT                   /db_xref="GOA:C8W932"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C8W932"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACV50620.1"
FT                   /translation="MAKDIDFGTDARAKLAKGVNTLADAVTTTLGPKGRYVALQRSYGA
FT                   PTITNDGVSVAREIELKDPVENMGAQLVKEVATKTNDTVGDGTTTATLLAQVIVNEGLR
FT                   NVAAGANPIAIRRGIDKAVEAVVSQMKGIAKEVSTKQQIASVGTISAGDPVIGGKISDA
FT                   MDVVGKDGVITVEESQTFGIDIDTVEGMQFDKGYVSPYFATNNETLTAELDNPYILMTD
FT                   SKISSIQDILPILEAVQKQGAPLLIMAEDVDGEALTTLILNKLRGVLNVCAIKAPAYGD
FT                   RRKRMLEDIAVLTGGQAVIKELGVNLNEITADMLGRAKSVKVTKETTTIVGGAGSKDAI
FT                   DERIAQIKAEIDNTTSDFDREKLQERLAKLAGGVAVIKVGAATEVELKEIKHRIEDALQ
FT                   ATRAAVEEGIVAGGGVSFLAASSVLDSVQTSDADEKIGVEIIRKALEAPVRTIANNAGF
FT                   EGSVVVEKIKALPAGQGLDSATGQYGDMIEMGVLDPVKVTRTTLQNAASVASLILITEA
FT                   TVSEMPKDTTIEESISRAAAQGGQGGMY"
FT   gene            217040..218425
FT                   /locus_tag="Apar_0185"
FT   CDS_pept        217040..218425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0185"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sit:TM1040_0396 4Fe-4S ferredoxin, iron-
FT                   sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50621"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W933"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV50621.1"
FT                   /translation="MAQNHNEDRDFLDDLIDIQDSLRVLSNPLDALMGSLSVDPNTDKP
FT                   FEPMDYKEIPWSNANRCLRCASGKPEACSRCLDVCPANCIDIHNQSVRIDDEACLQCGL
FT                   CVAACPTETFNTRRHTSRMLYDQVARAASAYEQCYITCTRALGRKPEGNEICLPCVGML
FT                   SADIWFSILTDFDNVSVYLPLGVCDRCRTTTGEEAYSEAIATAEEWTGATVGLEVDGNN
FT                   LNHNFTRAYIRSQFISNAMNGAERLVSASTPVLAGAKAIADRINTHARSLDKLQTQLDD
FT                   VMGLRTTDMRQSMLTQDRRLVMGALQHDPDLAPYVKLKAPIWDSSKCTVCGDCKNTCTT
FT                   HAIDIDERGKLTIKMPFCVNCGACEIVCPEPGALTMVPMNTSELVVRDRKAEETERLEA
FT                   LARRKARFIFDTGKEQLKHLTDSLAEDSDADHAANSSVDPAEDPAKNLGDAAQQLPKED
FT                   NRE"
FT   gene            218518..219582
FT                   /locus_tag="Apar_0186"
FT   CDS_pept        218518..219582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0186"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: Protein of
FT                   unknown function DUF933; GTP- binding protein HSR1-related;
FT                   KEGG: dno:DNO_1325 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50622"
FT                   /db_xref="GOA:C8W934"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C8W934"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ACV50622.1"
FT                   /translation="MSLSIGIVGLPNVGKSTLFTALTRKGGLAANYPFATIDPNVGIVD
FT                   VPDARLQKLAEIVNPGRIMPATVEFVDIAGLVKGANEGEGLGNQFLANIRNTDAICEVV
FT                   RYFKDPDVIHVEGRVNPDEDVDIIQTELILADLGTIERALPKLEKEAKRDKDLQPKLNV
FT                   AKRLQEWLNEGNRAADMEMTDEERLAARDLFLLTMKPILYVANVDEDMLTEPAPVINGV
FT                   QSIPVCAGVEAELADLDPEEAAEYLESLGLEHSGLETLAQAAYKLLGLQSYFTAGPMEV
FT                   RAWTVRIGAKAPEAAGVIHSDFERGFIKAEVASYNDYVELGGEAGCKAAGKLRIEGKDY
FT                   VVEDGDVMHFRFNV"
FT   gene            complement(219727..221418)
FT                   /locus_tag="Apar_0187"
FT   CDS_pept        complement(219727..221418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0187"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   bca:BCE_5306 LytR family transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50623"
FT                   /db_xref="GOA:C8W935"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C8W935"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ACV50623.1"
FT                   /translation="MARRSHSSQNRGRNSRDRYEDTPEYDTEDFAQDDYDAYDQGGYQP
FT                   RTLGSVRSAGASSARNNHAESHGSRFTREPLIGQTNVGDEWPEDNPATQPRNARYASHR
FT                   AGAVSHAPSRAEGVGAYSKKRQGSSRGRGLKIFGGILGTLLLVAGIAFAWWMLDTNSKL
FT                   RQGLDANLQATLVQVAPSDPFYMLLLGVDKDEGRAENWGDSNANFRADTIILARVDPKN
FT                   KKITLISIPRDTMVDLGEHGKQKINSAYSYGGASGMVEAVSKLANVNISHYAEVDFESF
FT                   TKIVDSIGGITVNLPVAVSDMQYSGIDLPAGEQQLNGQQALGLSRSRHAYDNYGAGDFY
FT                   RAANQRMILTAIAKKVLKLDPVSMSGAVSTMAESVTTDFNVTDIVGLAMSLRGLDTSKD
FT                   MYSARTPTTSELIDDVWYEIVDKDAWKTMMDRVNQALPPLEDASTDETTGIAGTVAGDA
FT                   SATDNIKPDYTGEVAVLNGTDVQGLAAQKAGILKTKGYTAYADSSQEHPSNSIIVYDGT
FT                   RTGLAKAVGVAKALDIPTANIKANDGTYPTDTDITVVLGTDQAPKR"
FT   gene            complement(221587..223113)
FT                   /locus_tag="Apar_0188"
FT   CDS_pept        complement(221587..223113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0188"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; PFAM: Cna B domain protein; surface protein from
FT                   Gram-positive cocci anchor region; KEGG: bcr:BCAH187_E0033
FT                   collagen adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50624"
FT                   /db_xref="GOA:C8W936"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:C8W936"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACV50624.1"
FT                   /translation="MNKRLLKLFSFVLVLALSLPLAVKLAFAEPTSVEGATGAPKAVVA
FT                   TITDFRIEDRFGNPTTVVNKANLYAIAMNWDASANAHVEPGDYFDVTLPDTMRFTAAHP
FT                   ASTFNITDAATGEVMAVAHVSPGADGFGGTMRVVFTDYVNNHTDLRGSVRLGFTINSER
FT                   IQTGTGKTFNFTVSGNIVPVTFDVTALGVIDTEYLYKWGKVIEGNANEIQWTGRINFSR
FT                   GNFNNVHLHDQLLDWGGGDLPAEITYVPGSFELWTGVFDEYGSTIPGTAHRVPITDDMI
FT                   TISPDGKSFDLDLSGVDFSNGQSYKFMYRTTYVPGVALRNLIKMYSDKPEYSSDWVWRN
FT                   ATSSGEGTSTIVARIRVIKVDKDDHNTKLAGAVFKVTSVADPTKTWTITTGEDGTATTE
FT                   KLPAGTYTVQEITAPNGYELSTDTYNLTVSATSGVIKTVENEKTPTVPPTTPPNTPPAA
FT                   PPSETPKKPKKKQSKLPETGEVSEIALVAVATVGSVASTLGYALKNRHRK"
FT   sig_peptide     complement(223027..223113)
FT                   /locus_tag="Apar_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            223435..225024
FT                   /locus_tag="Apar_0189"
FT   CDS_pept        223435..225024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0189"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; ExsB family protein; KEGG:
FT                   bcu:BCAH820_0294 GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50625"
FT                   /db_xref="GOA:C8W937"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8W937"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ACV50625.1"
FT                   /translation="MSESRPKQFVAVLDFGAQYGQLIARRVRDLNVYSEIVPCDISADE
FT                   LRELNPSALILSGGPASVYAEDAPKIDPEILELGIPVFGFCYGQQIMAVTLGGTVGHTE
FT                   KGEYGPAHLTRAGESRIFDGTAEQQTVWMSHRDAVSEVPDGFTVTASTDVCPIAAMENA
FT                   AKNLYSTQFHPEVNHTECGSQMLSNFLFNICGFEKTWTMDNIIEQKVEEIRQKVGNGRV
FT                   ILALSGGVDSSVVAALVHRAIGDQLTCVFVNHGMLRKGEPEMVEQVFCKQFNVPLIHVH
FT                   AEERYAELLAGVTEPEKKRRLIGTEFWKVFFDEAQKLDGVQFLAQGTIYPDIIESGARK
FT                   TGGKAATIKSHHNLIPFPEGVHFDLIEPLDHFFKDEVRALGVSLGLPENLVYRQPFPGP
FT                   GLAIRIIGDVTPEKLEILRNADAIVREEIDAYNAQLFDETGDRNSEHSVWQYFAVLPDI
FT                   KSVGVMGDERTYARPVILRAVESSDAMTADWAKLPYELLTRISSRIVSEVAGVNRVAYD
FT                   ITPKPPATIEWE"
FT   gene            complement(225189..226067)
FT                   /locus_tag="Apar_0190"
FT   CDS_pept        complement(225189..226067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: phage head-tail adaptor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50626"
FT                   /db_xref="UniProtKB/TrEMBL:C8W938"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50626.1"
FT                   /translation="MRRFIYLDTETLNSYIAQIYDGLIKTNEENTQQINESSKESSHSI
FT                   SPNAAIDFTLLGKGIEGKVEYIFKSLKANKDSTLINKVETKMLHDNAFNLLINHINKHE
FT                   DLKDGNIGKFIELFNSFYILDFLYYKELFSDTNFINFLIDSSMENLIKETENEKSKLTT
FT                   GTPNKKQIIKEIDNKLAAFRKEQESEYSNALKLIDIITKIIPYQRVLCINDCIVTLSDE
FT                   FIRDDIQMSSFKYGGKIKVFGYITNIIHRNIKQNLPIFAEIINQINSAILPEIINKDEV
FT                   KIIHPIAIYYE"
FT   gene            complement(226081..226479)
FT                   /pseudo
FT                   /locus_tag="Apar_0191"
FT   gene            226543..227305
FT                   /pseudo
FT                   /locus_tag="Apar_0192"
FT   gene            227354..230041
FT                   /locus_tag="Apar_0193"
FT   CDS_pept        227354..230041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0193"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; PHP domain protein; KEGG:
FT                   aeh:Mlg_1540 SMC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50627"
FT                   /db_xref="GOA:C8W939"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W939"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ACV50627.1"
FT                   /translation="MAIAKWYKIDFHTHTPESRCFPDKSITAARWLQAAKDSGLNAVVV
FT                   TDHNSVGFISEIEKVKNQFEELNPIKGNLFKVFYGIELCVSAEFTHILIIFDDKMSVTE
FT                   IEDAVIGCLGLKRNDWANTEINVSEDKLKKLCQEYENKVFVIPAHFASNKGLGTCRTNA
FT                   IKKYQEFVKFSAVEVRNSTDVKEYKNKLNNKVINEAVLVTGSDNPSNKDETQHSIEGFG
FT                   KIFTWIKVSDLSFNALRQVFIGPEHRCINWLDLEAIGIDYNPNNISFNYISGINFKGIS
FT                   HMTDMNIRFSPHLNCIVGGRGTGKSTLVEAINYGVGNESDLKRCNLMEKTFDKSGSIST
FT                   FFNFGEVKAYKANCIRSGKQTVLTIEDDNGVVDNPPEFKIDFYGQKEIFGLIEDDNDIS
FT                   SSDISPLIKLIDDKVKAELFSYKDDIENSISSMVSLSNNYKANRKKIQDMPGIKAEIEK
FT                   SEAILKKFQASGIESARAEYEQTDNVIKTINEKVQTEKEVINESIQRFSELKEDLNRDI
FT                   LVLLEKLGSDDENIQIVTELKDINDEIINHANNKIDSLSKLEEKFNSSNIYNKLKVDYE
FT                   KYKEAVEEVNNTGGENIDYIQNQLQNNRNRYDQLNQLQQQQRILKEKIRQSICDFVEKR
FT                   IKLSDKRKHVILELGLDTIKIEIVPLGHISRWKANLQKEFGKEGIFDSEFEKLSENVLS
FT                   KTNNFENYKKFLEFLLIDDTGDIECLYEDIKTDPRFNKLWLDKHKNDTLSSMVKIIPED
FT                   KVNIKILEDSGEIDINDGSPGQKSAALLAFILNSGDSPLVIDQPEDDLDNSLIYSLVVT
FT                   SIRRMKKKRQIIIVTHNPNIPVLGDAEGILILDRDSFGKVTFRKDKKAGCIEEQVIKEG
FT                   ICEIMEGGEAAFKKREEKYLSLLG"
FT   gene            complement(230772..231335)
FT                   /locus_tag="Apar_0194"
FT   CDS_pept        complement(230772..231335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50628"
FT                   /db_xref="UniProtKB/TrEMBL:C8W940"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50628.1"
FT                   /translation="MSIASALGAEAPRDALRLERAERVEVVTEKRPTLADDEHAHNVEP
FT                   NPDFLGVQVLDEVGSREPFERRAVRVLLGKSLAAVLCDLAVDEDQVVLVTGDEVDDVAA
FT                   DSIRKIGVSGARGTLEVLFRYERELSLIPVVTEDGVAIAPDPKKEGSQKAVQTLKAWKR
FT                   MRDQLASGEIDEGDYESWKARFMG"
FT   gene            complement(231364..232476)
FT                   /pseudo
FT                   /locus_tag="Apar_0195"
FT   gene            complement(232534..233520)
FT                   /locus_tag="Apar_0196"
FT   CDS_pept        complement(232534..233520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0196"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: ade:Adeh_1687 tyrosine
FT                   recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50629"
FT                   /db_xref="GOA:C8W941"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C8W941"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV50629.1"
FT                   /translation="MNEYKQTISRIEHLMEGALSGSQRDLLHAVLRQCLDDDAARADAK
FT                   TSMSNKRMLDAFYAAKRLEGCSERTISYYASVLHHYMVNITTGFRQVTTEEVRSYLIEY
FT                   GQRKGVSKITVDNVRRVISSLFSWLEAEDYILKSPVRRIKKIRSPRNIKPVITDDELET
FT                   MRDGCTCVRDLALVDLLTSSGMRVGELVRLNREDIDFEGRQCVVRGKGDKERRVYFDAR
FT                   TKVHLHEYLNSRHDENPALFISLDGTKKRLEISGVELRLRMLGRSLGLPRVHPHKFRRT
FT                   MATRAIDKGMPIEQVQVLLGHSKIDTTLCYAMVDQENVKQAHRKFIA"
FT   gene            complement(233616..236993)
FT                   /locus_tag="Apar_0197"
FT   CDS_pept        complement(233616..236993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0197"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   protein of unknown function DUF450; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicase; KEGG:
FT                   amc:MADE_03609 type I site-specific
FT                   restriction-modification system, R (restriction) subunit
FT                   and related helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50630"
FT                   /db_xref="GOA:C8W942"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W942"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACV50630.1"
FT                   /translation="MNFSFLKDIKEYEMFSGACEDAERTFASSPAMCALACRKAMELAV
FT                   KWVYAADETMNEPWRSNLASLIHEASFKNAMDTTTWGQLRYIWKLGNNAAHTQRQIDAR
FT                   DALAALAGLFNFVEWIDYCYGPSYEERHFDPKAIPVLKQALDEQKLRKTLQENAEKDAR
FT                   IAQLEEQVRAQRAQFSETKEQRPEETHFNPDEIPEYETRKRYIDVDLEYAGWNLDDSVK
FT                   TEAEVSGMPNPTGTGFIDYVLLGRNGKPLAIVEAKRTMYDPLKGEQQARLYANCLEKKY
FT                   GYRPFVFLSNGFETRFMDDGTAAPRACSGVFGREDLERLMNRRGKVKNLSTVPVNRDIA
FT                   GGGRNRYYQVEAIEAVCQNMEEGHRRSLLVMATGTGKTRTAAGLVDVLSRAGAVTNVLF
FT                   LADRVALVRQAKNAFQNYLTTMTVCNLCETDDKAKNVDARIVFSTYPTILNAVDDVKRD
FT                   GDARLFTPAHFDLIIVDEAHRSIFKKYRAIFDYFDSPVVGLTATPKDEVDRNTYDFFQV
FT                   ERGIPTYLYEYATAVEKDKVLVPYYNIEVQTNFLSKGITYDELSEEDRQRYDDDWEEAQ
FT                   GTSAPDYVEASALDRFVFNEHTIDLVLTTLMDEGIKIKGGEHIGKTIIFAQNRKHAEII
FT                   VKRFNELYPKFGAQGFCKRVVHTDDYAPTVITDFETKEMPTITVSVDMMDTGIDVPEVV
FT                   NLVFFKQVKSKVKFWQMIGRGTRLCEGIHAQDKVSGEYEDKKHFFIFDWCGNFEFFRQE
FT                   QKLAEGANPESMQEKVFKRQALLAQALQGADFASDDYQEWRVRVVQEMAVKVQSVKEPL
FT                   TAAVKLHIREVDKFSQVPSYQVLEDVDIADLNKVAPLVRADGEEELSLRFDALMYAYMV
FT                   VLISGTNTENHRTRVVGIAVRLQNKASIPQVREKMDLLKRVTSEGFLESASLITLEEVR
FT                   VELRDLMKFLIGDSRPLMVETRVTDSVVGRCEGDAISPKEDFEDYKLKVSRYIAQNANH
FT                   TVIAKIHHNQQMTSFELNELERIFTVELGNEADYRAAYGDTPFGKLVRQVAGLSHEAAM
FT                   DAFAEFLGDESLSRQQMDFVHKIVDYVETNGFMDLADLGKPPFDQPQSFVRLFDGRRQR
FT                   RLVQIIQSVNDNATTPAA"
FT   gene            complement(237003..238163)
FT                   /locus_tag="Apar_0198"
FT   CDS_pept        complement(237003..238163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0198"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: neu:NE2496 restriction
FT                   modification system, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50631"
FT                   /db_xref="GOA:C8W943"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C8W943"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ACV50631.1"
FT                   /translation="MTSKPQFVGERVRLTSFVSAAGKRNKGAKCTDVYSVTNSHGFVPS
FT                   TEYFSKEVFSKELEAYRLVERGMLAYNPSRINVGSIALQESADRVVVSPLYVVFSVDTR
FT                   HLAPGYLLRFLKSKPGLNQIAFRSSGTVRSNLKFDALSLLEMPLPSIDVQEKRLVVLSR
FT                   LEKQIEARGEFIASLDTLVKSRFIEMFGDPIALNSNKKSRLDSFAKIITGNTPSRKKPE
FT                   YYGDYIEWIKTDNITSTPVLTKAAESLSEDGASAGRIAPSGSVLMSCIAGSVKSIGKVA
FT                   IADRPVAFNQQINAIIPADGILTEYLYWMLSLSKDYLCSDINMQLKGILNKTALSRKMF
FT                   CVPPPSLQQEFATFVRQVDKLRVVAEEQKKKLQTLYDSLAQEYFAI"
FT   gene            complement(238156..239676)
FT                   /locus_tag="Apar_0199"
FT   CDS_pept        complement(238156..239676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0199"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: gur:Gura_2095 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50632"
FT                   /db_xref="GOA:C8W944"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C8W944"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACV50632.1"
FT                   /translation="MITGATKSKVDDVWQRMWEGGITNPQEVITQLTYLMFIRSLDDKE
FT                   LESERMEELGIPQEYLFPQTSEGQEMRWCSIKNMAPEKMLEAIRDKVFPFIKTLHDDTP
FT                   FARSMRDATFGINNPRTLQKAVSGIDSLMNDFENDMDDLGDLYEYMLSKLSTAGTNGQF
FT                   RTPKHIRDMMVAMVDPRPGERICDPAMGTAGFLISAADHLRNDSAMKDDDWTVFAGEAA
FT                   EKDADGNVVAEGRHQFSGGETDQTMFRISAMNLMLHGISQPDIKLVDSVSKQNTTSDKY
FT                   DLVLANPPFTGSVDTEDIAPSLKAICNSKQTELLFVALFLRMLKVGGRCACIVPNGVLF
FT                   RTNSKAYRQLRQELVDNQQLRAIIYMPSGVFKPYSGVSTAVLVFTKTNAGGTDKVWLYN
FT                   MEGDGYTLDDKRDIDDAHNDVPDILERWAHLESEEKRDRKQKSFLVSKQDIIDNDYDFS
FT                   FNKYVETEYERIEYPPTEQIVAELDELNKEMATGLAELKKVLGGGLDD"
FT   gene            complement(239719..240306)
FT                   /locus_tag="Apar_0200"
FT   CDS_pept        complement(239719..240306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0941 restriction modification system
FT                   DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50633"
FT                   /db_xref="UniProtKB/TrEMBL:C8W945"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50633.1"
FT                   /translation="MPAAYQHLGALCSVKTGAPVSRAKRQTKGVPFHATQVLVPKAIEN
FT                   GRVINQELVEAKVSAVKEDLLTHCGDVILKTSTPYDCAYIDCAHEGLLVTSFGLIIRPL
FT                   PDADIDMRYLAAFLTLPQTRQLLQSESKGVTLQLLKKKDILDIPVLTPSKSVQQLLAEL
FT                   FENTQKRKELYRLAEAKSDQLLFSTFDQIAMH"
FT   gene            240440..241822
FT                   /locus_tag="Apar_0201"
FT   CDS_pept        240440..241822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50634"
FT                   /db_xref="InterPro:IPR025935"
FT                   /db_xref="UniProtKB/TrEMBL:C8W946"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50634.1"
FT                   /translation="MDDLSQNSSESTEGNSPFSGLAKAIKQDGSFPASSFGNGAFSNAI
FT                   LEHSKIPEPDYPYLIDASPTDYLLKPDWNQLIIIGNGFDLECGLHSTYRDFFASRRKIL
FT                   LCETTPGKRSEQSWGKCLKEAGISAWELILQDKYESYWYDIERAIKDWVAWDYTRIGFP
FT                   SKNTAIVLQYIKSGAKSDQADPDRLVGAKVARYVEDTHPAAEIRGWEAEDVYDFLLEEL
FT                   HALEHEFASYLKGEIARSSDYKQNAIRLMWNLLNDEFPKDSDKYEIEESVLSFNYTRPF
FT                   GSQLGRAPRTNILSNVHGSIEKDNIVFGIDGSDCMGLNKVIEFTKTYRLMALGSPDFSR
FT                   VVHGDGKSPMSHSTDLIKFYGHSLADSDYSYFQAIFDRVGLYSGNTRLVFYYRPHKLRD
FT                   GSMRSEKDVRESTMKSAIKLLTAYGRTMENVDHGKNLIHKLLLEGRLSVKLLPDDEVVP
FT                   IG"
FT   gene            complement(241993..242772)
FT                   /locus_tag="Apar_0202"
FT   CDS_pept        complement(241993..242772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50635"
FT                   /db_xref="UniProtKB/TrEMBL:C8W947"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50635.1"
FT                   /translation="MAARGVRSRRHRFRRQRACGPSRTTSRCARGPRSHSSPWRPGRRC
FT                   SGSQLPGRVHPSRGSATRHERSYGRICTSLRVRLHAHDCVTTEIMRLLAQLHDGDVQIL
FT                   QVSHHDAQQPLRLMGPEAVARGVVGDAVERVHGLVVAVSPATHLAIEPTCGGAVEHHGG
FT                   AGAFHHAVGGQLDERANELRDSEAVSRREVERPVLLAGREPHVYALTASVHRCSSSSGQ
FT                   VLGGRLPPRGAGHPPRSVIGRRAATLGRKTAPRQRIR"
FT   gene            complement(242784..243014)
FT                   /pseudo
FT                   /locus_tag="Apar_0203"
FT   gene            243326..243988
FT                   /locus_tag="Apar_0204"
FT   CDS_pept        243326..243988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50636"
FT                   /db_xref="UniProtKB/TrEMBL:C8W948"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50636.1"
FT                   /translation="MKKQLVIVANEKYLKYATYLQGLISCIDDEEDRQVGTKDGAVSAV
FT                   IWDEEHHKANSKSLASGNSVVFFGDSEYVRKNCSEINTKFSKFGMTYGWLGNHANLCVA
FT                   NDTLNEDNAADFYQMAEEYGKRFEKELSFLFSPKRDKEIGNDVVDHAIAVVEFAFPPAR
FT                   IVDLVMNRGKSSKLSNRLAMAIGKGVDKTKNAEAVDQQYTLLTLVFYMDSLSEFLGI"
FT   gene            243990..245051
FT                   /locus_tag="Apar_0205"
FT   CDS_pept        243990..245051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50637"
FT                   /db_xref="UniProtKB/TrEMBL:C8W949"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50637.1"
FT                   /translation="MNGFEEGYSFYADSSGANVAAQMGNLWVGEVNAAIDTLRSDLLEF
FT                   STSGKTIDTLSGDLAEFWHADTYNIDAILNGSENRAHVPRSTRFASADVELDTGESFQV
FT                   KYCQDGAHSAKAHAVSYNEASRNPSTSKGATEAIRAGANPNDSVYKGMGRVIPEGQKED
FT                   AVRELKRRIAKESVTRKEQVSRLEETREALTDTVGNGDGVKSKSLSREASKELAREVKE
FT                   GRVDLDAKDISTEQLVKLEHVMKSSLKTGMTAATIAMAVKAAPIIVSTIKDAAIEGRID
FT                   VDQLLNDGADTAKTGAGAFLSGTITAALTESMKSGLLGETFKNASSEAVALAVVLAGEG
FT                   LREGYRLAKGEIT"
FT   gene            245052..245471
FT                   /locus_tag="Apar_0206"
FT   CDS_pept        245052..245471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50638"
FT                   /db_xref="GOA:C8W950"
FT                   /db_xref="UniProtKB/TrEMBL:C8W950"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50638.1"
FT                   /translation="MQFTEIIFRKSYYALIAMGGGHLGQALIPVPVIGYMLGSLAGSLV
FT                   GGITYEIGSTVFVGLCVNRGMTFFGLVEQDYTLPENVLKSIGLEVFEYETFEFEKPAFE
FT                   TFAPETLALESSRLDQFEIRYSRRGLIAFNKIGYI"
FT   gene            245669..246568
FT                   /locus_tag="Apar_0207"
FT   CDS_pept        245669..246568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0207"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: hpa:HPAG1_p002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50639"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C8W951"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACV50639.1"
FT                   /translation="MGFLSVAEVAELWGISERSVRNYCANGRVPDAFLVGKTWNIPADA
FT                   AKPSRKNAKTSSTSSLLSRLIEEKPSKIKGGIYHKIQVELTYNSNHIEGNKLSLNQTRM
FT                   IFETATIGVEENPVHIDDIVETQNHFRAIDYVIDHAKDPLTEGIIKELHRILKTGTTDS
FT                   VKDWFAVGGYKRLPNEVGGRETTLPENVAKEMKSLLRAYNSNSSHTFEDIVDYHVRFER
FT                   IHPFQDGNGRVGRLIMLKECLTHDVVPFVISDDIKSFYYRGLSKWNKENGYLLDTCLTA
FT                   QDRFKATLDYFRIAYITR"
FT   gene            246638..248467
FT                   /locus_tag="Apar_0208"
FT   CDS_pept        246638..248467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0208"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; KEGG: sus:Acid_7303
FT                   glutamine--fructose-6-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50640"
FT                   /db_xref="GOA:C8W952"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C8W952"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACV50640.1"
FT                   /translation="MCGIVGFTGHQSAKDILIEGLKRLEYRGYDSVGIALQNATNKELT
FT                   VVHRVGKVAGLAEAVEYLDNVSPCGIGHTRWATHGAPSERNAHPHTSCDNKIAVVHNGI
FT                   IENFAELREQLEAHGHKFRSDTDTEVVAHLIEEAYSGNLRDAVAKACSQIVGTYGLAVI
FT                   CSQEPGRIVVTRKDSPIVLAHGEKGSYVASDIIAVIEASRDVTVLGDNEFAVMEPDGIS
FT                   YTDAEGNPIQPKVMHVDWDVDVAEKGGYPDFMLKEIHEQPRVIRDTLAGRLTNGVLSID
FT                   ELGMSLEQLRLIDRVYIIACGTSYHAGLIARQLIEGWARIPVEVEAASEFRYRNPIITP
FT                   STLVVAVSQSGETADTLAAIRDARIKGAKVFGITNVIGSPVARESDGVIYTKANKEIAV
FT                   ASTKSFLGQIVSLTLLAMVLAQAKGKLSIAQIRLLFKELADTAEQVEEVLSDTKAIDIA
FT                   AQACKDANDALFIGRGMGAAICYEGALKLKEISYLHAEAYAAGEMKHGPIALLSKGYPV
FT                   IAVATNSPVYDKMISNIQESRARGAMIIAVATEGDQEIKKHADYVIYVPKVRDAFSPII
FT                   ASVPLQLFARSMALARGCDVDKPRNLAKSVTVE"
FT   gene            248639..248977
FT                   /locus_tag="Apar_0209"
FT   CDS_pept        248639..248977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0209"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: bcr:BCAH187_A3051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50641"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W953"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACV50641.1"
FT                   /translation="MAKAIDSGTLTEPTFYILLSLYQPMHGYAIMQNVQEITDGRVAIG
FT                   AGTLYGAINSLIEKGWIEALHNQPSDRKKEYRITQQGKQAFLQEVNRLQALLANAQNVI
FT                   NTANTKES"
FT   gene            248980..249531
FT                   /locus_tag="Apar_0210"
FT   CDS_pept        248980..249531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_1074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50642"
FT                   /db_xref="GOA:C8W954"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:C8W954"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50642.1"
FT                   /translation="MSTSTTIKKFFTDFDAEEAWLNQMSAQGKELVNYRGGTYTFTTSE
FT                   PHMWQYAIEILGTTSKEGRDYLSFLEDMGIETVSTYAGRAYLRKKDDGTPFVLHSDLKS
FT                   RIAQAQKANFWPPIIITQLFIVLALCVNGVFQQVSPVAFGILAGIGIAFIIAAAIEFFV
FT                   FAKPYRKRIRQLKQELAIKE"
FT   gene            250314..251861
FT                   /locus_tag="Apar_0211"
FT   CDS_pept        250314..251861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0211"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: glo:Glov_0246 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50643"
FT                   /db_xref="GOA:C8W955"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W955"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50643.1"
FT                   /translation="MQLNLSNIEYIYPSAVEPTLCKVTATLPEGWTAFVGDNGSGKTTL
FT                   ARIVCGLLQPDVGVVSPSLFSTYCAQSANEPPSNLFDFAVAYDDLVIRLRNELSIEDDW
FT                   SWRFDTLSCGQQKRLQIACALWSTPDVLVVDEPTNHVDASTRHALFTALSKFKGVGVLI
FT                   SHDRELLDALCSQCLFITNGTATMRPGGYSQASSQVALERSSAIHARDIAQKEKARTER
FT                   EVQRRREEASRVQARRSGKGIAKNDSDARAKKRHYIVSGQDGKAGKLSAHIQSRLEKAE
FT                   DNVANSKVEKRYDAHVWLDAEPSRRKVLFRMEPGHISVGESLLSFPALFIGNTDHIGLV
FT                   GDNGSGKTTLVKKIIASISADMSPIDMSSMDAIFANMGGADTKVLYIPQEPDIAQKENT
FT                   LKKIRELPSAQRGQVLSTVAQLNSDPDCILEGDTVSPGEMRKLMLALGILDSPELVIMD
FT                   EPTNYLDLGSTEALEQLLSVYPGALLLVSHDASLVSSATSLTWRIQKLGDGYELVVD"
FT   gene            complement(251933..253162)
FT                   /locus_tag="Apar_0212"
FT   CDS_pept        complement(251933..253162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0212"
FT                   /product="Uncharacterized protein containing a NRPS
FT                   condensation (elongation) like domain"
FT                   /note="KEGG: dal:Dalk_3047 protein of unknown function
FT                   UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50644"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C8W956"
FT                   /inference="protein motif:COG:COG4908"
FT                   /protein_id="ACV50644.1"
FT                   /translation="MDIKGQPFDYMQYMYSFVQNPIIRGCIRFNGKLQGGKLKRAIEEL
FT                   ASTYPILLCKYKVQKGTWATDSHASCEDLLTTISAKNDFSTLENDSLLTSLKIGIDLPL
FT                   KIYWLCGEEKDSLCIIASHLLCDGRGFEQLLYLLAELYSGTEIKEQINRDRSFSQVINR
FT                   FSMGQKIKILCSKTQKHSSTKLHLPLNESSRTPNLITRQISISKLEQYHSCTNEHKPSI
FT                   NDILLAAYLLTLHDMFQWNNITIPCPVDLRKFSTDTRNSICNLTGNYYCHINFNDNSTF
FT                   DEICREITTQMHTQKNSSSCLKEPMLLHILYRILPLSIVKGLLSRAISVPITSYTNLGK
FT                   MDEKLLVFQGVSISDAFIATADKPVPYFQLAASTYKDKCTLSVCTYASGKSFDVLCSVV
FT                   DNICSVLENL"
FT   gene            253497..253997
FT                   /locus_tag="Apar_0213"
FT   CDS_pept        253497..253997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0213"
FT                   /product="Putative protein-S-isoprenylcysteine
FT                   methyltransferase-like protein"
FT                   /note="KEGG: noc:Noc_2817 S-isoprenylcysteine
FT                   methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50645"
FT                   /db_xref="GOA:C8W957"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C8W957"
FT                   /inference="protein motif:COG:COG2020"
FT                   /protein_id="ACV50645.1"
FT                   /translation="MVSNSRKKDHLPIFGAGPAYVITIVALTIAGIVLSQLGILPYLRI
FT                   RSTIIVLHSLGTICFIVGIWLWVSAAIKEKLQDKIVANKLVTTGVYSVVRHPIYSAFAF
FT                   VLTGILLIYSNLYLLLLPFIYWAFLTVLMKATEEKWLVDQFGKEYEDYCRQVNRCIPWF
FT                   PKR"
FT   gene            complement(254105..254572)
FT                   /locus_tag="Apar_0214"
FT   CDS_pept        complement(254105..254572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0214"
FT                   /product="putative flavodoxin"
FT                   /note="KEGG: pca:Pcar_1078 putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50646"
FT                   /db_xref="GOA:C8W958"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8W958"
FT                   /inference="similar to AA sequence:KEGG:Pcar_1078"
FT                   /protein_id="ACV50646.1"
FT                   /translation="MKPLIVYYSYSGITRKLAEDIALITDGELLELKPQDPYSFSYNTA
FT                   IKEVRSQIEKGYGPQLCQSSVNIDDFETIFIGSPNWLKTFAPPVLSFLRTTDLSKKTVI
FT                   PFCTHGGGGFGHMLEDYERECNASTIKKGIALKGDYDFNKLRNWLETSDLY"
FT   gene            complement(254575..255315)
FT                   /locus_tag="Apar_0215"
FT   CDS_pept        complement(254575..255315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0215"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: apa:APP7_1823 tetracycline repressor
FT                   protein class B from transposon Tn10"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50647"
FT                   /db_xref="GOA:C8W959"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8W959"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV50647.1"
FT                   /translation="MPSKSLKSPAGSSAKNATKSLTKTSSKSRTLSKKKIFSTALALVD
FT                   EKGLSSLSLRALGQRLGVSQAAFYRHVPNKSALLEGVSEEVLRRALESFISGIERNTEV
FT                   YGQMSWQNYLRAYAVSLHDTLLQHPNAIMLVLTHPISTPGQLSLFAKMLANLSKTGFSA
FT                   PLDMLGIATAVTVYTTGFSASEAVPPVGSTSEEDAPSLSEAIESLPADELDSLSMLIGD
FT                   IMEGKWNFSTQFERGLDALLQGWK"
FT   gene            complement(255332..256105)
FT                   /locus_tag="Apar_0216"
FT   CDS_pept        complement(255332..256105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0216"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sus:Acid_1494
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50648"
FT                   /db_xref="GOA:C8W960"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C8W960"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV50648.1"
FT                   /translation="MTTLKQFAAVVRLNIRLQLMDPTPTLILSIFPLVMIPFMEPAFKS
FT                   MLLADGYTNVTGVEQAIPGMAIFFSFLSVQTIIQSFFREYAWGMWPRLEASSTPQGTIL
FT                   AGKAFVAYLIQAVQVLTVLGLGALIFGYRPTGNVVALILVILTFSAVLAALGVALALWT
FT                   PTEDIALSLSNIVGMLAAGIGGSFCTVSSFPDWAQSVAKFSPAYWALNAVHAVSLDGAG
FT                   MTDVLPQIGMLGIFFVILTILVVIQFTFKKGQQSR"
FT   gene            complement(256092..257024)
FT                   /locus_tag="Apar_0217"
FT   CDS_pept        complement(256092..257024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0217"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcy:Bcer98_0215 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50649"
FT                   /db_xref="GOA:C8W961"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W961"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50649.1"
FT                   /translation="MSDIKKGSPALQLSAVQKSYGDHHVLCGVDLKVMPGQILGLLGKN
FT                   GAGKSTLIEILCGLRQADSGSISVCGMNPAKESVGHLIGYAPQDLGIYPDLTVMENLTY
FT                   YGQLEGLSRKRSFARAEEVMELLGLTSEKTKRARHLSGGQKRRLHSGMAIMHEPKVIFM
FT                   DEPTVGADVEARSRILHTMQSLAKNGATIIYTSHYLAEFEELGADIAIIHNGRIAAEGS
FT                   LEKIITNYARSSVSLQFSQPVPSIDGWQSSGVKLLRENNANDAGSAIADLLANPALREN
FT                   TLENVHISQASLQSAYLSIVGEETNHDNA"
FT   gene            complement(257214..257831)
FT                   /locus_tag="Apar_0218"
FT   CDS_pept        complement(257214..257831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0218"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG: Clan PC(S),
FT                   family S51, peptidase E-like serine peptidase ; K05995
FT                   dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50650"
FT                   /db_xref="GOA:C8W962"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8W962"
FT                   /inference="protein motif:PFAM:PF03575"
FT                   /protein_id="ACV50650.1"
FT                   /translation="MKLFLTSYLAGTKELVQNFLTQNDIQEILFIPTAANVEEYRGYVD
FT                   EGIAALKENGYNVTILDVATTPHNKSVQTIKNSGCLCISGGNTFYLLQELKRNGLLDLI
FT                   KQKVQDGTLYIGESAGAIIACPDISYNQIMDNKTVATELTNYSGMGLVDYYVLPHNGEF
FT                   PFVETTAQTIKVYGEKINLIPLNNSQAVIVENEDFSILTEPL"
FT   gene            complement(257917..259119)
FT                   /locus_tag="Apar_0219"
FT   CDS_pept        complement(257917..259119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50651"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8W963"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50651.1"
FT                   /translation="MKKNEVILKRQSTRIYFKNGDTDFFFNWLLGIGEVFGFSHGELYF
FT                   LTQKLGKSPKPDDWKNIFLSHGNYLKQKASNSDLSEQTKAQYYLAQTYSLRSAIQFINP
FT                   FSDEYLSTVHQMEQAFSNAIHSLGAPIEKLTITYQDSYLPGYYLHTGDDCPTLIMIGGG
FT                   DTYREDLFYFAGYPGWIRKYNVLMVDLPGQGSNPSRELVFDVDASAPISLCIDWLENRN
FT                   SKLNYLAIYGVSGGGYFTAQAVEKDPRIHAWIASTPIYDVAEVFRKEFGSSLKTPSWLM
FT                   NTILKLAGNLNESANLNLKKYSWQFGTSDFKSAIDEVFDRAKIVDYQKIQCPCLFIMGE
FT                   GESAELQHQTKVIYEALRFKNPQTKIQVFEAESGADAHCQVNNLRLAHNVVFDWLDTLF
FT                   K"
FT   gene            259396..259785
FT                   /locus_tag="Apar_0220"
FT   CDS_pept        259396..259785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0220"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bam:Bamb_5788 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50652"
FT                   /db_xref="GOA:C8W964"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W964"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACV50652.1"
FT                   /translation="MIIRIDQMDQMPVYQQIRNQIVAAIGQGELCPADRLPSVRSLASD
FT                   LGINIHTVNKAYAVLRDEGYLFMRGRSGAIVADFKQTATPERIAINSDELAEKLQQLAL
FT                   EHRAQGGTKESFLEIAHTQAKYAFA"
FT   gene            259801..260922
FT                   /locus_tag="Apar_0221"
FT   CDS_pept        259801..260922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0221"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50653"
FT                   /db_xref="GOA:C8W965"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:C8W965"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ACV50653.1"
FT                   /translation="MDIISISAQTIVTFVVGLFLTFIPYITRHNECFAVTVPVSAQKDS
FT                   RMISLKKRYVVEMLLTTILATISSVIAGKLLTTNQTIAGLTLLYSALVIPAIVSFVLML
FT                   HARSKVIALKKSEGWDFEQHKMTASVVEKDFPNPISLRWNLMYIPIILGTVCLGFVLYP
FT                   SMPDMLPMHADFTGTIDSYTPKTFGSALGFPVAFEVFMAACFIFSHWMIVHSKHAVDPS
FT                   EPATSAFSYGVFARAQSIFLFIIGLLISGGLGVLFILASAGRISLGQVGFIAEIFAVLT
FT                   VVGILVLSAVYGQSGSRVFRKLDHNENYLSDEDRHWKLGVFYFNREDASIFLPKRFGVG
FT                   WTMNFARPAVWVIIVGLIIFPIVFVVLVSYLAG"
FT   gene            261120..261401
FT                   /locus_tag="Apar_0222"
FT   CDS_pept        261120..261401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0222"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: nmu:Nmul_A2034 RelB
FT                   antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50654"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:C8W966"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACV50654.1"
FT                   /translation="MTIAATESISAKLRKDEKDRFSVICDEIGTSPSNAIRMFVSAFNR
FT                   RGGFPFDPSNPYGFDAETLAAMDDAVVGRNLSGPYRSVKEAMDALNKE"
FT   gene            261404..261682
FT                   /locus_tag="Apar_0223"
FT   CDS_pept        261404..261682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0223"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: lpc:LPC_2177
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50655"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C8W967"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACV50655.1"
FT                   /translation="MLELKFTAKFKKDYKRAQKQGKDLKKLEKILEKLVCREELPKSAC
FT                   DHSLGGVYRGHRECHIEPDWLLIYRINEDEFILAATRLGSHGDLLGM"
FT   gene            complement(261742..262245)
FT                   /locus_tag="Apar_0224"
FT   CDS_pept        complement(261742..262245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0224"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   bca:BCE_1071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50656"
FT                   /db_xref="GOA:C8W968"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W968"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACV50656.1"
FT                   /translation="MKFSIGIEYALHCLLYMVDLNENKSIRVRDFAEFQGISESYLSKT
FT                   FTQLSKAGIVLSSPGIKGGYRLAKSPQSISFWDIVEAIEGKDPLFQCHEIRLSNSTLKE
FT                   IGVLQKADKSPCLISGVMHQGEKEMKKFLSKKTLRWLHDEVFNHAFTKEQQKLTIQWLV
FT                   HHSW"
FT   gene            262382..262756
FT                   /locus_tag="Apar_0225"
FT   CDS_pept        262382..262756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0225"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: dvm:DvMF_2023 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50657"
FT                   /db_xref="GOA:C8W969"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8W969"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACV50657.1"
FT                   /translation="MLSEKFFECLDKDGIVAIATANEEGQAHLVNTWNKYIIVTEDEKI
FT                   LIPCAGFHKTEKNVANNSYVEMSIGSPEVMGRNYMGAGFHLTGTAEFHSDGPLFERMHQ
FT                   ERSFCSRIMVFTPETCRQMV"
FT   gene            262867..263319
FT                   /locus_tag="Apar_0226"
FT   CDS_pept        262867..263319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0226"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: gbm:Gbem_0508
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50658"
FT                   /db_xref="GOA:C8W970"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C8W970"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACV50658.1"
FT                   /translation="MKALLVVDVQTDVMRFRDTRGLIEACNDRISHYAPEKVMYVVHKM
FT                   PWERASKKKKFGSGLLVVSDRVFDKRVGNAFSNSQLLQTLKDEQVDEVEIIGIDGNHCV
FT                   KETALGALENGFKAIVNERAVASMNKREFEGTKQQLRDAGVAVITE"
FT   gene            263372..263818
FT                   /locus_tag="Apar_0227"
FT   CDS_pept        263372..263818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_00463 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50659"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8W971"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50659.1"
FT                   /translation="MKAAIVYYSKHHGNTKKLLDAIAQEYDVELIDVSNTKVFDLSEYE
FT                   VIGFASGIYYGNMHKLVLQYAKKNLPLNKKVFFIYTCGNINKIYMNAIKSIVKAKHAEI
FT                   LGEYECFGFDTFGPLKLLGGIRKGHPTVEEMNRAVEFYTGIVNK"
FT   gene            263971..265368
FT                   /locus_tag="Apar_0228"
FT   CDS_pept        263971..265368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0228"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   swi:Swit_2151 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50660"
FT                   /db_xref="GOA:C8W972"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C8W972"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV50660.1"
FT                   /translation="MFHFDRKLQQQESDTSSASDNTTDVISRIGVITPTEDEEDAEARE
FT                   AYESLMRHRKIRRRKKFIKVGIVLGIVVLVAILVILRLLQDANQVEAPVTSTTFITRGE
FT                   FIDSVSASGSIKPISSTVVTPEVNGIIQDVQVTEGSTVKKGDKLFTIKNDELDKAVRKA
FT                   AQQVKAAENEVSKARSALVSARNGVSEVGENGQEANAASGAAAVEAAEANLESAQIALE
FT                   EARSAYNDAVDQADKRVVTAPCDGTVIVMNAVNGASVGSSAPGSGNSGPLITIADLSQM
FT                   KVNVQINEVDISRIAADQKAQVTFTALRDLYCDAVVTHVSAVSSSGADASTSYDSPGRS
FT                   IVSYTVDLLISSPDASIKPGMTANVDIMIQHMDNVLTVPLVAVMDDGDGAYVNVVTSRD
FT                   EKGHLQVKRVPVTVKAQSSTTAVIEGAGIEDGTEVMIGGGSGPSQGADMDAPEGATAGS
FT                   TGSKDSK"
FT   gene            265378..266172
FT                   /locus_tag="Apar_0229"
FT   CDS_pept        265378..266172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0229"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_7937 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50661"
FT                   /db_xref="GOA:C8W973"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W973"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50661.1"
FT                   /translation="MSKVIEVHKLHRIYETAAGLTHALRGVSLTVEKGEFLCIMGPSGS
FT                   GKSTLMNILGCLDTPTAGSYKLEGLEVADLSDDDLAEIRATRLGFVFQSFNLLPRTTVL
FT                   RNVTLPLIYSDIPAKERELRAWKALRSVGLPEEYYEHKSNELSGGQVQRVAIARALVND
FT                   PAVIFADEPTGNLDSATSEMVLNTFKSMQERGKTIVLITHDPETALWADRVVHIRDGRL
FT                   LTDEQEKEFVKHHTAQTSTDVQAATGVQTAVDVQTATGGATL"
FT   gene            266169..267377
FT                   /locus_tag="Apar_0230"
FT   CDS_pept        266169..267377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0230"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rce:RC1_1640 macrolide-specific ABC-type efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50662"
FT                   /db_xref="GOA:C8W974"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C8W974"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACV50662.1"
FT                   /translation="MRLMDLLRETLSALNANRGRSLLTVLGIVIGISAVITMTALIDGI
FT                   KYSLVSSLGLNQSRMVMIYAWPDREVTQQDLEMLQLSVPGYELVTGIDSTMAHISSAEK
FT                   QFDARIIGCTPDYFTAMGLKASVGSLFTKSDVDDKSRNVLLDKKSAEKLFGSADASIGQ
FT                   VVRIDNDSYTIVGVTNGGPNAGGQGETLLAYMPYSTYSVRLTGTKTISQIFGYARENVD
FT                   MKALADKTKSWLLDWFNIPSAQAEDRVTVMTLSSIIEQMNATLMSFQILVTATASISLL
FT                   VGGIGIMNMMLTNVTERIREIGLRKALGARASDITKQFLCESILICIMGGVIGIALGYA
FT                   GAWGLAGSFSRMITIDTGITPIITPTIVMVTSGICIGIGLIFGYWPARRASKLNPVESL
FT                   RYQ"
FT   gene            complement(267405..268238)
FT                   /locus_tag="Apar_0231"
FT   CDS_pept        complement(267405..268238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0231"
FT                   /product="protein of unknown function DUF364"
FT                   /note="PFAM: protein of unknown function DUF364; KEGG:
FT                   ccv:CCV52592_1453 sigma 54 modulation protein/ribosomal
FT                   protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50663"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:C8W975"
FT                   /inference="protein motif:PFAM:PF04016"
FT                   /protein_id="ACV50663.1"
FT                   /translation="MGNFLLEETATKVKDILGEKINDLSIERAVFGLFFSGVKLSDGQG
FT                   GLCFTPVKEIPQAVCCPSSARAMPLSGRLTKRSIEETLADLNSNNILRKTLAIATLNAL
FT                   SASCWNAGEAKRGGYALELDKNTFDEVEIPVEGKTVVVGALVPILKRLIKSHADFTVLE
FT                   MDKRTLKGAELDHYAPPEDAHLYIPDADLVVITGVTVLNDTLPDLLQLVKPGAEVVVTG
FT                   PTASMLPDVFFTHGVTMMGGVLVTKPDEVLDCISEGGSGYHFFGKSAERLIIKKA"
FT   gene            268497..269108
FT                   /locus_tag="Apar_0232"
FT   CDS_pept        268497..269108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asu:Asuc_2076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50664"
FT                   /db_xref="GOA:C8W976"
FT                   /db_xref="UniProtKB/TrEMBL:C8W976"
FT                   /inference="similar to AA sequence:KEGG:Asuc_2076"
FT                   /protein_id="ACV50664.1"
FT                   /translation="MGIVSVHTNKHQKLKRIDIIGGVVFAVLTVAIITVFFTNSMFFEW
FT                   AFARHHNTLSWYIRPLFIIPIALGAFKRSYTITFASIFCLFTSMFWFPEPAVVDKSVDG
FT                   FLSFEKTYLTSGWSLDKIIALIAIILFFIFLIYTTWNRKWKWLLVVIAAGAVLKVIHSL
FT                   VFSGEDALSIVKPAVLGLILCVAAVVFFVRRRNNTDNSGQ"
FT   gene            complement(269150..270412)
FT                   /locus_tag="Apar_0233"
FT   CDS_pept        complement(269150..270412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0233"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: mrd:Mrad2831_2432 acetylornithine
FT                   deacetylase or succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50665"
FT                   /db_xref="GOA:C8W977"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C8W977"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACV50665.1"
FT                   /translation="MSSRTNFDASKLPNNLPEVAKMTAQLVALKSTDPGSYEEEIETFI
FT                   KTWIVNSCSFSLPNKKEMFPIIQEVEVFPHRRCLRATIPSATTSFDSSTLPPSDLTFIC
FT                   HMDTVTDGDGWDSETPAFNPVYKDGLLYGRGSCDMKGGLACALLAFRDACQTCKTQKTL
FT                   PQKSLSVIFTVDEEANMRGVERVIDAGWVGEKGWVLDAEPTNNAIRGSHKGRTWFKITV
FT                   TGITAHASTPWKGADAIAAMAIVINEIRTAVQSLPTHPELGSSTVTFGQILGGYQPYVV
FT                   PDKAELWVDMRLAPPTTTQAAERIVQQAIKRAQTEICGTHASYDITGNRPSVVLPKDSE
FT                   LLAQLLSCAESCNTPAKLDIFTGYTDTAVIASTCRNTECMSYGPGELERAHKPNEYVPV
FT                   EDLTRVYRVFKSLIKSTICDF"
FT   gene            270610..272073
FT                   /locus_tag="Apar_0234"
FT   CDS_pept        270610..272073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0234"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: rme:Rmet_3725
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50666"
FT                   /db_xref="GOA:C8W978"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C8W978"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACV50666.1"
FT                   /translation="MADSKKSILFQWDGVPSVGELIPLSLQHVVAAVVGIITPAIIIAG
FT                   VCNLAPADKTLLIQVSLVMSGLVTILQAYPLFGKFGAGLPIIMGTSFAYVPTLQAIGAA
FT                   NGIGAILGAELIGGIVAVLFGFFFKKIRVLFPNVVTGTVVLCIGLSLYSVAIGYMAGGK
FT                   SSANFGAPQNWIVALITLAACIYFSNFAKGVFKLGSLLFGMLVGYVVSIPFGMINYESV
FT                   VNASWVELPHFMPFALEFVPATIASVTIVFIVAALEAVGNMTGATVGGMDREPTDTELT
FT                   GGLVSQGVMTMVGAFFGAFPTSTYGQNVGIVTQTRVINRRVFAVAGAILLVAGLAPKLA
FT                   AILSGIPQPVIGGATINVFGTISMTGIRILSKDGLTPRRATIAGLSLALGMGITMTSNS
FT                   LAGPGMPAFINEVFGHSAIVVAALSAIILNLVLPKGGPDKEVVEAVEGAAEVQEEAVGA
FT                   LYKSAATGVPAVEHKPGSVKAYKTGYKSE"
FT   gene            complement(272177..272824)
FT                   /locus_tag="Apar_0235"
FT   CDS_pept        complement(272177..272824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0235"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: dds:Ddes_2335 YheO
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50667"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C8W979"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ACV50667.1"
FT                   /translation="MDMQQIDFLKRLAQGIALQFGSNCEVVVHDLQSKDPAHTIVAIEN
FT                   GHITGRSIGDGPSNVVLKALHSNPEKLHDSPSYLTKTEDGKILKSTTIYLRDEKHKPIA
FT                   IFAINYDIALFSAMEESLRGLITPSNSSEETPQTIPHNVTDLLDELIDQSVHMVGRPVA
FT                   LMTKDDKIKAIRFLNDSGAFLITKSGQKVCSYFGISKYTLYSYLDEAKNQNS"
FT   gene            273176..274531
FT                   /locus_tag="Apar_0236"
FT   CDS_pept        273176..274531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0236"
FT                   /product="selenium metabolism protein SsnA"
FT                   /note="TIGRFAM: selenium metabolism protein SsnA; PFAM:
FT                   amidohydrolase; Amidohydrolase 3; KEGG: Amidohydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50668"
FT                   /db_xref="GOA:C8W980"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017700"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8W980"
FT                   /inference="protein motif:TFAM:TIGR03314"
FT                   /protein_id="ACV50668.1"
FT                   /translation="MLLIVNGRVITRDEAHPYIEDGAVAIEGQKIVAVDTRAKLEAAYP
FT                   DAEKLDAHGGVIMPGLINCHTHIYSGLARGLAIKDCNPHNFLENLEQQWWNIDRHLTLD
FT                   GTRACAYATILDSLRDGVTTIFDHHASFCEIPDSLFAIKDVAKELGIRACLCYETSDRD
FT                   GEAKRDESIAENAAFAKWAADEDDDMIAAMFGGHALFTLSDETLDKMVEANNGLTGFHI
FT                   HVCEGMDDVYDSALNHGTTAVHRLLDHGLLGEKTMLGHCIHVTPADMDILAHTHTSIVN
FT                   NPESNMGNAVGCAPVLEFFKRGIDVCMGTDAYTHDMLESLKVFLPMQRHNACMPNVGWV
FT                   EAMTMLFKNNVKMAEKYFSTKSNGKPLGKLAPGAAADIAIFDYKPFTPFSDENIDGHML
FT                   FGFEGKNCRTTIVNGKVLYKDREFVAFDEDKINAWTMVEAKKLWGELNGRQY"
FT   gene            274659..277652
FT                   /locus_tag="Apar_0237"
FT   CDS_pept        274659..277652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0237"
FT                   /product="selenate reductase YgfK"
FT                   /note="TIGRFAM: selenate reductase YgfK; PFAM: FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: ecy:ECSE_3142
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50669"
FT                   /db_xref="GOA:C8W981"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017701"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8W981"
FT                   /inference="protein motif:TFAM:TIGR03315"
FT                   /protein_id="ACV50669.1"
FT                   /translation="MSDIMRPMKFDHLMNWILDEYENQKTIFGIHAFAKTAGAARPIFN
FT                   EKIETPFGPAAGPNTQLAQNIVASYVTGARFFELKTVQKMDGEELSACVNKPCILASDE
FT                   GYNCEWSTELTVPQAFDEYVKAWVICHILSRELGLGDADGFVFNMSVGYDLEGIKTPKV
FT                   DKYINDMKDASETPVFKEAIAWAKANINRFHNVDEAFIDSIPSRISDSITESTLHGCPP
FT                   DEIERIASYLITEKHLNTFIKCNPTLLGYEYARKTLDSLGFDYIAFDDHHFLEDLQWAD
FT                   AVPMLERLMKLCAEKGVEFGVKLTNTFPVDVTRGELPSEEMYMSGRSLWTLSLSLAKRL
FT                   SEQFDGKLRISYSGGADYNNIKDLVDTGIWPVTMATTILKPGGYERMTQIAGLFADENT
FT                   EAFSGVDVAKVSALLESSLKNARYHKEIKPQPDRHVRGALPLTDCFIAPCRDSCPIHQD
FT                   IPGYLKAVDEGRYADALHIILERNALPFITGTICPHTCTNSCMRNYVDEHVHIRSCKLT
FT                   AAENGLMEVLPTLASRGVVKDKKVAIIGGGPAGLSAASFLSRAGIEVVVFERTNKLGGI
FT                   VRHVIPGFRISEEAIDNDVKLCQAYGATFKTGVEVTDVNTLLSEGYTDVVVAIGAWAPG
FT                   RKTLKSGEALDALEFLEEFKRAPESVNLGTDVVVIGAGNTAMDVARAAKRVAGVQNVRL
FT                   VYRRTKRYMPADEEELQMAIDDGVEFMELLAPGDLSNNHLTCEVMKLGAPDESGRRRPE
FT                   GTGEFVTVPATAVITAVGEQIESNLYTTSGIALDEKGRPVVDNNLQTSLAHVYAVGDGR
FT                   RGPATVVKGIADAMTVAVAIADFNFSSKELSNLEEDVAKIFGKRGQLCGDTDACEQSRC
FT                   LSCPSVCEACVEVCPNRANVAIKVPGVQQQQIIHVDGMCNECGNCAVFCPYSEGRPYKD
FT                   KFTAFWSREDFDNSENEGFLPTADGFLVRLDGSTAIYNVDDEACGLPENIRKMIVTVRD
FT                   SYRYLLNA"
FT   gene            277832..280603
FT                   /locus_tag="Apar_0238"
FT   CDS_pept        277832..280603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0238"
FT                   /product="selenium-dependent molybdenum hydroxylase 1"
FT                   /note="TIGRFAM: selenium-dependent molybdenum hydroxylase
FT                   1; PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; ferredoxin; [2Fe-2S]-binding domain
FT                   protein; aldehyde oxidase and xanthine dehydrogenase a/b
FT                   hammerhead; KEGG: mag:amb1483 aldehyde oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50670"
FT                   /db_xref="GOA:C8W982"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017697"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C8W982"
FT                   /inference="protein motif:TFAM:TIGR03311"
FT                   /protein_id="ACV50670.1"
FT                   /translation="MAEEVEEYTFTVNGETITTTKNKSLLRFLRDDLHLLSVKDGCSQG
FT                   ACGTCTVVIDGVATRGCIMNTKRAQGKVIETVEGLSHEEQEAFVYAFGAVGAVQCGFCI
FT                   PGMVMSGAALIRRNPNPTEAEVKEAIKNNICRCTGYKKIIEGILKAARILRGEEQIDPD
FT                   LERGDNYGVGSKAFRVDVRAKVLGYGKYPDDVTNVDFPDMAYGSCVRSKYPRARVVKID
FT                   TTEAEALPGVVGVLKAEDVPVNKVGHIQQDWDVFIPEGSNTRYLGDALCMVVAEDEETL
FT                   EAAKKLVKVEYEELPIVRNIEEAAAEGAPLVHTEAESNLCQSRHITRGNVQDALKNSAH
FT                   IITKHFSTPFTEHAFLEPECAVAFPYKDGVKILSTDQGAYDTRKEVAHMFGWDETPDKV
FT                   VVETMLVGGGFGGKEDVTVQHISALAAYIFKRTVKCKFTRNESLIFHPKRHAMEADFTL
FT                   GCDAEGHLTALDCDIYFDTGAYASLCGPVLERACTHAVGPYKYQNTDIRGYGYYTDNPP
FT                   AGAFRGFGVCQTEFALEELMDLLAEKVGISPWEMRWRNAVAPGDVLPNGQICDQSTALK
FT                   ETLLAVKDVYEAHKGRAGLACAMKNSGVGVGLPDAGRANIRIEDGKVVVYSATSDIGQG
FT                   CNTVFLQDVAEAIGLPKSVIVNGECSTENAPDSGTTSGSRQTVVTGEAVRGVAFLLRDA
FT                   LLDIEAGKEVSSEPVEAHGDGKTIVYSDGRPYEGLGYADGKALVAGAGIHPKDPVAGLK
FT                   KLEGHEFRYVYFEPTDKLGADKPNPKSHICYAFATTCVVLDDEGKVTDVYAAHDSGKVI
FT                   NPIAIQGQIEGGVLMSLGYATTENYKLQDCVPKSKFATLGLFHAPDIPHIEAIYVEKEH
FT                   LLPVAYGGKGIGEISTIPTAPAVANAYYAYDHVMRTKLPMEDTYYTKSKAKK"
FT   gene            280803..282029
FT                   /locus_tag="Apar_0239"
FT   CDS_pept        280803..282029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0239"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /note="TIGRFAM: diaminopropionate ammonia-lyase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: dde:Dde_1266 diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50671"
FT                   /db_xref="GOA:C8W983"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C8W983"
FT                   /inference="protein motif:TFAM:TIGR01747"
FT                   /protein_id="ACV50671.1"
FT                   /translation="MQPEMKWVLNKMPQSEDRNLQVMSLENVKKARAFHKSFPQYAVTP
FT                   LANLEGMASNLGLGGLYVKDESYRFGLNAFKVLGGSFAMARYIADETGKDVSDCDFEYL
FT                   TSEQLQKDFGQATFFTATDGNHGRGVAWAANRLGQKAVVHMPKGSTKTRFDNIAKEGAQ
FT                   VTIEELNYDDCVRLAAKEAEETEHAVIVQDTAWDGYEKIPSWIMQGYGTMAYEAAEQLR
FT                   ELEVNRPTHVFIQAGVGSLASAMVGYFTNLFPSNPPKFVIMEAGAADCLYKGALAADGE
FT                   PRIVGGDLITIMAGLACGEPNTIGWDILRNHATAFISCPDWVSAKGMRMLAAPVKGDPS
FT                   VVSGESGAVGMGVISTLMTDPAYKELRDALDLTTDSKVLLFSTEGDTDPVRYEEIVWDG
FT                   AWQSTDDVK"
FT   gene            282264..283646
FT                   /locus_tag="Apar_0240"
FT   CDS_pept        282264..283646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0240"
FT                   /product="M20/DapE family protein YgeY"
FT                   /note="TIGRFAM: M20/DapE family protein YgeY; PFAM:
FT                   peptidase dimerisation domain protein; peptidase M20; KEGG:
FT                   ecr:ECIAI1_2992 putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50672"
FT                   /db_xref="GOA:C8W984"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C8W984"
FT                   /inference="protein motif:TFAM:TIGR03320"
FT                   /protein_id="ACV50672.1"
FT                   /translation="MKDLDYGAIKDAANKYSKDMTAFLRAMISHPSESSEEGEVVACIK
FT                   AEMEKLGFDEVKVDGLGNVMGFMGTGDKIIAIDGHIDTVGIGNRDNWDFDPYEGFEDDQ
FT                   LIGGRGGSDQEGGVCSGVYAAKIMKDMNLIPEGYKVMVVGTVQEEDCDGMCWQYIYNVD
FT                   KIKPEFVISTEPTDGGIYRGHRGRMEIRVDVKGVSCHGSAPERGDNAIYKMADIINDVR
FT                   ALNNNGADESTAIRGLVKMLDPKYNPDHYEDARFLGRGTCTVSQIYFTSPSRCAVADSC
FT                   AISIDRRMTAGETYKSCLKEIEELPSVKKYGDDVKVSMYMYDRPSWTGEVYETESYFPT
FT                   WINKESAPHVKALVDAHKALFGDKRIGCEKSMATREGRPLCDKWTFSTNCVSIQGRYGI
FT                   PCVGFGPGAESQAHAPNEITFKQDLPTCAALYVAALNLYDASAVTDDATEFRASLTDNN
FT                   IK"
FT   gene            283698..284900
FT                   /locus_tag="Apar_0241"
FT   CDS_pept        283698..284900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0241"
FT                   /product="carbamoyltransferase YgeW"
FT                   /note="TIGRFAM: carbamoyltransferase YgeW; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; KEGG: aha:AHA_2161 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50673"
FT                   /db_xref="GOA:C8W985"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR017702"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C8W985"
FT                   /inference="protein motif:TFAM:TIGR03316"
FT                   /protein_id="ACV50673.1"
FT                   /translation="MATTIQPYLDKLAKLDFSKMYNEDFLLTWEKSTDELQALYAVADA
FT                   LRNLRERNISTRLFESGLAVSLFRDNSTRTRFSFASGSNLLGLQLMDLDEGKSQIAHGE
FT                   TVRETATMISFMADVIGIRDDKFIGKGDAYMREVSASVKQAFEDGVLDHRPTLVSLQSD
FT                   MDHPTQSTADILYLINEFGGLENLRGKKVAVTWAYSPSYGKPLSCPQSLITLLPRFGMD
FT                   VTLAHPEGYDLMPELVDVAGKFAAESGATFKKTYNMAEAFEGADIVIPKSWAPYAAMEK
FT                   RTNLYAAGDDAGIDALEKELLAQNATHKDWCCTTDLMAKTAHGMDTIYMHPLPADINGV
FT                   SCEHGEVENEVFDYHRDGLYKEASYKPYAIAAMIFLQKAKDPIATLKALEQGDTPRWFQ
FT                   A"
FT   gene            285038..285979
FT                   /locus_tag="Apar_0242"
FT   CDS_pept        285038..285979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0242"
FT                   /product="carbamate kinase"
FT                   /note="TIGRFAM: carbamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: aha:AHA_2165
FT                   carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50674"
FT                   /db_xref="GOA:C8W986"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C8W986"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ACV50674.1"
FT                   /translation="MGKRIVIALGGNALGKNLPEQMIAVKHTAKAIVDLIEQGNEVIIA
FT                   HGNGPQVGMIQEAMTQLNRSDPEKYIPCPLSVCVAMSQGYIGYDLQNALREEMLNRGIK
FT                   KNAATVLTQVEVDKNDPAFKNPTKPIGSFMTEEEAKKMVAERGYNIVEDAGRGYRRVVA
FT                   SPQPVAIVELDTIRSLIETGNVVIACGGGGIPVFITEGNHLKGAAAVIDKDFAAARLAE
FT                   QVNADALIILTAVEKVAIHFGTPEQEDLSELTPESAQAYIEAGEFAPGSMLPKVQAALQ
FT                   FAQSGEGRTSLITLLDKAADGIAGKTGTVIRG"
FT   gene            286047..286697
FT                   /locus_tag="Apar_0243"
FT   CDS_pept        286047..286697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0243"
FT                   /product="Uncharacterized MobA-related protein-like
FT                   protein"
FT                   /note="KEGG: gme:Gmet_2140 molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50675"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8W987"
FT                   /inference="protein motif:COG:COG2068"
FT                   /protein_id="ACV50675.1"
FT                   /translation="MSHIGCIVMASGASTRFGSNKLMASFMGKPLIQHVIETAQTAGLE
FT                   PIVVTIDNPFHEPILVLCNKLKVRAVTHSGTLQSDTVRRAMLEVQKDGLGENSWDGAMF
FT                   LQGDQPCVRADSLCALIASFEEHPKVVSRLSWHGVPGSPIVFPSVLFDMLCRVQGDKGG
FT                   SGVFLLCPEYQASAVLVEAQCEQELLDVDTPSDLNYLHSVSISGLTTERLGVD"
FT   gene            286697..288052
FT                   /locus_tag="Apar_0244"
FT   CDS_pept        286697..288052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0244"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="KEGG: scl:sce6399 dihydropyrimidinase; TIGRFAM:
FT                   dihydropyrimidinase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50676"
FT                   /db_xref="GOA:C8W988"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8W988"
FT                   /inference="protein motif:TFAM:TIGR02033"
FT                   /protein_id="ACV50676.1"
FT                   /translation="MNVLKNGFLVLPEGVFCGDLVLDGTKIIQVGGTYEARIDDNVIDV
FT                   TGKYVFPGFIDAHTHMQCWTGMDWTADSFETGTRAAACGGTTTIVDYATQDKGMTLPEA
FT                   LDEWHKRADGTCTANYAFHMAIADWNEQTKADMQAMRDAGVMSFKTYFAYDHLRLDDAQ
FT                   TLEVLEYIRDIDGVLCVHCENGTLVNELQRRMLAAGITGPEGHPMSRPAACEAEAISRL
FT                   CYLAELADARINIVHLSSALGLEAVRAAKARGKVKMDVETCPQYLLLDDSRYLESDFEG
FT                   AKYVMSPPLRKPHDIEVLRRAVCDGEIDTIATDHCSFNLHGQKDRGIDDFTHIPNGGPG
FT                   VEHRPGLIMTSFENRLGVQDFARLMSEGPARVFGMYPRKGVLRVGSDADVTVWDPSVTW
FT                   TISEKNQHQNVDYTPYEGFEVHGRPAYVFVNGELAVVDGEPTGVKPGAYVKR"
FT   gene            288145..288525
FT                   /locus_tag="Apar_0245"
FT   CDS_pept        288145..288525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0245"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: dal:Dalk_4660
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50677"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C8W989"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ACV50677.1"
FT                   /translation="MSKKAIVTDKAPAAVGPYSAAVSANGSINVSGQLPVDPATGEFAG
FT                   EDIKSQTRQSLTNIKNILEAAGASMADVVETTVLLSDINEFGAMNEVYAEFFADPYPAR
FT                   AAFQVVALPKGAKVEIKAVARI"
FT   gene            288739..289371
FT                   /locus_tag="Apar_0246"
FT   CDS_pept        288739..289371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50678"
FT                   /db_xref="GOA:C8W990"
FT                   /db_xref="UniProtKB/TrEMBL:C8W990"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50678.1"
FT                   /translation="MSVRENDAEVPENTDVQKAMDSLDHDFLTGETLDIGDNVTHQLQQ
FT                   EQATLPRPAVKSADPIQDTQGVTTDVSDKTANNQLFIVAIVAIFSLVVCVALLVFHPWT
FT                   SNQPAQSAQPVQTETVKKEPVKVEVPLASKDVSEYDYEEAQKKFEHAGFTNVTVQKDED
FT                   LKIGLINHENQVKEITIDGDKKFSVGEKYDENVPVVITYHAFPQKSN"
FT   gene            complement(289337..290041)
FT                   /locus_tag="Apar_0247"
FT   CDS_pept        complement(289337..290041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50679"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="UniProtKB/TrEMBL:C8W991"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50679.1"
FT                   /translation="MNCYELLGILPGITSVIGSGGKTSLLTKLSQEVRGTVILTTSTHI
FT                   LPFPNILLLENPTLTEVSDALITHRVICVGSFSSEKHKLGSSVLSAQELAPVADYVFVE
FT                   ADGSKRLPLKAHASHEPVIPEGTQRTVQVIGLSGFGLPIHQAVHRSEIFCKWASCLPDD
FT                   IVTPTRIATVIAAEHASGAVKANVILVNQTDNEKDLTLARDFTQELRLQGDNTPVIAGS
FT                   LFNSTFVEMRDK"
FT   gene            290141..290752
FT                   /locus_tag="Apar_0248"
FT   CDS_pept        290141..290752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0248"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: sat:SYN_01072
FT                   putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50680"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:C8W992"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACV50680.1"
FT                   /translation="MKIDARNLTCPKPVILTLEALPKLSSGEKLDVVINDNVAFGNLTR
FT                   LADEKNCDLTSVKNGSDTTMTFSPRNKVEASDSAVVEASQFCDIPDRSATVVAVDAEYM
FT                   GRGNDELGHILMKGLIYALAHQDTVPETMLFYNGGAHLTCEGSESLEDIKELESRGTKI
FT                   LTCGTCLDFYGIKDKLAVGDVTNLYAIAEIISQQPGVMVL"
FT   gene            290763..291941
FT                   /locus_tag="Apar_0249"
FT   CDS_pept        290763..291941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0249"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: ppd:Ppro_2495
FT                   cysteine desulfurase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50681"
FT                   /db_xref="GOA:C8W993"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C8W993"
FT                   /inference="protein motif:PRIAM:2.8.1.7"
FT                   /protein_id="ACV50681.1"
FT                   /translation="MIYLNCAATSYKRPQCVVDAVSRALCSFGSTGRGAASAELDAARA
FT                   VMVARERIALLLGFSHPERVVFTANATDALNKAILGIVKPGDHVVATDWDHNSVLRPLN
FT                   RLQKKRNVKVDYVPANLQGCLDWDVLERLVSPGTKLVVVTHASNLTGNVCDLERVVTVA
FT                   HAVGALVLVDASQTAGSIPINFDDLGVDVLAFTGHKALMGPQGTGGLLVAPHVAIEAVI
FT                   QGGTGVLSFEEEMPQVYPEHLEAGTLNSHGIAGLSAAVDFVSTQGVCAVHRHDLALVRQ
FT                   FVAEARQVPGIELYGCFPDNISELNGESSQKDHAPIVTLNLDGWTSSELARVLSVEYDI
FT                   SVRAGAHCAPRMHRALGTQDTGSVRFSFGFYTTEDEIHKATTALNELAKSVM"
FT   gene            291970..292122
FT                   /pseudo
FT                   /locus_tag="Apar_0250"
FT   gene            292237..293043
FT                   /locus_tag="Apar_0251"
FT   CDS_pept        292237..293043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0251"
FT                   /product="selenium-dependent molybdenum hydroxylase system
FT                   protein, YqeB family"
FT                   /note="TIGRFAM: selenium-dependent molybdenum hydroxylase
FT                   system protein, YqeB family; KEGG: sbo:SBO_3109 putative
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50682"
FT                   /db_xref="InterPro:IPR017695"
FT                   /db_xref="UniProtKB/TrEMBL:C8W994"
FT                   /inference="protein motif:TFAM:TIGR03309"
FT                   /protein_id="ACV50682.1"
FT                   /translation="MLVVIRGAGDLASGIALRLYRAGLSIVMLDVEVPTAVRRTVAFSE
FT                   AIRLGKKKVENVTAVRAKDAEDALRIVNEKNIAVLIDPQGTNIAKLHPEVLVDAILAKK
FT                   NIGTTKDMAPLVIGVGPGFTSGETSTADCHAVIETKRGHYLGRVIYDGSAIPNTGVPGN
FT                   IGGFTKERVLRAPQDGIFEPVAKIGDLVSKGDIVATVSGMPVKATINGVLRGLLQEGVP
FT                   VFKGMKSGDIDPRCAPGHCFSASDKARAVGGGVLEALCHFTERLVG"
FT   gene            293046..294104
FT                   /locus_tag="Apar_0252"
FT   CDS_pept        293046..294104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0252"
FT                   /product="selenide, water dikinase"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; KEGG: ppd:Ppro_1707 selenide, water
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50683"
FT                   /db_xref="GOA:C8W995"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C8W995"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ACV50683.1"
FT                   /translation="MSNDVKLTKLADCAGCGAKVGAGELAKLLSDIKVHEDPNLLVGFD
FT                   KADDAAVYKVTDEIALVETIDFFPPIADDPYTYGAIAATNALSDVYAMGGEPKVALNVM
FT                   AVPEDMSSHVVYEILRGGYDKVYEAGANIVGGHSIYDNEPKYGLAVSGFVNPKKMYTNS
FT                   GARADDVLILTKALGVGVLTTAAKADMLSIEEMSVAEASMMTLNRYARDIMVNYDVHAV
FT                   TDVTGFSLMGHLLEMCQGSGLLAKITVNNIKFLSTRVFELARLGILPAGMYRNRHYAEK
FT                   YVQAEGVSREMSDVLFCPETSGGLLISVAHDDAQHLLAALQANEHTANSCVVGYMEKQD
FT                   IRNKDATYIVLQ"
FT   gene            294157..295170
FT                   /locus_tag="Apar_0253"
FT   CDS_pept        294157..295170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0253"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   sfu:Sfum_1316 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50684"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W996"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ACV50684.1"
FT                   /translation="MADLQGTLCDEHFVRRLLSELEAGRSFVLSTIFATKGSMPRHAGA
FT                   RMVHFEDGSFLGTIGGGSVELIAQERSKGFFTGEENNQIEWMTREKTGMACGGDALVGI
FT                   RKVTPDQKDFFAKDLMNLIDAKKPFVVIENWSDPSHVLVEAKAVDMFPQDDIRVCSDVP
FT                   IWDEEAATYSEPLGPEPVAYIFGGGHVGRALTPVLASVGFRVIVLDDREGVAQKKDFPS
FT                   AEAVYHNDFSDISTDVTVTRRDYAIVTTHGHAFDIKVLQQLYSYKPAYVGCIGSKRKAA
FT                   FAKHTLVERGVSKGWTQTIHSPIGDDIKAITPSEIAISIAAEIIRCRANFRPEKLH"
FT   gene            295274..296149
FT                   /locus_tag="Apar_0254"
FT   CDS_pept        295274..296149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0254"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: bsu:BSU33380
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50685"
FT                   /db_xref="GOA:C8W997"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:C8W997"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ACV50685.1"
FT                   /translation="MKSESSVTRRSFVASATGAAVFGLSACNGNETKKEDTSGSQKKAD
FT                   AQKLIVFAAASLTESLTEAGELFKNANQGVDISFNFDSSGTLKTQIEEGSDCDVFISAG
FT                   QKQMNQLDANAKKDHDKDLDFIASDTRFDILENKVTLCVPQDNPKVVKSFDDMATKLTS
FT                   GEVLLGMGNSDVPVGQYTQKILKYYKLDEEKLAKEGHISYGTNVKEVTTQVKEASVDCG
FT                   VIYKTDATSAKLQMVDEATEEMCGRVVYPAAATKNAKQADLAKKFLEFLKTSDASACFE
FT                   KVGFTPLSKA"
FT   sig_peptide     295274..295363
FT                   /locus_tag="Apar_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.395 at
FT                   residue 30"
FT   gene            296182..296871
FT                   /locus_tag="Apar_0255"
FT   CDS_pept        296182..296871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0255"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RS05467 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50686"
FT                   /db_xref="GOA:C8W998"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W998"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ACV50686.1"
FT                   /translation="MDWYPLYNSLRIAAASTALVFLLGIALANLVAKTPRIIKGLLDVI
FT                   LTLPLVLPPTVVGYLLLLLLGPRRPIGFWVMDVFGIKLTMVWYAAIFATVVVSLPLMYR
FT                   TTRGAFESFDETLADAARTLGKSNTWVFWHVKMPCCMKGVVAGTVLAFARALGEYGATS
FT                   MICGYTPNTTATVSTTVYQLWRTGDDAAAIQWVLINLAISAVVLLALNIFEKGSRRARV
FT                   ATPVQEA"
FT   sig_peptide     296182..296268
FT                   /locus_tag="Apar_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.603 at
FT                   residue 29"
FT   gene            296874..297977
FT                   /locus_tag="Apar_0256"
FT   CDS_pept        296874..297977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shl:Shal_0899 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50687"
FT                   /db_xref="GOA:C8W999"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W999"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50687.1"
FT                   /translation="MALSVDIAKHLDGFDLHVSFVVEKGNEVLALLGPSGCGKSMTLKC
FT                   IAGIVKPDSGRIVLNDRVLFDSEAHINLPPQERHVGYLFQSYALFPHMSVMQNVLVGAK
FT                   GETQAEREACALEQLKKVQLDGLLDRRPHELSGGQQQRCAMARILASKPDLILLDEPFS
FT                   ALDSYLRWQLELELSDTLRAFPGGAIYVSHNRDEVYRLCDSVCVINHGNSDDKVSVYEL
FT                   FSTPTTLAAARISGCKNISRAHKVGEKSLFCDEWGLSLTTALPVDEQVKYVGIRAHYFQ
FT                   VVDCASEYKNIIPCQVNRVIDNTFSTIVMAQTPGGSLLRYECSKESWARLGEPRQVLLH
FT                   VAPEYVMPLCDGEEKHSVVEEKKSLYV"
FT   gene            297970..298917
FT                   /locus_tag="Apar_0257"
FT   CDS_pept        297970..298917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0257"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sat:SYN_00381 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50688"
FT                   /db_xref="GOA:C8W9A0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A0"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ACV50688.1"
FT                   /translation="MYDELGRNIRYLRLSVTDRCNCRCLYCMPAHGISMLRHEDILSFE
FT                   EMRAIVEASAQLGVRKVRLTGGEPLARRGIVDLVRMVSAVEGIEEVVMTTNATLLAPLA
FT                   KDLKAAGLSRLNISLDTLDSELYTKLSRTGTLDDALAGIEAAREAGFIYTKFNTVLLGG
FT                   LNESEIRPLAERAKSEPVDVRFIELMRMGECSKWPAERFISADCVLKVLPELEAAGSNG
FT                   VTELFQAPGWRGRVGLIRPMTHTFCSSCDRIRVTADGMLKPCLHSAREIPLRGLVGDEL
FT                   VQVLRQGISQKPEGHIMSLSHASESLRAMNKIGG"
FT   gene            298919..299398
FT                   /locus_tag="Apar_0258"
FT   CDS_pept        298919..299398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0258"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: hip:CGSHiEE_03685 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50689"
FT                   /db_xref="GOA:C8W9A1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A1"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACV50689.1"
FT                   /translation="MAFTHFNSQGHAHMVDVSAKEKTARTARAKGKIFMRHDMLELVRT
FT                   GGIQKGDVLSVAQVAGIMAAKRTWEIIPMCHPIQLTGVDISFAFEGDGIAVEACCRCTG
FT                   ETGVEMEALTAASTACLTIYDMCKAHQRDMVIDQICLLEKDGGASGHFVREEQNK"
FT   gene            299395..299883
FT                   /locus_tag="Apar_0259"
FT   CDS_pept        299395..299883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0259"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   gme:Gmet_0302 MOSC"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50690"
FT                   /db_xref="GOA:C8W9A2"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A2"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACV50690.1"
FT                   /translation="MSVGVTESAKRGTVLSCCISVKKGTRKVPVDSIEVCVGEGIKGDA
FT                   HAGNWHRQVSLLGNESVDTMREKGAELHPGDFAENILTSGLALRELPVGTVLAIGDTLL
FT                   GVTQIGKVCHHDCEIRKLVGTCVMPTDGIFTVVLRGGTIRPGDAICVVDAKELLHETD"
FT   gene            299870..300904
FT                   /locus_tag="Apar_0260"
FT   CDS_pept        299870..300904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0260"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   dds:Ddes_1824 molybdopterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50691"
FT                   /db_xref="GOA:C8W9A3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A3"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /protein_id="ACV50691.1"
FT                   /translation="MKQIRTEDAVGHVLCHDMTQIIPGESADDKTRFKGVRFKKGHVVE
FT                   KADIPVLLSMGKEHLYVWELGDNQLHENDAAYRMAALCHGENCLVSKEPHEGKLTITAA
FT                   VDGVFELDVQRLNAVNAVDEVMIATRRGNIAVKKETPLAGTRVIPLVVDTSVVEAAEAA
FT                   ADVEHKGALMRVVPFCVKTAALIATGSEVQKGLIEDKFTPVVEKKLAAFGIETVHCAKP
FT                   GDDMDALVAAIRKAQHLGVDMIVCTGGMSVDPDDNTPGAIKRSGAHIVTYGAPVLPGAM
FT                   MCLGYLDAANSSTSQIPILGLPGCVMYSATTVFDLVLPRIAAGIELTKHDFVALGEGGL
FT                   IVKE"
FT   gene            300907..301416
FT                   /locus_tag="Apar_0261"
FT   CDS_pept        300907..301416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0261"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   sfu:Sfum_0070 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50692"
FT                   /db_xref="GOA:C8W9A4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A4"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACV50692.1"
FT                   /translation="MPESSCDATSFSARVITVSDRSSRGERPDASGPALVAFLGEKGFA
FT                   VDAYAEVVPDERQQIARALRNAISDDIALVVTTGGTGFSPRDITPEVTSEVCERMVPGI
FT                   PEAMRAASLLITPKACLSREVAGIAQRTLIINLPGSPKAAIENLAAVLDVLPHGLGILR
FT                   GTILDG"
FT   gene            complement(301485..302696)
FT                   /locus_tag="Apar_0262"
FT   CDS_pept        complement(301485..302696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0262"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dar:Daro_2073 NAD(P)H dehydrogenase
FT                   (quinone):NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50693"
FT                   /db_xref="GOA:C8W9A5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A5"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACV50693.1"
FT                   /translation="MKFVGIVGSNAEISYNRKLLHFIKKHFAKQFELEILEIDNIPLFN
FT                   QDLKWDENFQLRLLYNRITRADGVIISTPEHNHTISPALKSVIEWLSYDVHPFEDKPVM
FT                   IVGASYYDQGTSRAQVHLRKILDAPGVNAFVLPGNEFLLGKAKQAFDEDGNIIDERTVS
FT                   FLGFCLDNFVKYVEVVSKLKKPKPIAPEDLDVTNSISTTIQGIDPDDPDWVEKAAELVG
FT                   AVSGDTYVKLNHGILTVNQIDMFLKAMPFELTYADDNNQFLYYNNVHDNPDTMLAKRVP
FT                   EQSGNRLSTVHSSLPEGRMKNVEYVIGVLRNGDKEYVRTIVPGTPADIINTHNYQAMYY
FT                   PDGSYAGINEIVFNFKPWLDWYLQTTGQRLVGGAGMPMPPTGAPSGNADGSNSSVDAIS
FT                   GASA"
FT   gene            complement(302717..303325)
FT                   /locus_tag="Apar_0263"
FT   CDS_pept        complement(302717..303325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0263"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dar:Daro_2073 NAD(P)H dehydrogenase
FT                   (quinone):NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50694"
FT                   /db_xref="GOA:C8W9A6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A6"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACV50694.1"
FT                   /translation="MLNFVGLIGTNSKESNNRRLLQFMQKHFADKATIELVEIDNIPLF
FT                   NKPAKMRVPKVVSELAKKIEAADGVIIATPEYDHSIPAVLQNALAWLSYGIFPMVNKPV
FT                   MIVGASLGTLGSSRAQLQLRQILDAPELKAAIMPGSEFLLGRAQQAFDEKGNLKDKATV
FT                   KKLDLLFDDFRLFVKLNEKMAASRELLRKEAENFDWENL"
FT   gene            complement(303343..304305)
FT                   /locus_tag="Apar_0264"
FT   CDS_pept        complement(303343..304305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0264"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: eta:ETA_19250
FT                   putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50695"
FT                   /db_xref="GOA:C8W9A7"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A7"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACV50695.1"
FT                   /translation="MSELAYVSRSTHLMGATITISLLSPQNDMQMECSAEQLLNGVFDL
FT                   LHIYNQRFSANDANSELMQVNHAAGKHSIPVHPELFELIQIGKEQSLLPASHLNIAIGP
FT                   LVQAWRIGFTDARIPNKTEIAHALALTDPQLIELDPLNYTVFLAKEGMKLDLGCLAKGY
FT                   IADKIADYLKSQHVTSALINLGGNIKTIGTNLLAGRPWQIGIQDPQQPRGTNLAVLPIR
FT                   NQSVVTSGTYERKLQVSGQSYHHILDRDTGYPVDTQLASITIISDNSLDGEIWTTRLYG
FT                   EKPNQLLARVEQEKDIDALIVTNDNRVYYSSGISPELLA"
FT   gene            304594..305370
FT                   /locus_tag="Apar_0265"
FT   CDS_pept        304594..305370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50696"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50696.1"
FT                   /translation="MRSIFEDRQVSIKCDNKYSYTVTKDGLAYVPGNGKPEVRILFSEV
FT                   GSTFLLNYCSSNGPYEITFKSNDGHDIASIDTDLKLREFGHNILDTKTIILAFAAHKLT
FT                   NEFPNNLEILNTTLGFSFKEKKITISNGVISGAKHQVKLSDIRRVQCVAGGALNNLFVF
FT                   TKEKGGFFDRADIVVPVNELTVPILEATMRRNTGHGIDFSRGNGFDQPNSNFIIIRYLD
FT                   SSFFETAPGVFKEDWQKDAYEFVKSFGYDLQTMLGE"
FT   gene            complement(305471..309523)
FT                   /locus_tag="Apar_0266"
FT   CDS_pept        complement(305471..309523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0266"
FT                   /product="cell wall/surface repeat protein"
FT                   /note="TIGRFAM: cell wall/surface repeat protein; PFAM:
FT                   surface protein from Gram-positive cocci anchor region;
FT                   KEGG: similar to zymogen granule membrane glycoprotein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50697"
FT                   /db_xref="GOA:C8W9A9"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9A9"
FT                   /inference="protein motif:TFAM:TIGR02543"
FT                   /protein_id="ACV50697.1"
FT                   /translation="MERKNKNFAGKGAKTAMSLVLALSLVPSSALAEIANTQETTQAQE
FT                   VAATQTSDTTASTSEATAETTAESTVNTEATTNQQTSTNQQTSEQTTTPTDRSSRRVAR
FT                   SLSVTSTELWVDGTNGNDANDGSNTNALKTLQKALELCSETPSINTIHLKGNLDLTSTV
FT                   TIPAGLTLKIADEGATLTGTGNRIDGLVLKSGSTLTGTGTLTMSGFKTALTAQPGSTIT
FT                   DGTYVFKNNAGSSGSRGISLGGTVKGTTNKNSVSITADDKSNTNFFESGSTFENATINV
FT                   TSQARTWNDARNLTLKNTDLKVKGFGQTFYVNQLNMTDSTLTINPSYWGQTGMTIQGPS
FT                   NIVNSTINANAGSTSGISVGVAGGTVNVTNSTLNFTNGGTGGLNVNTGNVIINNSTIKG
FT                   DGRNSGALFGAQTNGSIQFTGNSLVETPATKNSDNGAGQTRQNYNVVGGSYLLKYAPDY
FT                   NSGFGSTIPTNGAANGNEALSLFTLADVSTNSLSLINANGATYTYPVANASSDGQKHVW
FT                   APAATVTFDLNAPGVTGINPTFADGTTANKTALAMRGNSLATASSVAEGSTTLPADPYA
FT                   SGQEFDGWYYTDASGTEHQFTADTQVTSDMTVYPHWKANTSWLYVRYHNGNGVSVIDRV
FT                   ATNANRTVTVRSNTEVNNLNNNFNIAGKTFKRWTTQANGAGDEVAANSNLAIPTGTDTI
FT                   DLYADWEEQRLTVSFSANGGTFSANSVFKQNPNVFDITTDANGGEVATIKTHPTVAEQT
FT                   NINALLRNLSGNTLSATTAGIASPTDSNTNTAYTNIATLENHILDSEDKPKTFFGFVVG
FT                   HDYHYWFTDAAGNSPATINGGATLTNDVTYYLKWKDDPSIQKVELTSDLPADMWSDSQN
FT                   NTTQIKEVSNDKSFSLTGAIDATSVINQMTNFENNIAGGLDDLTKITLSGTTSTFTAKL
FT                   TLPAGVVVPANPTVTTSGLGDLFDVSNVSVNGQEVTVTLKLKNTYSNYKQLKDAVETVG
FT                   KDDAATAEIARPLTVTVNGLTLDSTQVTNGQELTATGTLTGTFESYAKNTVTNVTKKYN
FT                   LSWNGVQITANRDPRGTDIQQTLIVNNPIDMNIPADMLADENTEHDQVITMKAGSTFNL
FT                   TGSILASSIQEQMNNIERAYPNTNHDTITLSNLKFKFTATLTVPEGMTLPSNLDASTVQ
FT                   ASNFGSGFKVSDVQVNGRTVTVTFELSDPSSIRTYSDLERIVDEASANGGWMKLTIPGV
FT                   TIDSNVAAGTQLTAVGTVTGSFSAIADSAAGNRKAFSFTWNGVQWPDGKDAVATNNDTI
FT                   QLTITVAEDKTPETPSPSTPTKKKPSKKKKTPYTGDASVAAPLGVLLAGMTTVMTSLGI
FT                   TKRRKNK"
FT   sig_peptide     complement(309425..309523)
FT                   /locus_tag="Apar_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            310048..310692
FT                   /locus_tag="Apar_0267"
FT   CDS_pept        310048..310692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0267"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: bcb:BCB4264_A2172 HD domain protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50698"
FT                   /db_xref="GOA:C8W9B0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B0"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACV50698.1"
FT                   /translation="MNPKIIDDALDFVKQIFSTDFSGHDYFHTLRVYKMAVKIAQEEGA
FT                   NQEIVALAALLHDVDDIKLSPETHEHKERAVAFLRQHVVDEVIIQAICTAIDEVSFSGT
FT                   DSVIPSTLEGMCVQDADRLDALGAVGIARTFAYGGSHGRAMYDPDEPPTLNMNGEEYHS
FT                   HKSTSLNHFYEKLFLLANMMNTRSGKKLGKTREKYMREYVDEFLDEWNGER"
FT   gene            310794..311921
FT                   /locus_tag="Apar_0268"
FT   CDS_pept        310794..311921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0268"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /note="PFAM: Methionine synthase vitamin-B12 independent;
FT                   Cobalamin-independent synthase MetE domain protein; KEGG:
FT                   asu:Asuc_0713 methionine synthase vitamin-B12 independent"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50699"
FT                   /db_xref="GOA:C8W9B1"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B1"
FT                   /inference="protein motif:PFAM:PF01717"
FT                   /protein_id="ACV50699.1"
FT                   /translation="MAIKNDKTTPHRFDVVGSFLRPENLKQARIQFEKGQIDAHELKLV
FT                   EDKAITELIQKEKQAGLKVITDGEFRRATWHLDFMWAFEGIGHAPTNTGLPFHDETAEI
FT                   DDTFLVGKVELTKEHPFIEHFRFVQQFEDETTVAKLTIPAPAQFIEQFIMPMNREQTKK
FT                   YYADDQELLEDIVAGYGTFIEQAYAAGCRNLQLDDCSWGVLVDPRAELFFGADQEGLKK
FT                   IKALLLEINNRVLDAAPADLTINTHVCRGNFHSTWACEGGYDDVADTLLAQEHVNAFFL
FT                   EFDDHRSGGFEPLASVPAGKKVVLGLITTKHAQLEEKTKVIERIHETAQYVPLENLCLS
FT                   PQCGFASCEIGNKLTEEEQWAKIAFVKEIAEEVWG"
FT   gene            312054..313046
FT                   /locus_tag="Apar_0269"
FT   CDS_pept        312054..313046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0269"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: bha:BH1815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50700"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B2"
FT                   /inference="protein motif:COG:COG2378"
FT                   /protein_id="ACV50700.1"
FT                   /translation="MPSEKTRCLHLVKIFEEETDDDHGLSTPQLIERLAERGLSVERKT
FT                   LYDDIKSLQNFGYDIQSYQRHPVEYGLATRKFQAEELMLMADAVQSSKFLTERKANNLV
FT                   SLIGDLGGKSTSDTLKKRIHVEGRIKSQNESVFYALNAIQTALLQKKKVSFKYRKKGFK
FT                   DKVIEELPVREETPVQLTYIDDFYYLIVWNDKHQNFVNYRVDRMFRLEVSDADATVNEQ
FT                   IKRFDIDKYQERVFGMYSGEVVAVTLRVNERVMCSVYDRFGKNIILNNLSSDGATADVH
FT                   VSVMEAPTFYGWLATFGTDIELVAPKKTRQKYQEYLSGILQSYQSQKED"
FT   gene            complement(313085..313408)
FT                   /locus_tag="Apar_0270"
FT   CDS_pept        complement(313085..313408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50701"
FT                   /db_xref="GOA:C8W9B3"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50701.1"
FT                   /translation="MYSPTKLVDSFVISGLPYYDAPLIFDQLKLGSDLTIVPERDNPYD
FT                   PEALALYSNNNKLGFIPKESNSLWSTLLFYGHQNIITCKITQLSDHHGHLLVKAGLYVI
FT                   DAR"
FT   gene            313527..314075
FT                   /locus_tag="Apar_0271"
FT   CDS_pept        313527..314075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0271"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sml:Smlt2135 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50702"
FT                   /db_xref="GOA:C8W9B4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV50702.1"
FT                   /translation="MITTKRLFLIPWHASDADELYELAKDPEIGPLCGWEPHKTLEDSK
FT                   QVLANVLSDKSCYAVKDMKTGHVIGSMSLNFEEISDLKDPSKQLHQAEIGYWIGRPYWG
FT                   QGLAPEGVQALTSYAFEEHGVDQVIIRYLEHNKKSASVARKCGFTEVGIITDFNKYTGK
FT                   EEQFGISMLTKADWERVQK"
FT   gene            314280..316016
FT                   /locus_tag="Apar_0272"
FT   CDS_pept        314280..316016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0272"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   hiq:CGSHiGG_06595 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50703"
FT                   /db_xref="GOA:C8W9B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50703.1"
FT                   /translation="MMINKRLIALIEESKKYIGLTVLYQWIALIANIVFMYSLARMIEA
FT                   LFMDYFVFEEQLLFIVLCLIAIVIRYFCKLAQHKTSFYAAKRVKKTLREKIYQKLLEFG
FT                   PSYKNSYATSEIVQLAVEGVDQLETYFAQYLPQFFYAVLAPLTLFLVLLFISPVVGIVL
FT                   LVFVPLIPMTIVFIQRFAKKLLSKYWGQYTQLGDTFLENLQGLTTAKIYKADDFKHKQM
FT                   NEEAEHFRRITMKVLTMQLNSITVMDVVAFGGSALGTILAIQQVNDQLLFMWEGVFVIL
FT                   ISAEFFLPMRLLGSYFHIAMNGMAASDKIFNLLDMPVQEQGAKTFPASSDVSLRNVSFS
FT                   YDGEKPVLVNVSFGMHANSLNALVGESGCGKSTIAALLTGKLRSYSGDVLFGNTSLADI
FT                   SDQNLLQNVTYIGHQAHLFMGSVRSNLVMGNPEATEDQLWHALEQVNLAEFIRSLGGLD
FT                   APVAEKGSNLSGGQRQRLALARALLHNSQMYIFDEATSNIDVESEDVIMQQVHQLAQSK
FT                   MVLVISHRLVNVKNANQIVVMQHGRVVGSGTHQELLATNDEYKRMTQAQTELENYVKGV
FT                   EA"
FT   gene            316016..317716
FT                   /locus_tag="Apar_0273"
FT   CDS_pept        316016..317716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0273"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hit:NTHI0785 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50704"
FT                   /db_xref="GOA:C8W9B6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50704.1"
FT                   /translation="MKTEVKNNATTARTSRRGAFTVMLRLVGLVRPLAGYMILAILMGV
FT                   LGNLAATFISIFGAYALLSATGFASSSPMVLLFGGMLLFALVRGLLRYAEQECNHFIAF
FT                   KLLALIRDRVFTALRKLAPAKLEVKNKGNLMSVITSDIELLEVFYAHTISPICIATVFC
FT                   IVMVWFIAGSTNWILGVIALVSYLIVGVVIPFNMSKRSEQDSAEARDLAGKLSTVTLDN
FT                   LRGLDEILQYNTGKQMIEQTSQLANQLSDRQQAVKKAFGVNDAVTSTVILLAGLVMFFS
FT                   SFYLAHTQQILMNEAFIVTIALMSSFGPVVALASLGTTLTSTFAAGNRVLDILDEKPLV
FT                   EDVVDQKDVSYEGVRVSELSFAYDDEQILDNISVDIPTDKIVGIVGKSGSGKSTLLKLL
FT                   MRFWPATPGAIEISGTPLEQINTSNLRDLESYMTQDTHLYHDSIKNNLRIAKLDATDEE
FT                   IIEACKKASIHECISTLPQGYDTPVAELGDSLSGGERQRIGLARAFLHDAPLMLLDEPT
FT                   SNLDSLNEAIILRSLDKETEHKSVVLVSHRASTMGIADVVYTVDGGRVS"
FT   gene            317716..318033
FT                   /locus_tag="Apar_0274"
FT   CDS_pept        317716..318033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF_A0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50705"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B7"
FT                   /inference="similar to AA sequence:KEGG:VF_A0934"
FT                   /protein_id="ACV50705.1"
FT                   /translation="MTPEEIEQKRQKEKDLFSLMIRFYCEKYHHTKAHEHLCEGCAELE
FT                   KYAHMCVQRCPFIETKTFCSKCKSHCYNKEMRARVKEVMKSTGPRLLLHHPILVIKHAL
FT                   Q"
FT   gene            318174..318833
FT                   /locus_tag="Apar_0275"
FT   CDS_pept        318174..318833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_2236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50706"
FT                   /db_xref="GOA:C8W9B8"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50706.1"
FT                   /translation="MIKSKKASFIFKLFIAVIGTFVLCDSAGIFRMNFRVSFLYYFTNI
FT                   SNLLLVAYFWGALFQAYKHPETAQKPWMPTVKHTLMLGITVTGLVAYFLLDHGEVFVNG
FT                   VFKFNNFILHDMIPICGVLDWLLFDEKPTMSFKEPLIWPLYPLTYFVYIIVLVLGFGVQ
FT                   IKEKSRWPYGFMDFDKLGVPAVALTIVILVVVFVALGYLYVFIDKKLGEKIKKAQN"
FT   gene            319011..319232
FT                   /locus_tag="Apar_0276"
FT   CDS_pept        319011..319232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50707"
FT                   /db_xref="GOA:C8W9B9"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9B9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50707.1"
FT                   /translation="MSLYRHLHSRLGSAHKIVLAVCTFVMAIALPAIAKADVVSTPRVG
FT                   RSSVFLVAAAVSILVAVIGAIFIIWRNR"
FT   sig_peptide     319011..319115
FT                   /locus_tag="Apar_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.800 at
FT                   residue 35"
FT   gene            319237..320535
FT                   /locus_tag="Apar_0277"
FT   CDS_pept        319237..320535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_2104 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50708"
FT                   /db_xref="GOA:C8W9C0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50708.1"
FT                   /translation="MSTPQQLFPKKEVSTFAYALCHFVVDFACVSTMLCAVSRVLGESG
FT                   QGSLELATLSILLYDVVAFAFQLPVGIALDKLDKNSFAAMLSYALIGGGVLLSLVPVAL
FT                   LEWPTVLLLAVGNALFHCAGGLCVLNISQKHAGPSGIFIATGAVGVFLGTFSARYGRLQ
FT                   VAFALLVLLFLCAIITQVVQKVNKKYWNIHNTPLAIPELSSRTLLAIVLLCFVVALRSY
FT                   AGMVMAFPWKSEMLLLVLSILGVFSGKALGGMIADRIGFRTTAIFSLIAAATLFIPSWE
FT                   IPFMGLLGVFFFNFSMAITLASLANILSSAKGTAFGLASFSLAIGALPALLGLRLEHPL
FT                   ALFAMSLVSAFALGVGLTLVKDSIVIGPFGHERSVQVLNEAQAEQASQIEQATQESQAT
FT                   QAAHVTPEASIAQTEHIAPDDESTKTLGNEQHD"
FT   gene            320528..320905
FT                   /locus_tag="Apar_0278"
FT   CDS_pept        320528..320905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50709"
FT                   /db_xref="GOA:C8W9C1"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50709.1"
FT                   /translation="MTSWMFFSSYFISTIQTFLFCLILTIFVELVVAYLIGIKNKQALL
FT                   IIVAAQVFTNPIAVFITSACMEWTTDSAQYFACVIVVELVVIAVEGLIYKFKGVSSAPW
FT                   KLSILCNLASVSLGILIQVFI"
FT   gene            complement(320976..321116)
FT                   /locus_tag="Apar_0279"
FT   CDS_pept        complement(320976..321116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50710"
FT                   /db_xref="GOA:C8W9C2"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50710.1"
FT                   /translation="MHTLNTSQAKLTRASRAQKLLHRQATAALRTSIGLMVGALLIAIV
FT                   H"
FT   gene            complement(321130..321966)
FT                   /locus_tag="Apar_0280"
FT   CDS_pept        complement(321130..321966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0280"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: rpb:RPB_3405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50711"
FT                   /db_xref="GOA:C8W9C3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C3"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACV50711.1"
FT                   /translation="MPEVDILQYAFMQRALITGIATAIVCGLLSCWITHMGWSLMGDAI
FT                   SHSILPGVVIAHLLGFPYLVGALVFALITVVLVGQVKKSQIVRADTAIGIVFTTFFALG
FT                   TVLISKVPSQINLSHILFGNLLGVTTPDMLQVLCIGLPIAILLILKNKDLTLLSFDQTQ
FT                   VQAIGLSIKTLTSFLLVALALAIVISLQAVGVILSVSLLIVPGACARLLTNQMKHMLWI
FT                   SPLIATLSILIGITGSYYLDASSGGMIGLTLGVIFCIIFILKSLPRLTFGHILNKN"
FT   gene            complement(321959..322711)
FT                   /locus_tag="Apar_0281"
FT   CDS_pept        complement(321959..322711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0281"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pmr:PMI1026 iron ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50712"
FT                   /db_xref="GOA:C8W9C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50712.1"
FT                   /translation="MNLCVSQLCAWYEKKDREKPIIHDVNFSLSTGDLCALVGVNGAGK
FT                   STLFKALMDTIACEGSITWGNQTLSQARKLGKVSYVPQTEAIDATFPLLVKDVVMQGRY
FT                   VHQGWMRIASAQDKELVAQALERVNLADLMNCPLAQLSGGQRKRVFVARGIAQAAELVF
FT                   LDEPFAGVDARSEAIITEQLNNLSKEGKTLLVSIHDINLAQQKFPLCLVINRTITAQGP
FT                   SKEILSGDALLQNLGISEDTHIEEVLHA"
FT   gene            complement(322719..323759)
FT                   /locus_tag="Apar_0282"
FT   CDS_pept        complement(322719..323759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0282"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   rle:RL3884 iron ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50713"
FT                   /db_xref="GOA:C8W9C5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C5"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACV50713.1"
FT                   /translation="MKHHCTHHSTAANLRPHTNLQPHAHRNPLLTRRSALSLIVASSTI
FT                   AIASLSACGQRNSATNSGSTSNQNSSAPLVLTTFTVIQDMASRVAGEFCQVESITKAGA
FT                   EIHDYEPTPDDLKRAQKAQLILNNGLGLERWFERFVDESPAQRADLSEGITAIPIAEGD
FT                   FQGQANPHAWMSPENGKIYVENIVRALSSLVPDHAKDFEANGNAYKKELDSISSRLIEE
FT                   LSALPENQRTLVTCEGAFSYLCRDTTMKELYLWAVNAADEGTPQQIAKVVEAVKSQQIP
FT                   AVFCESTVNPKAMQQVADETGATLKTDEKNILYVDSLSEAGGPVPTYLDLLQHDADAIV
FT                   SGLMGR"
FT   sig_peptide     complement(323601..323759)
FT                   /locus_tag="Apar_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.292 at
FT                   residue 53"
FT   gene            324104..324856
FT                   /locus_tag="Apar_0283"
FT   CDS_pept        324104..324856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0283"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mno:Mnod_3070 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50714"
FT                   /db_xref="GOA:C8W9C6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV50714.1"
FT                   /translation="MTFDFTGKLVLVTGGSAGIGAEISKGIVAGGGHVIVCSRHEDTGR
FT                   KFVEELGEGNYFYPMDISDAEGVKKTVAQILEERGDVNVLINCAGRISSVPFAEVDDEE
FT                   WNKTINTNLTGTYNVTHALWQHFIKRGGARIVNVSSVAGKIGGGLLGTVAYASSKAGMN
FT                   GFTKAIAKEGGKYGISCNAVCPSFTITDMTTALSNDEEKYKKVVGIIPLGRPAQASEPA
FT                   QMVLFFASDAASFVNGEVGDCDGGIVMD"
FT   gene            324867..325862
FT                   /locus_tag="Apar_0284"
FT   CDS_pept        324867..325862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0284"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="PFAM: 2-keto-3-deoxygluconate permease; KEGG:
FT                   sec:SC0161 2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50715"
FT                   /db_xref="GOA:C8W9C7"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C7"
FT                   /inference="protein motif:PFAM:PF03812"
FT                   /protein_id="ACV50715.1"
FT                   /translation="MATKDPISIQHPFKALGRIPGANILIPLLLGVFMNTFFPEVFPTL
FT                   GSFTAAMTVKGTAALVGAFMLCVGATISFKSAPKAALRGAIIITSKVVFCVALGLAVLF
FT                   FLNDNLLGLSSMVILAACSGANNSMYAGLMADYGNEYEQGAVAITTLVVGPPVTMLALG
FT                   ATGQSPINWSLLGAVLPIILGILLGNFFPSMKKMLTNALPAIIVMTFFAMGTTMKFDSL
FT                   IMAGPAGILLGVICSVCGGFINYFVDRATGGSGIAGVAISSCAGANALTPAAMAEANPA
FT                   LYGGAALATANAQVAAAVIVTAILTPLITGYVAEHFAKKDNTSEEVVEAA"
FT   gene            complement(325982..326791)
FT                   /locus_tag="Apar_0285"
FT   CDS_pept        complement(325982..326791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0285"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bha:BH0989 AraC/XylS family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50716"
FT                   /db_xref="GOA:C8W9C8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACV50716.1"
FT                   /translation="MQANLQELKKTYSRQTYSVFSINRQQKIADSQVTFSLAHSVFIIP
FT                   IFGAAEITIGGEEFICEGTTVVHAPAGQTVSYRTLYGRSFDHVNIYYDGVQDDVTSPIF
FT                   NAYAFDPQGFDRILNKTLDLEKLNTTPSLDNRVAQIVNGTELIKSMFLLTNSQKVQESM
FT                   ADARTYIELHFANPITIPDLAKRCGMSTQRFSNNFVQTFGVRPMTFIIAKRLDHAKQLL
FT                   QSGLSVRETSEAVGYNDPFYFSRLYKKHMGVTPQDVHDRYEGNILIK"
FT   gene            327164..329203
FT                   /locus_tag="Apar_0286"
FT   CDS_pept        327164..329203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0286"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   hhe:HH0112 putative inner membrane protein translocase
FT                   component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50717"
FT                   /db_xref="GOA:C8W9C9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9C9"
FT                   /inference="protein motif:PFAM:PF02096"
FT                   /protein_id="ACV50717.1"
FT                   /translation="MEQLAHVFSLIVQPAYDLTGSWWAAIFLFTFATKIILMPLALWTQ
FT                   QNSIVMVRLMPETFRLKTRYFGDKETIEERSNELNKKAGYHPLLSLIPLAIQVVILFGL
FT                   VDVIHGITDSGAPGTEFLGMTPIIDGGITWIMPLAAALSSVALGLASNKLNPLQREQSR
FT                   AEKNTTNGLSIAMSLVLAVYVVCGMAFYWVCSNLLSILVQIVCNIIIDPRKQVDYEDLN
FT                   AARDEFEAMDAATKSTHKWFQRDPHAAREKEDYKRFFDTIGKHLVFYSESSGFYKYFQG
FT                   AIEWLLANSDICVHYVTSDPNDQVFELAKQQPRLIPYYLGQRRLITLFMKLDADVVVTS
FT                   LGDLESSYMKRSYVRKDAEYMYMCHHMTSMTVTSTRNEYTYYDDVLCVGPHQQHDLELV
FT                   EKYYGTPSKRKPAIGYDLLDRSIQNYQKQNLGQRKPGEKPLLLIGPSWQYDNLMDSCLD
FT                   GILKQLMGRGWRIVVRPHPEYLKRYPARMEEILARYADADPEELSFETDFSSNTSVLSA
FT                   DLLFTDWSSVAEEFSFTTLKPSVFIDTAMKENNPDWSKIHSDPCDITLRNQIGRSFDPK
FT                   DLSGLGDAVAQMLEETDSWSHKIEEIRNNMIFNLGHGGEAAGKFILERVLAHQEEAAEQ
FT                   GDAAGANTTSKKSDAVEADAADKGNVAAIDEVTTTIDEDGVSRD"
FT   gene            329196..331346
FT                   /locus_tag="Apar_0287"
FT   CDS_pept        329196..331346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50718"
FT                   /db_xref="GOA:C8W9D0"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50718.1"
FT                   /translation="MIKATTSTKRNSHSSAAQRRATFLHAVFYLAVLTFAWWALLPATA
FT                   QAYVDPSVMTYTIQALAAVVVALSAVLGVAFRRSRKVLFRMLKIDENADKIVEGAVHKV
FT                   DAKGAQAADAQMRETLAAEAIRIKERKEGTLKPKGRIGVAFTVSFFTVFTILVVAPLEL
FT                   VANSARDLSFNLNDVAGPVIIAGLVLTLILTVFLSLLRKRLFNVAVALVGAVGFAAYIQ
FT                   VVFMNGGMPLADGHEVIWSNFTKKMVISGFVWLVIIAGSAVFSIIRARQFRTGLLVTSV
FT                   ALVIVQAVGVASLWGPSIAASIDANPENYQVVATREGLHSVSSKKNVVVFVLDTTDTAF
FT                   VQRLYDEQPETFAGLTGFTWYRNSAGSMIPTRYGVPSLLFGTRPQPGENFNEFVYNWAQ
FT                   SDQYLRDIQNAGFEAGLYTDQLNYDRYRGTAQKYSVNYHPPVGRGLDNQLDVFGALRIL
FT                   YKTALCRDMPWVFKPRFWYYTEDLNVRMRRQVNMDEVDLSSQPYTEDDLKYYQELQHYG
FT                   LSIDDTGQNGSFRFIHLFGSHPPYTLDRNVERTEDPSKQNVDEQTIASYRIVEAYIAEL
FT                   KRLGVYENTSFIITADHGDWYLTDNDIQTPSNPVIMYKPAGQTAEEAAQPMQISDAPVW
FT                   HYDILAQTLKDMGVDQQTLSNYTTPLDEVHEGDVRPRYYIETLSNGKRDIFVREFVING
FT                   NANDMNDWSLTGNEWRVDPWHD"
FT   sig_peptide     329196..329339
FT                   /locus_tag="Apar_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.899 at
FT                   residue 48"
FT   gene            complement(331500..333137)
FT                   /locus_tag="Apar_0288"
FT   CDS_pept        complement(331500..333137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50719"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50719.1"
FT                   /translation="MAVIKQEYALYLYKLLKNTIGISKQTPLSTVEGILIEDDLAPQDF
FT                   GFDDIRTLMEACPDFIKITAFKKGYIYATLLTFDAFEAALAAGEKNVEAQNNGKPWKRR
FT                   RGAKSIRALKPKRLVAETQTEAEEPEVVVPEVTEVEVSTKEVPQQESNNVAAPEPELEP
FT                   ESTNPKIEESDFVAAPEPELEPATEAPEPIAPEPTISLTVTYNPYDGSDEEKKLEATPS
FT                   VVQKAFNSTAKSSSAVAPEPKNSDQVSIQVETPVTTTAYPSNFEEELHISNELLGILYQ
FT                   MAPVDANVVQQLEEDFELAKASRSLISTGGIFTFNTRYKKPQTDEVITATIRKSRRGAL
FT                   RPWILLELSVSADELHDQAVDAYRGLPKSSIASWEKLPAAEKALPINPIDVVMHEAPIS
FT                   DWHALSTAYLSDAPSLQAAQACLSAAYVYRKNEQQLMHADTDFSLPVSTHTTPLFDSER
FT                   GFDTDSPLVQNALRAAKRGWRIAVELYNPSKHCIYLALPTTDGEKPLALVFDIQAEGPY
FT                   RVVATLTIEEAYPLARIFSDGLPAWIMP"
FT   gene            333282..334685
FT                   /locus_tag="Apar_0289"
FT   CDS_pept        333282..334685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0289"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: ccs:CCNA_02240 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50720"
FT                   /db_xref="GOA:C8W9D2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D2"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACV50720.1"
FT                   /translation="MIGRFIKRAAVRAAGLVITQYAAKAALQSEAGRKLLATTASKAAN
FT                   LAGNIAKEQIAAGFNAHVKPALPSADSIQTSVARAQSALRSAQTSVLAAQAQFQSNLEN
FT                   RFSRSKNKLSKQLSSTAESLEEMGNTLAEHQDAVTDIAVTDAVEEIATQNGQDSEELLA
FT                   PAQKGKTLRNVAIAGGVVAGAALGLAAYGAYSIAPRKQNDRLLLERWHEIARHRYAHRG
FT                   LYNNEAGIPENSLLAFRTACEKGFGSEVDVHLTADNRLVVVHDSALDRLCGVQKIVEES
FT                   TLEELRGLRLLATDEQIPTFEEVLEVYAWSGSGELPAPLIIEAKTCHNNAEQLTEKIMQ
FT                   ALDLRPVRACIESFDPRVLQWLRQNRPEMLRGQLSENFLIDRQTRHMNIATRAGATALF
FT                   GNSVGRPDFIAYKFEDRKNPFVKLACNTMGAHLITWTVRSEEDMIASELEGAPVIFEGF
FT                   IPTSASLIN"
FT   sig_peptide     333282..333356
FT                   /locus_tag="Apar_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.461 at
FT                   residue 25"
FT   gene            334856..336751
FT                   /locus_tag="Apar_0290"
FT   CDS_pept        334856..336751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0290"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: bcu:BCAH820_0652 heavy
FT                   metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50721"
FT                   /db_xref="GOA:C8W9D3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D3"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACV50721.1"
FT                   /translation="MSPKTKVKIVRIVCSAVLLGVAYVVEHVFNLQLWQALLLYLLPYA
FT                   VAGYDVVLEAWESITEGECFNEDLLMTIATLGALFIGFVPNGSPMFDEAVFVMLFFQVG
FT                   EVFEHLASDNSKKSIAKLMDIRPDSATVERDGQLLTVLPEEVELGEIIVVKPGDRVPVD
FT                   AEIVEGSTSLDTVALTGESVPRDATVGDNIISGCVNLSGVVRARVTHLFENSTATRIIK
FT                   LVESSNQNKSKSESFIRRFSRVYTPAVVYSAIALAFLPPLFSGDFVGNASTWIVRALTF
FT                   LIASCPCALVVSVPLTFFGGIGAASKEGILIKGSAYIDTLSTLDTVAFDKTGTLTEGVF
FT                   EVLAVHPQTIGEKDLLHLASHVEMHSTHPIAAALRAAYPSEDDGCVITDIKEIAGQGIC
FT                   ANVNGKSVAVGNCALMESVGASWKACKNHGTIIHVAVDGTYMGHIVISDRERADAPAAI
FT                   VSLKNVGVSKVVMLTGDKRDVAEEIAAQMSITEVRAELLPQDKVSAVEGLLAQKAAGKS
FT                   LAFVGDGINDAPVLARADVGVAMGVLGSDAAIEAADVVLMDDKLSKLSKAVKIARYTLG
FT                   IAKQNIVFAIGIKVAILILAAFGLAPMWLAVFGDTGVMVLAVLNSTRALNIKSIK"
FT   sig_peptide     334856..334936
FT                   /locus_tag="Apar_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.480 at
FT                   residue 27"
FT   gene            complement(336828..337655)
FT                   /locus_tag="Apar_0291"
FT   CDS_pept        complement(336828..337655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0291"
FT                   /product="putative methyltransferase"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   bcy:Bcer98_3362 tRNA (guanine-N(7))- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50722"
FT                   /db_xref="GOA:C8W9D4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D4"
FT                   /inference="protein motif:PFAM:PF02390"
FT                   /protein_id="ACV50722.1"
FT                   /translation="MRALHARLPKNFVLEERLKAYSSVIEPHPESLKGIWASACAPITA
FT                   EGHAFYSEVRVDLGCGKGSFTAAQAKANPDVLFVAIDTEPICISYAAKTIYEAGIPNAI
FT                   VVPGTGMKIDEYFSPEEISVIYLNFPAPFPRIRQAKLRLTDAERLMQYRNVLTKDGVVR
FT                   LKTDSQPLFDFSLEQVEVAGYNFIWKTRDAQADFPNDIPSEYEKKLSAQGAKVHAYLIT
FT                   PGPIPADFTPTKPVSLVDYLPEDLESLTYVPHGMESTVRNLANRARKLRKKSQ"
FT   gene            complement(337692..338309)
FT                   /locus_tag="Apar_0292"
FT   CDS_pept        complement(337692..338309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0292"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: ppd:Ppro_1070 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50723"
FT                   /db_xref="GOA:C8W9D5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D5"
FT                   /inference="protein motif:PRIAM:3.1.3.5"
FT                   /protein_id="ACV50723.1"
FT                   /translation="MSQNSSSQSSFFALISRMRYIERWSLMRNSRSESLAEHALDVAII
FT                   SHCLATIANVRYHRNLDADRAALIGMYHDASEIITGDMPTPVKYANSEIRDAYHQVEAR
FT                   AEKTILSTLPEDLQDAYAQVLTHNAETSEDETYLRKLVKAADKIAALIKCIEEAQSGNS
FT                   EFITAEASTRGVVEDLADSLPEVRDFMTEFLPSYGETLDQLL"
FT   gene            338589..339836
FT                   /locus_tag="Apar_0293"
FT   CDS_pept        338589..339836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0293"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   swi:Swit_0681 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50724"
FT                   /db_xref="GOA:C8W9D6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D6"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACV50724.1"
FT                   /translation="MSKYAFVGGKLVDGTGSAPVEDSLVLIDDDKITYAGPRKEVPEGY
FT                   EVRDASGYTVMPGLVDTHLHFSGNLTDNDNDWVIESVAQKQACAVKQAYDALTHGLTTV
FT                   VEIGRNGIAIRDLVNMGIMQGPRIFATGLGLCRVAGHGDSHHLPLQISKDGHPWGDQVD
FT                   GPWELRKAIRRRLREDPDGIKIWATGGGIWRWDSDRLQLFCTEEIKAIADECALVGIPL
FT                   YAHSYNNFDAAYDCVRFGCKQLIHGFEIDERTMKLMAEQGTFFTPTIGFLPTWYGTYPP
FT                   DWTPELDAFPGETVVEKGLARTYDNLRKAYDMGITITIGSDSFSFVTPYGYVTIDEMYD
FT                   FVEKVGISILDTVAAATYNGAKMLGKENEFGAVKEGLSADILVVKGDVANNIRDLTPEN
FT                   MDVIMKEGKIIDRGSF"
FT   gene            339962..341107
FT                   /locus_tag="Apar_0294"
FT   CDS_pept        339962..341107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0294"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bsu:BSU03360
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50725"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D7"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACV50725.1"
FT                   /translation="MSEPKQVKIVLLTGYLGAGKTTILNHILSNTEGIHAAVIVNDIGE
FT                   INVDAGLIKDGGYAKEGDVIPLTNGCLCCTLSNDLALQLGDLADTEEFDYIIIEASGIC
FT                   EPIPITYNISAFCNQSQHATNHSHLNLDNIVAVVDCARMFEEFHNGADLLDPDIEEDDI
FT                   ENLLIQQIEFCSTLVLNKTDLVTPEQLHELRALVRGLQKDAVIVEAVNGDIPMSELINT
FT                   GRFDFDKAYASAAWMNAMEHPEEHEDPEVLEYEITTFVYRRRQPFDLDKLNQFVASWPK
FT                   NIIRVKGSIWVSQDPEMSYVFEQAGNQVQFYENGMFYASLPEDERENLLDEKPELRAEW
FT                   DDELGDRQTKLCFIGRHMNHEEIEAGLDACLTEYVSDEFDY"
FT   gene            341190..342041
FT                   /locus_tag="Apar_0295"
FT   CDS_pept        341190..342041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0295"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: cvi:CV_0294 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50726"
FT                   /db_xref="GOA:C8W9D8"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D8"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACV50726.1"
FT                   /translation="MTKIEQLKDWIQSSDNIVFFGGAGVSTESGIPDFRGTNGLYRQGG
FT                   IKIENMTIGLGQDGYDMGKETCDLGNGITVDPDNEESFAYSKAPDFTLEEIFSLDVFLD
FT                   YPAAYYTYFRNSHHLGEAQPNIAHKWLAALEAEGKLRAVVTQNIDGLHQAAGSKRVFEL
FT                   HGNETRFYCPECGHVYTLDQIEEQSSVVPLCQCGAVIRPDIVFYGEGLNMDTVYGALNA
FT                   ISQAEVLIVAGSSLVVQPAVGLLDYYEGNKMVIINDQPTPYDGRANLVIRDRIGAVIEH
FT                   LL"
FT   gene            complement(342146..343813)
FT                   /locus_tag="Apar_0296"
FT   CDS_pept        complement(342146..343813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0296"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: DHHA2 domain protein; DRTGG domain protein;
FT                   CBS domain containing protein; KEGG: gbm:Gbem_0612 DRTGG
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50727"
FT                   /db_xref="GOA:C8W9D9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9D9"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACV50727.1"
FT                   /translation="MAEAIRKVNIIGHLNPDTDSICAAISYAYLKNQIDNPIYEARRAG
FT                   SLNRETAFVLNHFGFEEPQLITTVTPQIKDAEIQTQPKVDAEMSLYSAWQLMQNVKLDT
FT                   LCVTDEEEELTGLIAVKDIANANMSLSEPNLLSKAKTSYANIVSTLGGTMVLGDPQGVV
FT                   KQGNIRVGTSASALSEIVDAGDIIVVAGNHENQTIAVEHGASCLIVSCDAPIAQDVIDL
FT                   AKKRDCAIISTPRDTFEVARLLIMSMPVREKMLTDDILKFSVNTAIDDARKAMTNSRHR
FT                   FFPVINENGTFAGLISGPGLLNPRKKHVILVDHNERTQAVDGLEQAEIMEIVDHHRIGS
FT                   IETSNPITFRNVPVGCTCTIIYGLYHEYGIDIPKNIAGLMLSAILSDTLAFRSPTCTER
FT                   DIVAGKKLAEICGEDIDSYSEQMFDAGADLTGRTAEEVFHGDYKVFSRGGVKFGVGQGS
FT                   FMTETSRKAAEELVGPFLETAAKSEELPMVFYMFTDVKSQVTEMLFYGANAANVIERAF
FT                   NVKVDGNIAVLPGVVSRKKQVVPSLMATLQTLAEEAAN"
FT   gene            344065..344811
FT                   /locus_tag="Apar_0297"
FT   CDS_pept        344065..344811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0297"
FT                   /product="MORN repeat-containing protein"
FT                   /note="PFAM: MORN repeat-containing protein; SMART: MORN
FT                   repeat-containing protein; KEGG: sil:SPO0425 MORN
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50728"
FT                   /db_xref="GOA:C8W9E0"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E0"
FT                   /inference="protein motif:PFAM:PF02493"
FT                   /protein_id="ACV50728.1"
FT                   /translation="MSSPTRFSAKKRNARHTNKEADTLEPSSEAREVASVETQQVPTEK
FT                   ADATGSPVVFLQTVSEQLSSAFKLFAQRKPVEDSKSKVVPEKKKSEKTSLSSRKNTRVE
FT                   MHHRVQADPEPEERHSRPVSAGRKKLELISVVAILLLAVLSIVLVNRPSTKTLVFGNNQ
FT                   VTYTGTTIQGKMNGQGKMTFENGDTYEGEFVDGYFQGQGTYTSKDGWTYEGQFVKGQAD
FT                   GQGKLTTQDNIVYEGTFKQGIYQSAN"
FT   gene            344801..346612
FT                   /locus_tag="Apar_0298"
FT   CDS_pept        344801..346612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0298"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bsu:BSU27140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50729"
FT                   /db_xref="GOA:C8W9E1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACV50729.1"
FT                   /translation="MRIKWFSLVRITGLVLVLIYHFFKEALPGGFIGVDVFFTFSGYLI
FT                   TALLIDEFARFRSIDVIGFLRRRFYRIVPPLVFMVLVCTPFLLLVRAEFIAGIKYQIAA
FT                   ALGFVTNYFEIVLGNSYENQFAPHVYLHTWSLAVEMHFYVLWGLCAWLLACLSKTIRSY
FT                   KVKIAGASLVLLVVTYLAMATSAPSSTNLSIQYFSTQTHVFPFFIGALLSCVAGIAQTG
FT                   ALFDQLEQKLSTQLTLVGLVVSLGVLVCLSVFMHFDNLFTYTFGFLFASLASAAMIFFA
FT                   RMLHQKTDGIKEPGIVSFVADTSYSVYLFHWPLYIIFAEKVNPVLAALLTLLLSFVFAS
FT                   CSFYVIEPALAGKSPEFFSHIKLDGHKILRVTGLALIPFAAAVAFIALTAPQLSDFQND
FT                   LLLNASLQEQSTMTMTRKHADTSQASNYNVVEGVTYIGDSVSLRARSYLQDALPDAQID
FT                   ASVSRNVAMGVDLLQSAINNNTLYQNVVVALGTNPVGGTDAVDKIVEMLPRGHRLIFVT
FT                   PYDGRNTDPNAGANAIRAHELELAQKYDFITIADWAQVAQDNPDIWAGTDYVHFGSDSD
FT                   SINRGGTLYAQMVKDAVEKANQGHVKP"
FT   gene            complement(346846..347112)
FT                   /locus_tag="Apar_0299"
FT   CDS_pept        complement(346846..347112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50730"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50730.1"
FT                   /translation="MDVVFGAPTVANSTRGLFAERESMFTERQSAFVARENTPMSDNLS
FT                   KRRIHYAKNPNTMQIIGLRCVFCLVYCRISDIDVNLEAEISNS"
FT   gene            347220..348899
FT                   /locus_tag="Apar_0300"
FT   CDS_pept        347220..348899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0300"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aeh:Mlg_2098 putative ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50731"
FT                   /db_xref="GOA:C8W9E3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50731.1"
FT                   /translation="MAEFVYQMYKARKAVGEKVILDDVTVGVYPGAKIGVVGPNGMGKS
FT                   TLLKVIAGLEDVSNGEAKLTPGYTVGLLQQEPPLDETKTVKENIELAFGDLLSKIARFN
FT                   EIGVEMGNPDADFDALMAEMGQLQTEIDAANGWDLDSQLSQAMDALQCPDPDSPVTHLS
FT                   GGEKRRVALCRLLLEAPDLLLLDEPTNHLDAESVLWLEKFLHDYPGAVMAVTHDRYFLD
FT                   DVAEWICEVDRGQLYPYEGNYSTYLENKAARLEAQNQQDAKRAKKMRAELEWVRSSPKA
FT                   RQAKNRARLDRYEQMEAEARASKKLDFTEIQIPVGPRLGQKILEASHIHKAFGDRVLID
FT                   DLSFSLPRNGIVGVIGPNGVGKSTLFKAIVGQEELTSGTLEIGETVQISYVDQLRQGID
FT                   PEKTIWEVVSDGNDFIKVGDTEIPSRAYVASFGFKGPDQQKRAGVLSGGERNRLNLALT
FT                   LKQGGNLLLLDEPTNDLDIETLESLEDALERFPGCSVVTSHDRWFLDRIATHILAWEGD
FT                   DENPGKWFWFEGNFEAYQANRIERLGQEAARPHRIHRKLTRD"
FT   gene            349067..349582
FT                   /locus_tag="Apar_0301"
FT   CDS_pept        349067..349582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0301"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   gbm:Gbem_2519 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50732"
FT                   /db_xref="GOA:C8W9E4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E4"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACV50732.1"
FT                   /translation="MALDANVGNILNQQINKEFYSAYLYLTFADFYEEQGLKGFANWYV
FT                   IQSQEELAHARILRRYLLDNDWTPTMEAIAKPDLTFTKVIEPIKAAYEHEQFITASINE
FT                   CYVVAQKANDFRTMQLLDWYVKEQGEEEANASDLLKAVELFGGDPKNLYDLDLENAARV
FT                   YVAPTMPM"
FT   gene            complement(349598..350503)
FT                   /locus_tag="Apar_0302"
FT   CDS_pept        complement(349598..350503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0302"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bcy:Bcer98_0850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50733"
FT                   /db_xref="GOA:C8W9E5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV50733.1"
FT                   /translation="MKDATFKPTVLYLIALIICGSNGIVASLINLPSYQIVFFRMLLGT
FT                   LFLLTVKFVQKEAFTIQKYPKDFQALIGSGIALGLQWTFLFEAYQLVGVGIATLEYYCG
FT                   PVIVMALTPFLFGEKFTTKKILGFLVVVIGAALIIGYGVGLNLSPTGLLLGALSAVLYA
FT                   IMVICNRQLKNVSGIEGTSIQLGIGCAVVALVTIVFHSIELPADPASVNWLAVLTIGLF
FT                   NTGLGSFLYFPQLTKIPVQRVAVFGYLEPLSAVIFSALILGEPFGLLKIIGTACIIGGA
FT                   IFAELSGASSNKSEAIETPL"
FT   gene            complement(350507..351529)
FT                   /locus_tag="Apar_0303"
FT   CDS_pept        complement(350507..351529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0303"
FT                   /product="L-asparaginase, type I"
FT                   /note="TIGRFAM: L-asparaginase, type I; PFAM:
FT                   Asparaginase/glutaminase; KEGG: bsu:BSU23580
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50734"
FT                   /db_xref="GOA:C8W9E6"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E6"
FT                   /inference="protein motif:TFAM:TIGR00519"
FT                   /protein_id="ACV50734.1"
FT                   /translation="MKKLLLMATGGTIASVSTESGLAPSLSGEELLANVPLVHDLCKFD
FT                   FQQVMNIDSTNMRPQNWLQIRDAIIESYDTYDGFIILHGTDTMAYTAAALSYLIQNSEK
FT                   PIVLTGSQQPMANPFTDAKLNLYHSVLYALDNKSAGVVVVFGNEVIAGTRAHKQRTLSF
FT                   NAFTSMNYPPLAHIRGNKIIRSAPNNEQVEGGLVTYKTLNTRVIVLKLTPELNPSIFYL
FT                   LKNDYDAIVLETFGIGGIPSYDGSYEEAITDWIASGRTVVITTQVPEEGLDLGVYEVGR
FT                   TYQDMPGVLSGDDMTTEALVAKTMWILGQTSDQREQEKLFYQVICNDRIPQPVDTKICE
FT                   "
FT   sig_peptide     complement(351467..351529)
FT                   /locus_tag="Apar_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.388 at
FT                   residue 21"
FT   gene            351680..352153
FT                   /locus_tag="Apar_0304"
FT   CDS_pept        351680..352153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50735"
FT                   /db_xref="GOA:C8W9E7"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50735.1"
FT                   /translation="MAEKNLFGFGKKKRPAQVPPTVSREEESSTSPREVRGRHAAVGDR
FT                   AQAQRRMKQDRPTNPVNHARADAARARGRARTAYGNHYGTLNPRDEVQAAYAARRRRSS
FT                   RMRLGRVVLAVFLAAIILWVVFTLVSSCSPGGAFAHAQALDPTVTLTGSVKVG"
FT   gene            complement(352235..353197)
FT                   /locus_tag="Apar_0305"
FT   CDS_pept        complement(352235..353197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0305"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="PFAM: glycoside hydrolase family 25; KEGG:
FT                   mlo:mlr7748 lysozyme precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50736"
FT                   /db_xref="GOA:C8W9E8"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E8"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ACV50736.1"
FT                   /translation="MIFNSSHKSKKTRNSTTRSKTKHTPVSANAFKRKQQAMHTLGKNS
FT                   KNNPIVTWGLVMLAIVFVLALLQSCQGLFSLSFNNNWIVKNEVPYEWENLSYDATGRAH
FT                   YIVDGEELTRTGVDVSSHQGSIDWESVAADNIQFAMLRIGYRGSTEGGIRADELFETNL
FT                   KSAQNAGLDVGVYFFSQAINVDEAREEAAFVLQQLKEAGVTKLNLPVAFDLEPSPDYSG
FT                   RADNLSPAETNAIARAFCATIQEAGYRVIVYGNKVDLDRFDLVSLDEPIWLAQYVDQPD
FT                   VNFNFLIWQYTSTGQVNGITGSVDLNLDFSNVSTRKNQK"
FT   gene            complement(353194..354675)
FT                   /locus_tag="Apar_0306"
FT   CDS_pept        complement(353194..354675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0306"
FT                   /product="Domain of unknown function DUF1846"
FT                   /note="PFAM: Domain of unknown function DUF1846; KEGG:
FT                   ATP-dependent Zn protease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50737"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9E9"
FT                   /inference="protein motif:PFAM:PF08903"
FT                   /protein_id="ACV50737.1"
FT                   /translation="MRIGFDNEKYITMQADRIHQRINEFGGKLYLEFGGKLLDDNHASR
FT                   ILPGFAPDAKAQMLQQLAHEAEVVFAINANDIENGKRRSDIGVTYADDVLRLMDIFRAR
FT                   GLAIGGVVITQYSGQPKAKAYRARLENMGIAVYRHYPIEGYPSNIDLIVSAEGYGKNEY
FT                   VKTTHPLVVVTAPGPGSGKLAVCLSQLYNENVRGIRSGYAKFETFPVWNLPLKHPVNVA
FT                   YEAATADLGDNNIIDPYHLEAHGEVTVNYNRDVEAFPVLKAMMEKIAGTSPYQSPTDMG
FT                   VNMVGNCIVDDEVCQEASKAEIVRRWFRAAEKLERTGMGERELTKINLLMKDVNVDQNF
FT                   SPAHAACLHKAEETGKLAGAMVMPDGSIITGKTSELLGAPASLLLNALKYVVGIEKKTF
FT                   IVSNEVLRPICALKENNFKLAHTSLYADEMLIALSISSITNPLAGKAVDATQLLLGCDA
FT                   YFSSIIPIDDESIYHKLGINVCCEPIFEQGHFFHQ"
FT   gene            354780..355229
FT                   /locus_tag="Apar_0307"
FT   CDS_pept        354780..355229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50738"
FT                   /db_xref="GOA:C8W9F0"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50738.1"
FT                   /translation="MDSKFSQTPFRGEKFKELALSALRAFGYGCLAAAGMSAVIFAFAY
FT                   FTSGMDMFTGIDWVRRVMYVISSLGIIACGVGLLFSGKEYEDRQIGFTRDIDDPISLKE
FT                   GKLDPRISNIETNHLSWQAAILYASIGMFVVTTIFDEVMSHIFLM"
FT   gene            complement(355311..355751)
FT                   /locus_tag="Apar_0308"
FT   CDS_pept        complement(355311..355751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0308"
FT                   /product="protein of unknown function UPF0099"
FT                   /note="PFAM: protein of unknown function UPF0099; KEGG:
FT                   CG1307; K04794 peptidyl-tRNA hydrolase, PTH2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50739"
FT                   /db_xref="GOA:C8W9F1"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F1"
FT                   /inference="protein motif:PFAM:PF01981"
FT                   /protein_id="ACV50739.1"
FT                   /translation="MPSSSYKSKQMIVIRRDLKMRKGKIAAQASHACVEATLMALAKEH
FT                   RLNQVRVADDQNWVYLDHADEDTSAITNWFDAGVAKVCVYVDSEEELLELAAEGKARGF
FT                   VVALIRDAGFTEFHGEPTFTCLAFEPLAAEDIDPLTGELPLY"
FT   gene            355970..356458
FT                   /locus_tag="Apar_0309"
FT   CDS_pept        355970..356458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0309"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   sal:Sala_1131 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50740"
FT                   /db_xref="GOA:C8W9F2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F2"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ACV50740.1"
FT                   /translation="MKEFVILVMYICASISDMRDRTIPNRIPIMLVFLWPIWLAVNKNR
FT                   AEMIMSSLWSELFVICVLILVSIVTKFIGHMSSIGGGDIKLILSTCLYLEIKETFVFLF
FT                   LANILGVMFSFLFTIWSNFSKRRHKNSQENTSSNNILMYTFPFAPFLTIGVALALFLR"
FT   gene            357127..357546
FT                   /locus_tag="Apar_0310"
FT   CDS_pept        357127..357546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0310"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50741"
FT                   /db_xref="GOA:C8W9F3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV50741.1"
FT                   /translation="MAKAGVTKKTDPGLGRTVARLLQESGKRQVDLCEFSHWSRAYVSY
FT                   ICTERRKWPSFDKAKVIADFFSLSLDQLWVEHLKDLVDAGVELSESQKKNLAEGINLPN
FT                   PTVMHDGNNNREYLQPVAPSGNGSDYTLPEILGIE"
FT   gene            357656..357904
FT                   /locus_tag="Apar_0311"
FT   CDS_pept        357656..357904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50742"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50742.1"
FT                   /translation="MAGLHCSDCAFSSFKFNEDAQMYQAYCSRGYLLADPHIHELFAMH
FT                   FAKSPEDFVPVKDPFNREYLRKSYICGEFIKRKDDLG"
FT   gene            358149..358769
FT                   /locus_tag="Apar_0312"
FT   CDS_pept        358149..358769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0312"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bmj:BMULJ_02573
FT                   acrAB operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50743"
FT                   /db_xref="GOA:C8W9F5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV50743.1"
FT                   /translation="MSRRPQTESCDTRYRLLKSAEQEFALQGYDKASLRQICAHAGVTT
FT                   GALYFFFDNKEDLFKNVLIPITEGAVRILEDYKNHLLVSGERNLEDTPLGDKETLDKFL
FT                   DLLYGNRYVVRILVNNRENQHVVRFFEELTEVISSTIRAILYPNVAQVKPYDEFIITWL
FT                   AQTEMTTIVNILKNDETREEADGHINSAVMFTQGGIKALVDEH"
FT   gene            358856..359464
FT                   /locus_tag="Apar_0313"
FT   CDS_pept        358856..359464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50744"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50744.1"
FT                   /translation="MKFNKLGLVAVSASVVFALAGCSNLIPNLSDTGTTTGDQQQQQQT
FT                   KPDANTATKPSDSRAGDSDSKDLYNSLMDKHNTDEMIANVQKYVDDVKKTDDKTEVLID
FT                   TDKITVTVTGIGVDYENSNGYLVEVVNKTDSNIFIQAHDTTIGKNELSMFINAAPNTTT
FT                   KGFAFFDPGVKLDSSTTLRGTIYALYGSDYSMDSFDVMY"
FT   sig_peptide     358856..358918
FT                   /locus_tag="Apar_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.611 at
FT                   residue 21"
FT   gene            359642..360652
FT                   /locus_tag="Apar_0314"
FT   CDS_pept        359642..360652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0314"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="KEGG: bsu:BSU35790 mannose-6-phosphate isomerase;
FT                   TIGRFAM: mannose-6-phosphate isomerase, class I; PFAM:
FT                   mannose-6-phosphate isomerase type I"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50745"
FT                   /db_xref="GOA:C8W9F7"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F7"
FT                   /inference="protein motif:TFAM:TIGR00218"
FT                   /protein_id="ACV50745.1"
FT                   /translation="MLDLDKNTDSLYNDLIFLKPLFHNKIWGGRRLAEEYGYDIPEGSV
FT                   GECWAISAHPNGDCEVASGAYAGKTLSKLWETHRELFGNAEGDRFPLLIKILDAKDDLS
FT                   VQVHPDDEYAAEHENGSLGKSECWYILEAKQNGDIVVGQNASSKEEFAELVKQGKWSQL
FT                   LNYVPIKPGDFFRIDPGTVHAIRTGTLILETQQSSDITYRVYDYDRLGDDGKPRDLHLA
FT                   QSLEVIDYAQEAPTSGAITAPEIDGKTELMSCKYFSVEKYEIQKIKTIAQPWPFMCVSV
FT                   IEGEGTVCADGGKGCEHKLYKGSHFIAPALSGDLHFVGTMTLIVSHLPQPRSTAL"
FT   gene            360740..361909
FT                   /locus_tag="Apar_0315"
FT   CDS_pept        360740..361909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_2848 hemagglutinin/hemolysin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50746"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50746.1"
FT                   /translation="MNKEIMSRRAFAGLAAGGVASTLAACNNDVIQAFLNPDSVLGGTD
FT                   QANPQNGDQGGDTSKSNLTKLEEIPDNPTLTGDLTKIITGVWCVDYGVGIKGGKMDGKT
FT                   FDHSGMLNQGYNDGTVLNYSFKADGTFYMHNFKGVKTDGKWTVKGDNTIQCDYKDDSAS
FT                   MIFDKDDNNYLKFSDTNSEITFTCKKLSDNPDDTSQIAYLDGKVVNFAATVPGTYYLFG
FT                   LHYADGSKDDLTSDQIESMNKGSGAGYTFSAHKDGNAALFYPDGSVIPIQIVAEQPSSD
FT                   GLSFPILAMGISATEELSKSILYTTEDNKKLVCIDVPKYTLKFARLNHREDDWSKYEYA
FT                   PKAQFPWQPDGKGGFKLVTPTSGSGDGSSGNGDSSSGNGDSGNGGSGKK"
FT   sig_peptide     360740..360817
FT                   /locus_tag="Apar_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.809 at
FT                   residue 26"
FT   gene            complement(362032..362481)
FT                   /locus_tag="Apar_0316"
FT   CDS_pept        complement(362032..362481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0316"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: ppd:Ppro_1689 large conductance mechanosensitive
FT                   channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50747"
FT                   /db_xref="GOA:C8W9F9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9F9"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACV50747.1"
FT                   /translation="MKKFLEEFKEFIQQGNVMDMAIGIIIGGAFTAIVTSLVNDIINPF
FT                   IKLISGGGTEVSGLSIPVPGTQNGIDFGAFISAIINFLIIAFIVFCMVKALNKFMKASK
FT                   LEKDKEEAVEEVAAPHCPHCLEEVKEGATRCPHCTGEIEGGAHAA"
FT   gene            complement(362543..364099)
FT                   /locus_tag="Apar_0317"
FT   CDS_pept        complement(362543..364099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0317"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: bsu:BSU22080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50748"
FT                   /db_xref="GOA:C8W9G0"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G0"
FT                   /inference="protein motif:PRIAM:3.4.17.19"
FT                   /protein_id="ACV50748.1"
FT                   /translation="MDSANNTVELNAALSNPRDDIAKLDELEKKLFALNYAANEIGSFG
FT                   PCIDPKKAAEERGEALAILGEQIQETLCDPAVGALLDRLHGNRALLDETHRAQVKILRR
FT                   DRSQLVDVPVELQSNFVRLTTEANEVWEQAKNNDDWSLFEPKLDSLIELRKEMCQARDA
FT                   SKDPYDLLLSDFEHDTNREFYNTFFNNVKEVVVPLVADCMASKRQPSTKPLEGKFDVNR
FT                   QWDLAKDLVKLQGLDEDAYWLGKTEHPYTGGPGIGFVMVASHAYENNVLSNVYSMLHEN
FT                   GHALYEQGINWEYRFTSLSTGTSMGMHESQSRFFENYVGLSEAFAEPLIQLMRKHFPGQ
FT                   LNRVTAFQLFSAANKVQPSLIRTEADELTYPLHILIRYEMEQALLSGEITAKDVPTLWA
FT                   EKYKQYLGVTVSNNTEGALQDVHWSWGEFGYFPTYALGSAYGAQYKHAMIAEGMDFDAV
FT                   CASGDLTPIREWLGSRIWTWGRAKDSKELILDACGEPFDVHYYTEYLTDKYSRIYGLTS
FT                   A"
FT   gene            364294..365592
FT                   /locus_tag="Apar_0318"
FT   CDS_pept        364294..365592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0318"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mxa:MXAN_0212 aminotransferase, class I and II family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50749"
FT                   /db_xref="GOA:C8W9G1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV50749.1"
FT                   /translation="MDDSRISFDQWGDLYADRVQTMRKSEVRDLFAALSRPGVIALSGG
FT                   LPDISSLPLDQVAECARRCVAVEGLRSLQYGNSDGRIECRKTICKILAVQGIEADPDEM
FT                   ILTSGSQQALDFLGRVFLNPGDDIICEGPSYLGAFQAFSAYEPSVHTIDMDEEGIRTDL
FT                   LEAKLKELASQGRKPKFIYVIPNFNNPAGITMSMPRRLRLLELAHQYNIPVVEDDPYGL
FT                   IRFEGEDLIRLKSLDSNVIYLGTTSKIFAPGLRLAWMVAPRHFLERINLAKSGSDLCTS
FT                   PFNMILAEHYFNEVDWQAALEVSKSRYKERKDAMLAALEEFFPQDVTWTKPEGGLFLWV
FT                   TFPPYLNTEQLLPRAIEEGVAFVPGVYCYPDQRISSSMRLCYSFETPERIREAIRRLSL
FT                   CVQDRMALYRAFLEAGALPESSRSESYSSAREC"
FT   gene            365595..366596
FT                   /locus_tag="Apar_0319"
FT   CDS_pept        365595..366596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0319"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="PFAM: D-alanine--D-alanine ligase domain protein;
FT                   KEGG: abo:ABO_0600 D-alanine-D-alanine ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50750"
FT                   /db_xref="GOA:C8W9G2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G2"
FT                   /inference="protein motif:PRIAM:6.3.2.4"
FT                   /protein_id="ACV50750.1"
FT                   /translation="MATKVAVIMGGASFERNFSLKSGALVSEALEKCGYEVLPLDADAH
FT                   LVDTLRAEKPDVAFVCLHGAGGEDGAVPALLEFLKIPYVGSRPASCRAAWNKADMPFIV
FT                   RQAWSKEESEVIWPPQIVLTASAFKDLGAAAALDMVPERLGGGVGFPLAVKPVHGGSAM
FT                   GLSKVDSADQLGKALLGALGFDDSVIIQQWVDGVEVSVTVLSDADGEKTLPPVEISVIK
FT                   GIYDTDARLDPERIEHFCPVRSESLAALGADPVAAREALERAALEVFTAYGCRDLARID
FT                   FIWDGHHVMVMGLKTFPGLTETSLVPMAIEAAGYAVEDVLAQLVEGALKRGN"
FT   gene            366605..367573
FT                   /locus_tag="Apar_0320"
FT   CDS_pept        366605..367573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0320"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bcr:BCAH187_A4396
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50751"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G3"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACV50751.1"
FT                   /translation="MEYVLGIDVGGTTIKLGLFSTEGELLSEQKVKTPALDNEDGYQTV
FT                   TDAIRLIVHGQKASRNDVIACGLDIPGPVADDGTVGFLANVDIDPEGLVQAINMCLPNA
FT                   TIAFVNDANAAALGEAWAGVAVGVPSFVLIALGTGVGAGVVVDGKLAAGAFGAGGEIGH
FT                   IIVEPEETLTCGCGRHGCLEQYASAKGVVRLYLEECAARGVVPVNIEHETDTVSVFRAH
FT                   AQGDECATLAIHKMCHYLGLAMAQVSCVVDPAMFLIGGGVAGSFATFALELRETFEQYA
FT                   LPVSKGARIEAASLGNQAAMYGCAYEALRLRKERFGQEEAE"
FT   gene            367770..369275
FT                   /locus_tag="Apar_0321"
FT   CDS_pept        367770..369275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0321"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system PTS fructose- specific IIB
FT                   subunit; phosphotransferase system EIIC; KEGG: stm:STM3255
FT                   putative phosphotransferase system fructose-specific
FT                   component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50752"
FT                   /db_xref="GOA:C8W9G4"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G4"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACV50752.1"
FT                   /translation="MADESKYDIVAATGCPTGIAHTFMAKEALEKAAAAKGLTIKVETH
FT                   GQVGVENELTAAEIRNAKAVVVAADKDVQAERFAGKPMVNVGVTAAIKDAEGLIDRALV
FT                   AQPEGELAEADDAPVSSTIEKESVGHTIYKHLMNGVSHMLVFVVAGGVLTAVSFLWGIT
FT                   SFSSTEADYNSFAAMLKIIGGIAMGLMVPVLSAYIAESIGKRPALVPGFVAGMIAIQGL
FT                   PINPNTGMIDAVGAGVGFGFLGGIVGGFLAGYVIVGLEKLLSGLPKNLDGLKAIFLYPL
FT                   LSTTIVGLVMLGISGPMAAINTGMMNFLRGLSASGPIVLGLAIGCMCAFDMGGPVNKAA
FT                   YVTGTALLTEALNAGIGTPTYEFGTNFMAAVSAACIVPPLITTFAVVVGKKYFTKPDFN
FT                   AGLVNFILGCTHITEGAIPFMTKNIWPVMPIMMIGSSIGSILTLLFGVHDPAPHGGFLV
FT                   LPVVDGGLKWVLAILIGAVVGGILFVAFKAYEYRKNGDKIVED"
FT   gene            369447..370364
FT                   /locus_tag="Apar_0322"
FT   CDS_pept        369447..370364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0322"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="KEGG: sek:SSPA2915 possible carbohydrate kinase;
FT                   TIGRFAM: 1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50753"
FT                   /db_xref="GOA:C8W9G5"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G5"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACV50753.1"
FT                   /translation="MIYTLTTNPAIDMNVNSGVPSYTHVNRTTDAVYTPNGKGLNVSFT
FT                   LAHYGVKSTILGFFGGFSGNYIVEEASKMCPVKPVWIDGITRVNIFVTTPEGELKFPNA
FT                   GAPVVRSKQEEMLELLCNAPNLDVLVVSGSLSLEMDQTFYDELFDLCHERGAELVLDIS
FT                   HKHLAELVEKKPLLIKPNDEEVAEIFGVNVHNEADVLLALHKIHERGAKNILLTLGGEG
FT                   AYFFNGKHVWRANASQVEVLSTACAGDSTLASFMSIWLDDPSDVEKALTRAMATGGNVA
FT                   MSAGLGDFALVEKIAESIHVELVE"
FT   gene            370591..371388
FT                   /locus_tag="Apar_0323"
FT   CDS_pept        370591..371388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0323"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   jan:Jann_3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50754"
FT                   /db_xref="GOA:C8W9G6"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G6"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ACV50754.1"
FT                   /translation="MSGHSKWATTKHKKAAIDAKRSSLFSKLSRNITVAAKMGGDPNPD
FT                   NNASLSAAVARARMVSMPNAKIQAAIDKAFGAGADAAVYEEIVYEGYGPAGVAVYVDCL
FT                   TDNKNRTAADVRSAFTHSGGNLGTAGSVAFQFERKGSIAVDKVIVSEDKKVADRENAVD
FT                   EDEFMMAVAEAGGNDYEDAGDQWIVWTAYDKMQDVQKGLEAQGIEVKGSELTMVPTTPT
FT                   DVSVSDAKKVQRLIDKLDELDDVQNVYSTMNITDEIAAALEEE"
FT   gene            complement(371955..372719)
FT                   /locus_tag="Apar_0324"
FT   CDS_pept        complement(371955..372719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0324"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   hap:HAPS_0195 transcriptional repressor AgaR/DNA-binding
FT                   transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50755"
FT                   /db_xref="GOA:C8W9G7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G7"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACV50755.1"
FT                   /translation="MATSRSFVTSRRSSIMSLLEQYRQVSVSDLADRFEVSSLTIRRDL
FT                   DELEAQGLISRSYGMATLLDPLSTGLSSNQVTAKFKLAQAAAKLIKDGDTVFINTSSTA
FT                   IKVLEFITAENITIVTNNGSVLAADYPPSMTVLVTGGEVRPAKKSMTGDFALASINQIR
FT                   AAKCILGCSGISAERGLTTLVSNEMRVNSLMLKHSEQHIVLADSSKLGVNSSFQYGSPS
FT                   DIDVLMTDDSASISQVTALEAAGVRKVVRVSL"
FT   gene            373372..373830
FT                   /locus_tag="Apar_0325"
FT   CDS_pept        373372..373830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0325"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: pin:Ping_2057
FT                   putative PTS IIA-like nitrogen- regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50756"
FT                   /db_xref="GOA:C8W9G8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G8"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACV50756.1"
FT                   /translation="MLLRDIYEQNHYAFVKTPMTWEESIRECCKPLEADGTVNPEYADD
FT                   IIECIKKYGPYIVIVPNVAMPHSTARIGSNGKTAIGFMHSDVPVNFEDGDEEKQVKTFF
FT                   TLSATDQEAHLKNMQMLVQVLMNQEVLERLKNIQSPEELLEIDKLISE"
FT   gene            373933..375444
FT                   /locus_tag="Apar_0326"
FT   CDS_pept        373933..375444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0326"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: apa:APP7_1761 predicted ascorbate-specific permease
FT                   IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50757"
FT                   /db_xref="GOA:C8W9G9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9G9"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACV50757.1"
FT                   /translation="MDIVLGIWKWFASNFLTQPAYFIGLIVAIGYILLKKKWYDVLAGF
FT                   LKAVIGYQILLVGSGGLVTAFRPVLVGLEARFNLSAMVIDPYFGQNAVQAGMEAADAPA
FT                   FIAGRSFSSVMLLLLFAFILNIVLVAFKKQTKLRAIFTTGHVQVQQAATAFWLILFCFP
FT                   QLNDVAILAVMTILLGLYWAVGSNLCIGPTQDLTDGAGLTIAHQQMFGVYCASKASEWL
FT                   AKHSKKESKRIEDIELPGFLKIFNENLVATAILMTAFFGVILAVLGQDFLLENKFMKPG
FT                   QDFFFYIMTTSFQFAVYLSILQLGVRTFVTELTNSFQGISNKLLKGSVPGVDCAVTYGF
FT                   GSPNAVTLGFLMGAAGQFLAIAALLLLKSPVVVIAGFVPLFFDNATIGVYANNKGGLRA
FT                   VLIMPFISGLLQVFGSALIAGWVGMAAYGGYLGMWDWAVVWPIMTGVMKFLSYAGLAIV
FT                   VIALIAIPQLQYRANKDTYFMEVEDYQKCKEIRAQKAAAASAESK"
FT   gene            375610..375918
FT                   /locus_tag="Apar_0327"
FT   CDS_pept        375610..375918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0327"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: vsa:VSAL_II0823 PTS system,
FT                   lactose/cellobiose specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50758"
FT                   /db_xref="GOA:C8W9H0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H0"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACV50758.1"
FT                   /translation="MNAKILVACANGAGTSLMMKMTAERVTQKLNMGVDKIHHCALSEG
FT                   VSSARQYDIVFAPLNFLNMYDDAAKAGVTVIGLRNVLSDAEMEEKLKETGAAEKFSA"
FT   gene            375948..377003
FT                   /locus_tag="Apar_0328"
FT   CDS_pept        375948..377003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0328"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50759"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H1"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ACV50759.1"
FT                   /translation="MTFEKKILAEMPKCYALGMFEGEDTPSFLAAVEKDGPIRRFTLDG
FT                   EPLETVVPGPGGVMTITQVPGRKDQFLATRKFFSPNFGGDDAAIASYTKQADGSWSEQI
FT                   LCDLPYVHRFGILKAADGQLWVLACSIKGGAETGVKDDWRTPGAVWAAPLSDNLEQYTV
FT                   DNQLKLTCVANYQVQNHGFWTAPDKSYALISTAAGVFRYVPPTTPEGSWDVTCLLVQPT
FT                   SDIVATDFDGDGKLEILTFSKFHGDTLAIWHEGQTRDRYEQVWCDPQKRSFLHALWAAD
FT                   LNGEKCAVIGNRKDGRDLLLVRYVDGQYTVDVIDHDLGPANCMVYKHDGSNYIVAAYRE
FT                   TDQLALYKVVE"
FT   gene            377127..378245
FT                   /locus_tag="Apar_0329"
FT   CDS_pept        377127..378245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0329"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="KEGG: efe:EFER_4245 putative L-ascorbate 6-
FT                   phosphate lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50760"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H2"
FT                   /inference="similar to AA sequence:KEGG:EFER_4245"
FT                   /protein_id="ACV50760.1"
FT                   /translation="MADLKDVTRDSWIMSTFPEWGTWLNEEIDNAVVEPGQVEMWWLGC
FT                   VGIWFKTPGGANVAVDFWAGNGKRTHGDGLMKPGHQMANMAGVRKMQPNLRNVPFVIDP
FT                   FAIKNLDAVVVTHIHQDHMSKELAAHVVNNNMTTTDENGKEIPVPFIGPKDAVDIWVGW
FT                   GVPREQCIVVKPGDRVKIKDMEIVAYDSFDRTIIVTTTDTSENRPDLWGKCPMDMDEKA
FT                   VNYLFVTPGGNIYHSGDSHYSIYFAKHGKDIAKEFGGVDVCFGAYGCNPIGIQDKMEAT
FT                   DMLRMAEALQSKVVIPIHHDVWTNFQADVQEIKVLWDMRKDRLDYKFHPFFWEVGGHYT
FT                   YPQDKDRFAYHHDRGFHDCFDHEPNVPFRSVL"
FT   gene            378258..378959
FT                   /locus_tag="Apar_0330"
FT   CDS_pept        378258..378959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0330"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: sfv:SFV_4354 L-ribulose-5-phosphate 4- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50761"
FT                   /db_xref="GOA:C8W9H3"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H3"
FT                   /inference="protein motif:PRIAM:5.1.3.4"
FT                   /protein_id="ACV50761.1"
FT                   /translation="MMLKELRDEVYEANMDLPKHGLVVFTWGNASGLDRERGLFVIKPS
FT                   GVSYEELSPENLVVCDLDGNVVEGELNPSSDTPTHACLYRAWGDKIGGIVHTHSTHAVS
FT                   WAQAGRSIPCYGTTHADYFYGDIPCVRSLTKGEVESAYELETGNVIVEGFANLDPIAVP
FT                   GTLLHNHGPFSWGKDAMAAVYHAVVIEEVAKMATLTELNNPKVQEAPQYLQDKHYMRKH
FT                   GPNAYYGQGNH"
FT   gene            379035..379883
FT                   /locus_tag="Apar_0331"
FT   CDS_pept        379035..379883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0331"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="KEGG: hdu:HD1864 putative L-xylulose 5-phosphate 3-
FT                   epimerase; TIGRFAM: hexulose-6-phosphate isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50762"
FT                   /db_xref="GOA:C8W9H4"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H4"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ACV50762.1"
FT                   /translation="MSKYQLGLYEKATPTDLSWEERLSIAGESGFDYVEISVDESDARL
FT                   SRLEWSGEERAAVCQAMVNSGVRLGSMCLSGHRKYPFGSRDQATRERSLEIMQKALDLA
FT                   GDLGLHTIQLAGYDVYYEDGAEDTRKYFEENLAKAVEMAAKAGIVMGFETMETPFMDTV
FT                   EKAMHYVNLIKSPYLGVYPDAGNLTNASFIYGNTVADDIALGAGHILAAHLKETVAGAY
FT                   REIPFSTGTTDYEGALSQLVPQGVRRFVAEMWYTGNENWKEDLVFASTYVRSKIDKVFE
FT                   G"
FT   gene            380016..380696
FT                   /locus_tag="Apar_0332"
FT   CDS_pept        380016..380696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0332"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: acp:A2cp1_4211 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50763"
FT                   /db_xref="GOA:C8W9H5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H5"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ACV50763.1"
FT                   /translation="MKFFIDTADIDEISEALSWGCLAGVTTNPSLYAKIGGKLADFESH
FT                   MVKIAQLCEGLPVSAESTATTTEGMIEEGRHLASLAPNIVVKLPICAESLAATHQLASE
FT                   GIRVNMTLIFSAPQALLAANAGARYISPFVGRFDDIGEDGIEQLATVVSCIENYAWDKN
FT                   VDHTVEIITASVRTPNHVTQAALLGADIATVPFGALKKCLKHPLTDAGLKSFEADWEKV
FT                   KAQQ"
FT   gene            380810..381739
FT                   /locus_tag="Apar_0333"
FT   CDS_pept        380810..381739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0333"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   gme:Gmet_0551 transketolase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50764"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H6"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ACV50764.1"
FT                   /translation="MGTSALPERNLTDDELKLAANTLRRDVIDMLEKSKSGHPGGSLSA
FT                   ADIVATLFFSGVMKYNHNNPEDHTEDRFFLSKGHVAPVLYAAYHLLDWLHDEDMVTLRQ
FT                   LGSRLQGHPDCHACPGIEVCSGSLGQGLSVAAGCALGLSMDALASGERAKKVFVLLGDG
FT                   ELQEGSNWEACMFAAHQKLDNLIAIVDLNNLQIDGHVTDVCSLGDIDEKFRSFGWNVLR
FT                   VNGHEVVSVRKALLTARDGREAGNTAPTVVICQTVKGKGVSFMEDKASWHGNAPSAGQA
FT                   DIAREELDAARELLLIDLQGEGKEVANV"
FT   gene            381732..382658
FT                   /locus_tag="Apar_0334"
FT   CDS_pept        381732..382658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0334"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: gbm:Gbem_0280 transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50765"
FT                   /db_xref="GOA:C8W9H7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H7"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACV50765.1"
FT                   /translation="MSRATREAYGQTLVELVNEGHDIIAVDADLAGSTKLADLQKAFPQ
FT                   RMVDVGIAEQNMVGVASGLSLTGRTVFTGSFAVFATGRAYDQIRNTVCDSGLNVKICPT
FT                   HAGITVGEDGATHQSLEDIGMMRALPQMRVLVPADYNATRAALRLAAEADGPFYVRMGR
FT                   HKVADIYDESFKGGLPFANVLREGTDVTIAACGVEVAQALAAADLLAEEKISAEVIDVF
FT                   SIKPLDEEVILASAEKTRHVVTVEEHNVATGLGAAVAELLAEQLPTPMRFAGMRTFGTS
FT                   APGDVLLSHFGLDAEGIAARVREFVLS"
FT   gene            382706..383611
FT                   /locus_tag="Apar_0335"
FT   CDS_pept        382706..383611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0335"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bcb:BCB4264_A1013
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50766"
FT                   /db_xref="GOA:C8W9H8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV50766.1"
FT                   /translation="MKGNSLGETIYSLRHSKGLTQEQLAEGICSPVSLSRIENGRQMPS
FT                   KVILDALLSRLGASTYQLCDVFYQSDCQRSFNEITRRASLLIETGKIQQGLSLLESLDK
FT                   NDASHALERQSVLLIQAAAQLKQNKDPEDSYVKLYEALELTKPHIDLSDFRHELLSPIE
FT                   AEIIGLMVVALQQKEARIKAIRVGEELARNLSDQQSSSNDFMVVRINLEVNISSCLDLE
FT                   GRFEEAAQHAYLARDLSIESHEQILLPVIFYLIGRSEFRSGNIEKARSIMQTIIPYMEL
FT                   IGQHDNAEMVRAFVEENLSA"
FT   gene            383842..385467
FT                   /locus_tag="Apar_0336"
FT   CDS_pept        383842..385467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0336"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: bcz:BCZK1718
FT                   multidrug ABC transporter, ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50767"
FT                   /db_xref="GOA:C8W9H9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9H9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50767.1"
FT                   /translation="MSVKYLLKNASKRNVIIFVLVQIMSSCVVAGVAFLLSALLNTVSE
FT                   VIISGDIALLLKFIGLCCIYAIATGILLMLQGYVRARLVRDTVIKMRNSAVKAYLRRND
FT                   IVDMNENSAEFLSLLSQNMDTIEKDWLGGLLDAFSSCCEITIASLLLLYINPIVAVISI
FT                   LVMAIPTIIPGMFTKQLTHCQEEIVKNTVSYNGQIRDISLGIDVIRSFHKESNFTNRHL
FT                   MVAQQLEGKKAHLSEVTALISGLVTAISVSSQFIIMGITGIFAVQGFVSLGSVVAVTQL
FT                   SGQVITPASTFASLLGKVKAAYPVLKVVIRDDEETSFDNEARHYDVEREIELKNVTYKY
FT                   PDSISGVSKISARFKTGRKYAIIGKSGSGKSTLLKLISGQIEPQDGDILIDGSRDISCD
FT                   PAMIHQNVYLFDDTLKNNITLGSSYSNEQIDEAIKKSGLSEVVAALPKGLDTPVEENGK
FT                   RFSGGERQRIAIARALLYGKKLLLVDEATSALDTRMATEVENNLLGLSGVTMIEVTHHL
FT                   NVAQQSKFDAVFEMTPSGLLEIKQ"
FT   sig_peptide     383842..383934
FT                   /locus_tag="Apar_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.675 at
FT                   residue 31"
FT   gene            complement(385625..387028)
FT                   /locus_tag="Apar_0337"
FT   CDS_pept        complement(385625..387028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0337"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dol:Dole_0317 glutamate synthase
FT                   (NADPH), homotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50768"
FT                   /db_xref="GOA:C8W9I0"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I0"
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /protein_id="ACV50768.1"
FT                   /translation="MRMPQVNGRYIPNVKAPRTADNEEPAAERAQDFRPVDKGFTKEMA
FT                   IAEANRCLDCKNPLCVQGCPVNINIPRFIEAIRAEEFGRGLDIIRESSMLPAVCGRVCP
FT                   QENQCEGVCIMGKRSEPVAIGQLERFLGDQPELASKPAIAPKNGKKVAVVGSGPSGIAC
FT                   AGELARNGFDVTVFEAFFTGGGVLVYGIPEFRLPKAVVKREIDGLQELGVKFEYNSVVG
FT                   RITDADELFEQGFDAIYIATGAGLPKLLNIPGENLPNVFFANEYLTRVNLMKANKFPEY
FT                   DTPTKHGKNVVVFGGGNVAMDAVRTAKRLGAERAIIAYRRTEDEMPARRAELHHAKAEG
FT                   VEVLPLVSPLEFIAGEDGTVCAVRVQKMELGEPDADGRRRPVPIEGAIEDIPCDVAISA
FT                   IGTNANPFAKMIGDIKLNKWGYIEADEEGRTSDPRIWAGGDIVTGAATVILAMGAGKIA
FT                   AASITKHIG"
FT   gene            complement(387010..387852)
FT                   /locus_tag="Apar_0338"
FT   CDS_pept        complement(387010..387852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0338"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   sat:SYN_00607 ferredoxin--NADP(+) reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50769"
FT                   /db_xref="GOA:C8W9I1"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I1"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACV50769.1"
FT                   /translation="MYKILEKTQFSEKVFKFRIEAPQMAKHAHAGQFLMVRANECGERV
FT                   PFTFADWNPEEGWVEFIFMVIGKTTQMLSTYEVGDSLQDVTGPLGEPTEMGEGKWAVIG
FT                   GGVGLAIAFPVARQLVAAGREVHAIMGARTKELLLLEDQFRSILDDDHIHITTDDGSLG
FT                   EKGVVTAPLERLLQDKQVDRVFCVGPVPMMKFSTLTAEKYNTPIIASLNPIMVDGTGMC
FT                   GCCRVEVGGETKFACVDGPDFDATKVDWNDLRARQAAYLTEEGQSIKAYEETRCACHR"
FT   gene            complement(388101..388640)
FT                   /locus_tag="Apar_0339"
FT   CDS_pept        complement(388101..388640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0339"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: rbe:RBE_0861 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50770"
FT                   /db_xref="GOA:C8W9I2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I2"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACV50770.1"
FT                   /translation="MLICGLGNPGEKYAHTRHNIGFAVIDVLAARYNVHYWKNEAGCQV
FT                   STINITNASGQSQKIILAKPWDFMNTSGGPLCKLARAHNITADQILVIHDEIDLEDEHI
FT                   RFRTGGGLNAHNGLRSIADKLGTRDFMRLQCGISRPPGRMTVANYVLKELKGVSLTNFY
FT                   IEAEAAADKVEELIHL"
FT   gene            388892..389542
FT                   /locus_tag="Apar_0340"
FT   CDS_pept        388892..389542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0340"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="KEGG: spe:Spro_1260 pyrrolidone-carboxylate
FT                   peptidase; TIGRFAM: pyrrolidone-carboxylate peptidase;
FT                   PFAM: peptidase C15 pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50771"
FT                   /db_xref="GOA:C8W9I3"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I3"
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /protein_id="ACV50771.1"
FT                   /translation="MPTILVTGFQPFGGEKINPAWEAIRVLPDSIVGSKVVKLQIPVVF
FT                   GVGADVVSTAIDHINPDIVLCVGQAGGRAKITPEFVGINYRDARIPDNDGNQPHAQRIV
FT                   EDGPDAYFATLPVRAMTEAMNESGIPAALSYTAGTYVCNDVMYSMLHVLATKYPNARGA
FT                   FMHVPFATEQATKQPVNTASLPIEVMARGLEVALSVAVKHKIDVTSESTGTIY"
FT   gene            389645..390748
FT                   /locus_tag="Apar_0341"
FT   CDS_pept        389645..390748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50772"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50772.1"
FT                   /translation="MRKELFTRRSFTGLAAATTVGLLTGCSTFMQVFNGQNADENQGDN
FT                   KDKDQSKGFSQEDLKAEWNSTPLAEQPDNPTLDGDIKKIIIGVWQVDSAAGAGDKAGQT
FT                   YDHAGILNQAYKDGTVPHYIFKSDGTHELHHFDGKVDQGKWTIKEGSTISCFYEEDNTT
FT                   DELTYDKDKQRLRFTGKSAVSDYQKLTDNPEDTSQIAYDNGKVVNFAATLPGVWEVIYV
FT                   DHADKNEPDLDLKAIQKNIKETNSSYFFSVHKNGFCALFYPSGRVLPAKIYTKDLSDDG
FT                   LSYPLMVASSDQFENVEDAVLTREANNPRTIRVKLKDVEYLFQHYNHREDDFGDISYAP
FT                   KAPFPWNLDHLNDQNSKSDSSSSSGSK"
FT   sig_peptide     389645..389761
FT                   /locus_tag="Apar_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.520 at
FT                   residue 39"
FT   gene            complement(390961..391956)
FT                   /locus_tag="Apar_0342"
FT   CDS_pept        complement(390961..391956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0342"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bsu:BSU00510 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50773"
FT                   /db_xref="GOA:C8W9I5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I5"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACV50773.1"
FT                   /translation="MFENLSEPLLVARNIKLYTGTGNPELARKVADILHLELQGLLLEK
FT                   FANGEIYARFDESVRGDEVFFIQSLAGVNVNDLVMETLIVADAAKRASANSFTVVIPHY
FT                   AYARQDRKAAAREPITARLMANLLENAGVDRVITLDLHQGQIQGFFDIPVSHLTALYLL
FT                   GDYFKSKSLDWENTVVVSPDMGRAKAAKKLSDYLDCGLAIAHKSRPRHNESAVMGIIGD
FT                   IKGKTCIVNDDMIDTAGTLCASVVKLKEMGAGDIYVCATHGVFSGPAIERLNNAPIEEC
FT                   IVTDAIPCPAANQKGSKIKTITIANELAEAIYAVYTDRPVSDIFGGDFNL"
FT   gene            complement(391957..393345)
FT                   /locus_tag="Apar_0343"
FT   CDS_pept        complement(391957..393345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0343"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein; 4-diphosphocytidyl-
FT                   2C-methyl-D-erythritol synthase; KEGG: bha:BH0065
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50774"
FT                   /db_xref="GOA:C8W9I6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I6"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACV50774.1"
FT                   /translation="MPLTAIVLAAGEGTRMKSHHPKIVHKLLDKPIVWWSVNAAITAGA
FT                   DRVIVVVGNHADEVKSALSCFPNLEYVAQTERLGTGHAVKVVKDALGGFKGPVVVINGD
FT                   ASLLRAQSILDLVAETKAHHNACTVLTMTPPDPTGYGRVISSNGQVTAIIEHKDATPEQ
FT                   REQERECNVGVYCFCGGRLTANIDLLGNDNVQGEYYITDMVGLYVSQGEPVAAVHVDDY
FT                   KEALGVNSRSELAVATRIMQERINEHWMSQGVTMLDPTSVWIGPEVTLGMDTEVLPQTM
FT                   LYGKTSIGENCVIGPNTRLTDTCVGNDAIVDETVAINAQVDDYATCGPRAYLRPGTHLM
FT                   PHAKAGTHVEIKNSTIGEGSKVPHLSYIGDTTMGSGVNIGAGSITCNYDGYHKFKTHIG
FT                   NNVFVGSDTMMVAPVSIGDGALVGASSCITKDVPADALALERSEQKIVEGYAAQRRHKL
FT                   EKED"
FT   gene            complement(393415..393489)
FT                   /locus_tag="Apar_R0011"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(393415..393489)
FT                   /locus_tag="Apar_R0011"
FT                   /product="tRNA-Gln"
FT   gene            complement(393534..394463)
FT                   /locus_tag="Apar_0344"
FT   CDS_pept        complement(393534..394463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0344"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   mxa:MXAN_0560 penicillin-resistant dd- carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50775"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I7"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACV50775.1"
FT                   /translation="MDPITPGSIGAAVEDIQERLVKLGYTIEDDERQNHVFDKSTARAV
FT                   ARFRLDHDLSLGEEVDASTWAIMVDEGYELGDRTLYLRLPNFHGNDVRQLQERLNILGF
FT                   SCGKVDGHYGVHTEAAVKLFQESVGELADGMAFQDTLDAIERLRHVWSGKQAKGPHPQG
FT                   PMGFARAANVLETTCIAITGEDPISRNVAARVYNLSKATTEASGMTMIDRADSPTDAAT
FT                   ILVLTTDDKPNIPARGQIGIGSVSMEENETLPARLRTAIESADATGAPIRIVLPEGTNV
FT                   DGSFTTADAQTLAVLVLDAICGAFASLS"
FT   gene            complement(394466..395509)
FT                   /locus_tag="Apar_0345"
FT   CDS_pept        complement(394466..395509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0345"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: son:SO_3653
FT                   octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50776"
FT                   /db_xref="GOA:C8W9I8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I8"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACV50776.1"
FT                   /translation="MNFADYLKQKLPAVEAEIMRGLPAASTSPANASSERTHADLNTYL
FT                   YQPLAHFSAGGGKRVRPVLCCLGAEAVGGSAEAALPVGCAIEDFQSAALIHDDIADKSE
FT                   LRRGEKCLYKTLGTGLAINVGDSALVNVVRRVTVADHLSDQIKVRVIDALLSMEEHTLE
FT                   GQALDLGWAQNERWDVTSDQYLFMALSKTAYYSAAYPLVLGALIGGADQKTLDALKDFG
FT                   LKVGLAFQLQDDLLNLVGDAKEQGKDFRSDITEGKRTLAVVYALEHLGSADKAELVSIL
FT                   SAHTTDTLRLQHAVELMESVNAIKFVRTRALALVEEAKLVLKNVILTEDARDTLLSMAD
FT                   FFVNRER"
FT   gene            complement(395517..396572)
FT                   /locus_tag="Apar_0346"
FT   CDS_pept        complement(395517..396572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0346"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; Male sterility domain;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   polysaccharide biosynthesis protein CapD; KEGG: bce:BC5448
FT                   UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50777"
FT                   /db_xref="GOA:C8W9I9"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9I9"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACV50777.1"
FT                   /translation="MSDTSTSSNGCVLVTGGAGFIGSHTVVELLNSGYEAVIVDDLSNA
FT                   SAKVIDRIKTIVGEENAKRLSFYKADVNNADALNRIFDEHPINFVIHFAGFKAVGESVT
FT                   KPIEYYTNNLGNTLTLLDVMRNHGCKSIIFSSSATVYGDPDSLPLTERSPKKNATNPYG
FT                   WTKWMIEQILTDVHTADPEWNVVLLRYFNPIGAHQSGLIGEDPAGIPNNLVPYVAQVAV
FT                   GKREAVHVFGDDYNTPDGTGVRDYIHVCDLGSGHVAALKWMAGRTGVEVFNLGTGTGSS
FT                   VLDVIKAFSKACGKEIPYVIEPRRAGDVATNYADCQKAAKVLGWKAQYNLADMCRDSWK
FT                   WQSMNPDGYRG"
FT   gene            397494..397805
FT                   /locus_tag="Apar_0347"
FT   CDS_pept        397494..397805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50778"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50778.1"
FT                   /translation="MGLGDCNLGAVSYPLKDKGLNITPEMCFGIGEGYGFSFWVEKSNR
FT                   LPIVAIMGRTRSCEEDLFRKCISTFSLFDALFPQESEIEKEIVALGRSFTGSKSRESK"
FT   gene            397826..398521
FT                   /locus_tag="Apar_0348"
FT   CDS_pept        397826..398521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0348"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gbm:Gbem_2210 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50779"
FT                   /db_xref="GOA:C8W9J1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50779.1"
FT                   /translation="MIRFENVSKSFKDGDKYHTILNRASTSFNDGQKNCIVGRSGLGKS
FT                   TVLKLISSIENADEGSIYINDINISTASQEEIRSIRQHLIGYVFQSFNLIKSLTVEENI
FT                   LLPTFFLESPSDLFDISYLLDVLNLPSSILKQDVSTISGGEKQRVAIARALINKPRILL
FT                   ADEPTGNLDSNNEENVLKLFDRITNELDMTLVIVTHSSKVAANCDCIVTIENGEFQQVK
FT                   DTFSQNQFV"
FT   gene            398534..399736
FT                   /locus_tag="Apar_0349"
FT   CDS_pept        398534..399736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0349"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lpf:lpl2849 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50780"
FT                   /db_xref="GOA:C8W9J2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACV50780.1"
FT                   /translation="MHSSMYLLVKRAYSANKKRNSLTILAVGISVFLLTAILTFSTSFY
FT                   HKMIEEMRVADADVVTVAFGAGDNALNYTYLNLYTDDDIKLINQIDGVTDVTGVKGLNV
FT                   SAVTYDNNKRILANSLRGIDRSYLDNYKISYTGTFPDKDDEIIIGARIADASGLQIGDS
FT                   IDIDFGSQRKTFKIVGILDKQEEQLFSTFPTEINQLIATYSNSSLFETSNYIYISARVK
FT                   DQDQLSEVSKKIVEAINTDSNLTEALENTGLHPLVATRQNVLDMLDTWFSYILLFVYVV
FT                   SVLLGIISTVNIFNIFVITIQEQFKDIAVYKIVGASIRQIRNIFIYQSVFIGTMGSVLG
FT                   ILLGYLLSAIVILLLHWPIRFDVYTVLIPFAIGMTSPICAGVWSSKKSEKVDINILTGN
FT                   L"
FT   sig_peptide     398534..398641
FT                   /locus_tag="Apar_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.538 at
FT                   residue 36"
FT   gene            399746..399940
FT                   /locus_tag="Apar_0350"
FT   CDS_pept        399746..399940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50781"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50781.1"
FT                   /translation="MLHTLKTGHIFLFDNETLSIYSLDKEQGQRFYDIGDIELTKAFQK
FT                   NKSGNKKVSLLRIIRLPLG"
FT   gene            complement(400106..403861)
FT                   /locus_tag="Apar_0351"
FT   CDS_pept        complement(400106..403861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0351"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: dno:DNO_1110 phosphoribosylformylglycinamidine
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase; PFAM: AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50782"
FT                   /db_xref="GOA:C8W9J4"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J4"
FT                   /inference="protein motif:TFAM:TIGR01857"
FT                   /protein_id="ACV50782.1"
FT                   /translation="MVLRVYVQRKPGFEGEAKALLKEVKDLLGITELQRIDLFNRYDVE
FT                   GISEELFESCIPTVFSEPQSDFASRTMPEFSSEGAAVHTFAVEFLPGQFDQRADSAAEC
FT                   VQLISQGERPLVRSARLYVLTGNLTEANVAAIKNYLINPVEAREASLELPETLKISIPE
FT                   PADVEVLEGFNALDQDGLKEFISSHGLAMDLADLTFCQQYFTDEQRDPTITEIRVIDTY
FT                   WSDHCRHTTFNTGITGVQIDDDLVKAAFEKYLSMRKELGREDRAVSLWDMATIGAKYLR
FT                   KKGILTNLDESEEINACTVKVKVDVDGKDEDWLFLFKNETHNHPTEIEPFGGAATCIGG
FT                   AIRDPLSGRSYVYQAMRVTGAADPTVPVFQTLPGKLPQRTIVRTAAAGYSSYGNQIGLA
FT                   TGQVSELYHPGYVAKRMEIGAVVGATPQSHVRRERPEDGDVIVLLGGRTGRDGIGGATG
FT                   SSKAHDAGSIERDGAEVQKGNAPVERKLQRLFRREDACKLIKRCNDFGAGGVSVAIGEL
FT                   ADGLDVNLDAVPKKYDGLDGTELAISESQERMAVALEAKDVEQFCAYAREENLEATIVA
FT                   TVTEDPRLVMRWRGQKIVNISRAFLASNGAPKSITVRLAKPLVYQRTWAGSTLGEKLHS
FT                   LVRDLNVASNKGLSERFDSTIGAGTVLMPFGGARQLTPALSMVAKLPVMGQTSTVSGMA
FT                   WGFNPYLMEADQFRGAYLSVVESVSKLVATGFKYQDLYLTFQEYFEKLGQNPNRWGKPT
FT                   SALLGALMAQVNLGLAAVGGKDSMSGTFEDLDVPPTLVSFATGLTKVDKIVSNEFKGAG
FT                   HRLISIVPSYDESGLLPNNESLLTAYKLVSTLVQSKSALAITTPGYGGVAEALFKSCLG
FT                   NKLGVELVPEISANALFSPTYGAFIVELADGVSVDDVDGVCVAPLGATTSEYTFSACGE
FT                   KIDLSELQEAWERPLEEVFPYRGGSDEAVEKISFDGASTRHSYAGPTLIAPARPRVIIP
FT                   VFPGNNCEYDVARAFERAGADPTTLVINNLTPQDIVESANALAESIKKSQIVMIPGGFS
FT                   GGDEPDGSAKFICALFRAPQVTEAVCDLLQQRDGLMLGICNGFQALIKLGLVPYGNIRP
FT                   MDDTCPTLTFNTIGRHQSQLVHTSVASTMSPWLSKCALGDIHTIAISHGEGRFVASDEL
FT                   LETLKANGQIATQYVDATGTPSMDFSVNPNGSVLAIEGITSPDGRILGKMGHTERSGAG
FT                   LYKNIPELTPGDQFQPLIEGGVEYFK"
FT   gene            complement(404047..404841)
FT                   /locus_tag="Apar_0352"
FT   CDS_pept        complement(404047..404841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0352"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: bha:BH0166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50783"
FT                   /db_xref="GOA:C8W9J5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J5"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV50783.1"
FT                   /translation="MALKISVGQYYHANSPIHRLNPNVKCLAALLLMLTTFFIRTAPQL
FT                   ALLVVGALCLLVIAKIPVKQVLMSIIPIAWLLIFLSLFDLLLTREGTVLVSWSIFTITD
FT                   VGAWSAFLYPMRILSAILIGALLLLTTTQTDLGNAFEAACAPLSKIGLPGKEIAMVFSL
FT                   MLRFIPTLAGDAVSISEAQTARAGDVVSGSLPKRLRATLSIVVALLASSLRHANNLSKA
FT                   LDARHYVAGASRTRWHQPTFGAREAIALGVTACFIALVFVLA"
FT   gene            complement(404831..406717)
FT                   /locus_tag="Apar_0353"
FT   CDS_pept        complement(404831..406717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vfm:VFMJ11_1661 ABC-type cobalt transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50784"
FT                   /db_xref="GOA:C8W9J6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50784.1"
FT                   /translation="MSNLLDNSPDTHTSESAAQVQDLPVAATLSDVTFVHAKGVVALDH
FT                   VSFSIPAGKRTCIVGANGSGKSTVASILSGLTAPDEGTVTFLGTTVVNDGQVDFESYKT
FT                   IRPQLGLVFQNPEDQIICSVVADDIAFGLENLQVPSGHITQLVEEQIKLGSLTKFSSEN
FT                   PQKLSGGQQQRVAISGTLVMKPQILILDEPSAALDVVHRNNVMGLVKKLRAAGKTIVHI
FT                   THFMDEVVSADHVIALDDGRIAFEGTPEALFDQHELVECLHLEEPFAYQVAHALNNRGV
FT                   VVCKSPSAERVLNELTGLLATATQGGDMAENCNGAAAGCNTNNGITATDSASEPAAVSV
FT                   RNVTFSYQKPVLKNISVDVQKGSHVAVIGSTGSGKSTLARLICALDTPDTGSLCVTGLD
FT                   TRQKQNRRKLHGIVGYVMQRPERQLFAQTVAEDVAFGPTNLGFSACDVTSAVNAALELV
FT                   GLSRKADASPFELSGGQQRLCALAGVIAMQPQVLVLDEPTNGLDPYYRSKLRKIINAVL
FT                   KDGCTVIELTHSMEDAAETDQIIVLHEGDLIFSGSPQQTFTHFSEAEFQKLGLGIPHAL
FT                   AWAQRLSRATGINLGEPLTLSELADSLLDVVMTTPGAAQVSDLTQGGQNHGA"
FT   gene            complement(406710..407297)
FT                   /locus_tag="Apar_0354"
FT   CDS_pept        complement(406710..407297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_1606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50785"
FT                   /db_xref="GOA:C8W9J7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J7"
FT                   /inference="similar to AA sequence:KEGG:BCE_1606"
FT                   /protein_id="ACV50785.1"
FT                   /translation="MTSSHSTHATTVSSNGWSTKRIAILAMLCAAAAISTMVLQFPLIP
FT                   GVTFLKYDPSGVFALLAGVAFGPAAGAIVSVLPYLLHLATESGIYGTIMAILATLTYVL
FT                   PISLIVYNRSEKIKQLVLALIVGSVVSVIACILGNLLVTPIYTGMSVEAVSGLIVPALL
FT                   PFNVVKVAINSIIFVVIIRSATSLFESIKNGE"
FT   sig_peptide     complement(407175..407297)
FT                   /locus_tag="Apar_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.759 at
FT                   residue 41"
FT   misc_binding    complement(407303..407468)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam(RF
FT                   00050), score 84.67"
FT   gene            407711..408637
FT                   /locus_tag="Apar_0355"
FT   CDS_pept        407711..408637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0355"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: bcb:BCB4264_A5216 UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50786"
FT                   /db_xref="GOA:C8W9J8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J8"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACV50786.1"
FT                   /translation="MSESGYDLQSLAGKLCSIVGEENVLVDEPMSEHTTFKVGGPADLY
FT                   VIPDDPDEVKETLLAVKDAKAPYFILGYGSDLLVSDAGYRGVIIAVADGLTGVSIDDTE
FT                   MTCQAGVGLKEASEMACELDLSGLEFACGIPGSVGGACFMNAGAYDGCISDVLKSVRVL
FT                   LADGTFATLDASELDLGYRHSRIADEGMIVLSATFNLHRADGEKIREKMEEFTRAREEK
FT                   QPLELPSAGSTFKRPEGHFVGKLVTDAGLKGYRFGGAGVSDKHAGFVVNYDNATAAEVH
FT                   AVIEHVQAEVKRQFDVELYPEVRFLGE"
FT   gene            complement(408660..410042)
FT                   /locus_tag="Apar_0356"
FT   CDS_pept        complement(408660..410042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0356"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: sml:Smlt3887
FT                   putative phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50787"
FT                   /db_xref="GOA:C8W9J9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9J9"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ACV50787.1"
FT                   /translation="MRKIRKILIGQSGGPTVAINSSLAGIVARAHEEGIEIYGMQNGIE
FT                   GFLNGRYTNLTNLFFPQENQQNRNVDQQEHIVNQQKRSVDQQEHGVDQRGADQQKHTVE
FT                   LLVKTPSSFLGSCRYKLPEVSEKTSFYQDIECRLTSLEIDGILYIGGNDSMDTVNKLAA
FT                   YFAQHNNDISVIGIPKTIDNDLEGTDHSPGFGSSARYIATIVRELARDSEVYNKPNITI
FT                   VETMGRDAGWLGAASALAREKNEEAPDFILLPEVTYDEKRLLRKTAELFEHKNSVVIVI
FT                   SEGVRRPDGSTLLNKSHTKMDAFGHLADQSGNALYLADLFQKHFDAKIRGINLNSLQRC
FT                   AMHSSSKTDLSEAFELGKAGVDALLAHKTGCMIGLQRLSDVPYQAEIRCIPISDIANRV
FT                   KSVPAEMISDDGLWITEKALAYLRPLVSNEELAFDADTRRFVSSNILPDNNGLPPFIPK
FT                   LR"
FT   sig_peptide     complement(409968..410042)
FT                   /locus_tag="Apar_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.502 at
FT                   residue 25"
FT   gene            complement(410361..411704)
FT                   /locus_tag="Apar_0357"
FT   CDS_pept        complement(410361..411704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0357"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: dar:Daro_3204
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50788"
FT                   /db_xref="GOA:C8W9K0"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K0"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ACV50788.1"
FT                   /translation="MHSTSEHAIHTILVGQSGGPTTAINASLAGIIRAAHAQGLRVLGM
FT                   RNGIQGFLEGNVVDLIEVLELEKPKLGALKQADTNLGEKNLQLLRKTPSSWLGSCRFKL
FT                   PELEANSTSGASSESTANSKSAAVSPIYQQIDLQLKKYQVDAVLYIGGNDSMDTADKLS
FT                   RYFAQVESAVRVVGVPKTIDNDLEGTDHTPGFGSAARFVASVTAELTRDGGVYNTKNVT
FT                   FIEAMGRDAGWLTAAGALAQDICGTAPDFVLLPEVPLDVNALLSAIEQRLREKNNVIVV
FT                   VSEGVHHADGSFLFDAKSVAIDTFGHLAAQSGTAQYLSQLVKDQLGVKSRGIELNTLQR
FT                   CASHAASKVDLDEAEALGAAGVKAVLQGKTGVMVGVHRIPNEPYTTEIRTTPVADVANK
FT                   VKLVPREMISEDGFNVTDTALTYLRPLVAGIEEPVSVDGLPRFLAELP"
FT   gene            complement(412330..413619)
FT                   /locus_tag="Apar_0358"
FT   CDS_pept        complement(412330..413619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0358"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: bcy:Bcer98_3678 phosphopyruvate hydratase;
FT                   TIGRFAM: enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50789"
FT                   /db_xref="GOA:C8W9K1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K1"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACV50789.1"
FT                   /translation="MSQIFDVHAREVLDSRGNPTVEVEVVLDDGSFGRAIVPSGASTGE
FT                   FEAVELRDGDKSRYLGKGVLKAVEHVNTEIRDLVIGWDAEDQRGLDLAMIKLDGTPNKG
FT                   RLGANAILGVSLAVAHAAAASAELPLYAYLGGANAHTLPVPMMNVLNGGVHADNNVDFQ
FT                   EFMIMPVGAPDFTTALRWCAQVYHTLKDTLKSQGLNTGVGDEGGFAPDLKSNEEPLELL
FT                   SEAVKAAGFELGKDFRFAMDPASSEFYNKETGKYDLKGEGRSLTSEEMVAYYEEMVEKF
FT                   PIVSIEDGLAEEDWDGWKVLTQRLGKKIQLVGDDLFVTNTQRLKKGIEVHAGNSILIKV
FT                   NQIGTLTESLEAIEMAKRAGYTAVVSHRSGETEDTTIADLVVATNAGQIKTGAPARTER
FT                   VAKYNQLLRIEDDLADGAEYLGMDAFYNLR"
FT   gene            complement(413811..414167)
FT                   /locus_tag="Apar_0359"
FT   CDS_pept        complement(413811..414167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0359"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   dds:Ddes_1828 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50790"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K2"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACV50790.1"
FT                   /translation="MSEELIPGVMKNIDAKTVVTLKDQVACLPGQVISKTLAQNDAVSV
FT                   TLFGFGSGEEIASHRAGGDAFVTILEGRANITIDDDVYTLEAGQSIVMPLGHPHALQAP
FT                   EEFKMLLVVVYPQK"
FT   gene            complement(414270..416480)
FT                   /locus_tag="Apar_0360"
FT   CDS_pept        complement(414270..416480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0360"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: bca:BCE_3516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50791"
FT                   /db_xref="GOA:C8W9K3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K3"
FT                   /inference="protein motif:COG:COG3973"
FT                   /protein_id="ACV50791.1"
FT                   /translation="MDPIHQQEQEHLTHVYQKLVEIREDLDTTLNTTQKDAARDLRQMS
FT                   EEIRPDFGGADETIETLAAIETLNSVIDTYNQYHDFTVEKLGRVEILLRQPYFAKVTLK
FT                   MRPGRPSRDVYIGAAGITDKDRSQLIVDWRSPVAETYYNQEMGTTSYQVDGKKRTVELE
FT                   LRRQFDITRDKLNLYFDTTVAIEDSLLLAALKRQHTEKLQAITATIQREQNVVVRHEDV
FT                   PVLLVNGIAGSGKTSVLLQRIAYLLYQQRTTLTADQVYLFTPNEMFGRYINTVLPSMGE
FT                   HNPQVFTWDSFLKALGLADHASGAHNNPDSLKKLEEQLASLELYEDDFKAISVEGTTLI
FT                   KPAQVASSVAKFSQFPVGPRLIALAKDELHIRLERRLGQMAHNDEIQEEMLSLDVEQQL
FT                   EVFGRTISPSDEEEVLARTREFLNWRYSSAHEVIESTSWLRIDRIGMRMLNTSALSGAE
FT                   CVYLRLLITGAGEKNVKFVMIDEVQDYTETQLMVLGKYFSRAHFLLLGDSNQAIWEDTA
FT                   TFEQIEKIFTATHGEGAVSTCKLLISYRSSPEITALFTSLLSEEGRGQTSSVQRGGKKP
FT                   EFFEVVADDKETERAEYLKTMKSLVEQAQEFDGLTAIVCTEKSRVRWLAKQMEELFAAE
FT                   DVSGGTDDTVQIDGMKSSESNTGVKVLTSHDSLPAKGVVLLDLALAKGLEFDQVIVADA
FT                   QEEVYKADGISRRRLYTALSRAMHHVIVVSQGKMTPLLSNLL"
FT   gene            complement(416488..417072)
FT                   /locus_tag="Apar_0361"
FT   CDS_pept        complement(416488..417072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0361"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: bsu:BSU28190 GTPase
FT                   EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50792"
FT                   /db_xref="GOA:C8W9K4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K4"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACV50792.1"
FT                   /translation="MDLKYETAQYEASYGTISQLPSPETPEVAFVGRSNVGKSSLLNKL
FT                   IGRKQLARVSSVPGKTANINFFDVDGVKFVDLPGYGFARVSRQEKQRWADLIGGYFEQE
FT                   RSFNLVISLVDIRHEAQKLDLQMINFLQEAELPFVVAFTKADKIARGKQNQAAAALRKA
FT                   FHITPEQTIITSSETGLGIDELRRRIEDATI"
FT   gene            complement(417194..417820)
FT                   /locus_tag="Apar_0362"
FT   CDS_pept        complement(417194..417820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50793"
FT                   /db_xref="InterPro:IPR032209"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50793.1"
FT                   /translation="MKLKSKVPLFAIAISLVLVCALGYRVWWVNAHALTIPEEIYQMGE
FT                   WVPLDGNFHYSSSENTNGYSMRITEISLTTYDGYLEKHGITPQHPNAHSNQTSVIDVTI
FT                   EIKNDREETDPVGGIDFLGTVLIPQANNTYYICDLGNENSLWPLVQPNITTSLIAIKPH
FT                   TSYVLHVPYVVNLSGEEIYRTSITDTTFDLLVSRLPVEKRIRVSL"
FT   sig_peptide     complement(417719..417820)
FT                   /locus_tag="Apar_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.592 at
FT                   residue 34"
FT   gene            complement(417817..418476)
FT                   /locus_tag="Apar_0363"
FT   CDS_pept        complement(417817..418476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0363"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU40620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50794"
FT                   /db_xref="GOA:C8W9K6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50794.1"
FT                   /translation="MSYISAEHLTKEIGNDTVLKDVTLSLEKKQIIGLEGQNGSGKTML
FT                   MRAVCGLIKPTQGYVSIENKKLWDDIDFPPSVGLLLEKPALLSSYSGHKNLEILSSIKQ
FT                   IVSEQAIDAAIKKVGLDPKDKRPVRKYSLGMKQRLGIAMAFFEQPDLIILDEPTNALDE
FT                   NGVRMLTELIVEQRDRGATLLISSHDAEFLEVVCDVIYKMKLGKIVEKIDVQRRAS"
FT   gene            complement(418479..419342)
FT                   /locus_tag="Apar_0364"
FT   CDS_pept        complement(418479..419342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50795"
FT                   /db_xref="GOA:C8W9K7"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50795.1"
FT                   /translation="MRNSKVIPFGPFIYSLRSPFCICTILMVLIVTTSLVVFNRSATSN
FT                   PTFADNVSSLFAGMPQISQSISSNAAMPKIKVPFAWLILVLLPHLMCFLAVSRSLRKDM
FT                   YLVMSSSKSFYPILLTVSCVTATGLYWIIAGVLILLFTLLHGGEILPSTTISLEILEGF
FT                   DASTLPANTVSIVPLIGSLFITSLSLITLQCSAGLFIKEWPPLFLIISWIVSSIFKLHP
FT                   ILIGNYMMFSRSSLYIDSASREIVEGNLCAGVNPLLTLVFCIGSLGIFLYLSLSRFKNI
FT                   DQFGGE"
FT   sig_peptide     complement(419223..419342)
FT                   /locus_tag="Apar_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.296 at
FT                   residue 40"
FT   gene            complement(419329..420147)
FT                   /locus_tag="Apar_0365"
FT   CDS_pept        complement(419329..420147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50796"
FT                   /db_xref="GOA:C8W9K8"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50796.1"
FT                   /translation="MKHKISKICTQFFDMHKNLLAALFAMLLSCTAFISSFAQFSLITQ
FT                   GGYSFSLGDLIIATLYGSAHTFSVEWTALCISFFLIIVISSSDKNEHFSIQRIMRFEKK
FT                   TRYWIYSYINIIVSCLVLIAVYIVTYFILLNCTGNSSDIATLNVDIFINHTVQTGVDIS
FT                   LTAPEVLILLGIYYLGLLFFCSIYKVIKLYTHNSLAVLLSVSLLVLGEFFPKLSFPSTL
FT                   MTFSRLLPFNPEGFSLVYTTLYFLVGIICLNIFGLIGTKNTEFGGHYEKL"
FT   sig_peptide     complement(420031..420147)
FT                   /locus_tag="Apar_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.832 at
FT                   residue 39"
FT   gene            complement(420144..421031)
FT                   /locus_tag="Apar_0366"
FT   CDS_pept        complement(420144..421031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50797"
FT                   /db_xref="GOA:C8W9K9"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9K9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50797.1"
FT                   /translation="MNSLFKAEFKRQLTNNPLFWICIAIGACIAILAAWIEIQIELNTL
FT                   EATLQQGDHLSYNTLLSVISTYTAWIPTRIGDFYSGLYYLLWPLLATIPTAWILSNDSK
FT                   EGVLEQQCLRIKKASVIRIKLYVSFVSGGICSALPLVLNFLAVICFLPLSTPKIYDEIY
FT                   TAVPMNSLFSGLFYNSPLAYVITLSALAFIIGGLFSCTVSLFASLTKTTFQAIFVSYFL
FT                   LHLLAFLGSQFSAILSSAQLREVGQNSFIKLNFFQLTSSEYAPTKLGFYCFCFVLLFLV
FT                   IFISYKKTCRSDLL"
FT   sig_peptide     complement(420930..421031)
FT                   /locus_tag="Apar_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.777 at
FT                   residue 34"
FT   gene            complement(421041..421784)
FT                   /locus_tag="Apar_0367"
FT   CDS_pept        complement(421041..421784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50798"
FT                   /db_xref="GOA:C8W9L0"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50798.1"
FT                   /translation="MFSHDSKNLKTNKLPQKAPFLAVLIACVTIAGLLYFYSLAQKQAQ
FT                   QELFAQQVMQKQNEASETYKIGDVVQLTGLDQEEGNPVETPFGADLPWVGTIEVTVTDV
FT                   ILCHSIDEAGFTSGTLNNSLTPENADSLYLVYTLHFKNIDAVQKHTPNGPDYILLSSYS
FT                   INAEGHNIFMSQITPENARIDNSDTDKTKGYFWINAGDECDVKLAFALSPEELRDVTSI
FT                   HLANMGGIYSNAKLVDIQSALKSDK"
FT   sig_peptide     complement(421662..421784)
FT                   /locus_tag="Apar_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.900 at
FT                   residue 41"
FT   gene            complement(422106..423020)
FT                   /locus_tag="Apar_0368"
FT   CDS_pept        complement(422106..423020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0368"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: bba:Bd2619 LysR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50799"
FT                   /db_xref="GOA:C8W9L1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACV50799.1"
FT                   /translation="MTLTQLKYVLAIAKAGTINAAAKQLFISQPTLSSAVKELEAELGI
FT                   SLFNRTSKGVEPTADGEEFLSYARQVVMQTDLIEERYLGTAPTKQRFCVSCQHYSFAVE
FT                   AFVNLIKEHGGSKYDFRIRETQTYEIIEDVSKLRSEVGVLYLNSFNERVIRKTLQDQGL
FT                   VFSPLFKCKPSVFVGKDNPLAKRPSVTLNDLAPYPRLSYEQGEHNAFYFSEELLATLDR
FT                   DKDIMVRDRATIFNLIIGLNGYTISTGLINEELNGPNIVAVPLAVDDYMEVGYVTHDEK
FT                   SLSLFGELYIDALKRCCQAVTWV"
FT   gene            complement(423054..423734)
FT                   /locus_tag="Apar_0369"
FT   CDS_pept        complement(423054..423734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0369"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: psa:PST_0466 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50800"
FT                   /db_xref="GOA:C8W9L2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L2"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACV50800.1"
FT                   /translation="MEDYKREFIEFMVQSNVLKFGEFTLKSGRKSPFFMNAGAYVTGEQ
FT                   LHKLGLYYARAIHDNFGLNFDVVFGPAYKGIPLSVITAMGINELYGKQVQYCSNRKEAK
FT                   DHGADAGMLLGAELKDGQRVVMVEDVTTSGKSIEETYPLITSIANIEVVGLIVSLNRME
FT                   VGKGGKVAALQEVSERWGMPTAAIVSMDEVTEALYNKEVDGKVIIDDTLKSAIDAYYQQ
FT                   YGVK"
FT   gene            423977..425380
FT                   /locus_tag="Apar_0370"
FT   CDS_pept        423977..425380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0370"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bca:BCE_4685
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50801"
FT                   /db_xref="GOA:C8W9L3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L3"
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /protein_id="ACV50801.1"
FT                   /translation="MERITISALYADAEQLGGQKVTAAGWVRSVRDMKNFGFVTLNDGS
FT                   CFKDLQVVMNRENLSNYEEVASCGVGAALIIEGVLELTPDRPQPIELQAQTIVIEGPSS
FT                   PDYPMQKKRQSLEYLRTQQHLRPRTNMFRAVFRIRSVAAFAIHQFFQDRGFVYVNTPII
FT                   TASDAEGAGEMFRVTTLDLNNVPRTEKGDVDYSKDFFGQSSHLTVSGQLQAENFAMAFG
FT                   DVYTFGPTFRAENSNTRRHAAEFWMIEPEMAFCDLAQDMDVAEEMLRYVIAYVLEHCPD
FT                   ELEMLNKFVDKGLLERLNHVANSQFSRVSYTEAIEILQEAVKAGQKFEYPVEWGIDLQT
FT                   EHERYLTEQHFGKPIFVTDYPAAIKAFYMRLNDDGKTVAAADCLVPGIGEIIGGSQRED
FT                   RLELLEKRIVELGMNPDDYKYYLDLRRYGSCTHSGFGLGFERLVMYLTGVDNIRDVIPH
FT                   PRTVGNADF"
FT   gene            425653..426993
FT                   /locus_tag="Apar_0371"
FT   CDS_pept        425653..426993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0371"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: afr:AFE_2314
FT                   phosphohistidine phosphatase SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50802"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACV50802.1"
FT                   /translation="MVKTLVLVRHGVSERGSEDMSRELTRAGQRALSANYPHIFGLLGA
FT                   EGEEAEIWTSPALRALETAEIVAEALDAEGLEIHDSLYDQDLPALQAELEHADAETLVL
FT                   VGHAPFLGYVAETLLGFELPLTKGAVCAIDVRGSLGHQHECVWKQLGDVREPHGKLLWL
FT                   VSGPSTQPWETLDALDEACAHAATNLEDAYTEFRVHPEDPAVIKAFRFALRGTQLLTKF
FT                   FSPLLNEEAVEIAEPVYRLMLGATTRLREIDGFSDTVADLMESGELSQGSKLVSAVGAA
FT                   REAERDRVCEGLRKKAVRRSLRCALDELFEPAWSDTVLQDGLSFEDITSRFDYMLETID
FT                   ARLFGLDMTSFSEVHHARREVREVEHILLHLSDTLGEKRANYAQIMQDIDSELSTVCTA
FT                   QRNISLVKEWKDSMDFRDVTSDLAIVSEHEKVLIKRVIEGRETSILR"
FT   gene            427063..428343
FT                   /locus_tag="Apar_0372"
FT   CDS_pept        427063..428343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0372"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: dds:Ddes_1040 O-acetylhomoserine/O-
FT                   acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate- dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50803"
FT                   /db_xref="GOA:C8W9L5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L5"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ACV50803.1"
FT                   /translation="MSESIETRCVQGGYQPGCGEPRQVPIIQSTTFKYDESMQLGELFD
FT                   LKAAGYFYSRVQNPTLDNVASKICALEGGTAAMLTSSGQAANFFAVFNIAEAGDHFIAL
FT                   STIYGGTFNLFAITLKKMGVECTFISPDATDEEINAAFRSNTKCVFGETIANPALVVLD
FT                   IERWAKAAHDHGVPLIVDNTFATPVNCRPLEWGADIVTHSTTKYMDGHGCAVGGAIVDG
FT                   GNFDWATHADKFPGLTQPDPSYHNLVYTDTFGNGGAFITKATVQLMRDFGSIQSPQSAF
FT                   YLNLGLESLHVRMAQHCKNGQAVAEALANNPKVAHVSYPDLPGDTYYDLAQKYLPGGSC
FT                   GVITVDVAGGREAAEKFLGNLKVFSIATHVADARSCCLHPASSTHRQLTDEELVAAGIT
FT                   PGTVRLSCGIEGTEDLINDVEQALAAL"
FT   gene            complement(428482..429954)
FT                   /locus_tag="Apar_0373"
FT   CDS_pept        complement(428482..429954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0373"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; polysaccharide
FT                   biosynthesis protein; KEGG: MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50804"
FT                   /db_xref="GOA:C8W9L6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L6"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV50804.1"
FT                   /translation="MESNKLFAETPPFKLFIRAALPGAIAMLASMLYDTADGILVGRYL
FT                   GQESFGAVTIAVPLVILCFAIADLIGVGASAVIAVEHGKKNHQTANNIFTIAFIMLITT
FT                   GVISGIFFFFFAPNVLALMGAQGKIAEQGTIYLRVWTLFLPVMCISYAVDNFLKICGKI
FT                   RRSTSIAFISAILGTVLEYYFLGVLGLSVEYAALGYCISITFSSLYGVWPFIGNKQILK
FT                   FVKPHFNWTHIREIFVNGFPIFMQNISSRIYSLLMNAALLTLGGDIAIASYGVLLYSGG
FT                   LIQPLIYGQADAMQPAVGYNWGAKKKNRVLAIEKYIFSTGIIIGIFAFCVSFFFSEFLV
FT                   KLYLPDGTQELLNIAIPAMRIHAFIFIFSWITMCTESLAIALKQTKISNLLSIFMALIF
FT                   PISSLLILKPFGLDALWYVSVVSNILSALLSVGCLIHIYRKYFTSVDKDDVGAASDASQ
FT                   EEDAELTDAALATSELSSPEDHLDPESISRAQ"
FT   gene            430154..431311
FT                   /locus_tag="Apar_0374"
FT   CDS_pept        430154..431311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50805"
FT                   /db_xref="GOA:C8W9L7"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50805.1"
FT                   /translation="MSTEQKKDIGTEFAKLTESLRVDEFSKKITEASSELVENVSEVAE
FT                   RAEKILVVDEDEPLDFSASDQVKATIPRTPAQHVLRIVSIVLIILGAADVLTTLTSLFA
FT                   TIMGLQPAVPLEQLEFSGVYFTFSKNILLGYIFVLLIGVMQIVTSVLGLRAAKDSSKVE
FT                   PYRFLCYLIGLIILVGILWAWGRGELLILDPFVQLNTIVYVVICSNLADKVKKEHDQGV
FT                   VGTTYWRSRHQRVLHLFALVSITFSGIVLFQVLILLGLHDLSGVVNQPVLETVNQFLTQ
FT                   QGILAIFLVTLGAVFSLVVGLLALKGSNDARFIRPYILAVTVIVLFDIARIIFTALTQG
FT                   IPAVTSQDIFELTYNVAGLYLAIRIEAGLPNSYGQRLWKKIHSNT"
FT   gene            complement(431402..432847)
FT                   /locus_tag="Apar_0375"
FT   CDS_pept        complement(431402..432847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0375"
FT                   /product="dipeptidase"
FT                   /note="KEGG: bcr:BCAH187_A4839 Xaa-His dipeptidase;
FT                   TIGRFAM: dipeptidase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50806"
FT                   /db_xref="GOA:C8W9L8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L8"
FT                   /inference="protein motif:TFAM:TIGR01887"
FT                   /protein_id="ACV50806.1"
FT                   /translation="MTDAELKTSAEAFVNEHWEEIIEDIRYLVQVESVEDLSLAEPGKP
FT                   WGPKSYEALRRGLEIAERLGLETTNVDGYLGFGDLPGESEKYLATIAHSDIVPLGKGWT
FT                   VDPLDVTRREGFILGRGVLDDKGPLALSLWAAHFFVEQVKKTGKKLPYTLRAIVGNNEE
FT                   TGMGDVPYYLSKYPEPAFCFTPDAEFPLICGEKGVYHAQFTSPKIAGAYSEKIVELDGG
FT                   TVPNAIPGLASALVRADASTLTNTNSIKVEDAGIEDDGTKLARINATGKGGHASMPEGT
FT                   VNAIGLLVTYLLDNNICGEKERDFLTFSQQLCSTTDGTGTGIQSADDKFGPLTCISGTI
FT                   RTKGDRYVQTIDSRYPTSTTGEAITTRMTKLGAEHDCTFEVLSDAVPFYIDPSSPEITT
FT                   LLDTFHEYTGSNEQAFVIGGGTYARHFKRAVAFGPYDSKAAKDLPEWVGMEHGPDEGIS
FT                   EEWLKRALKIYIVSIARLMQLDL"
FT   gene            432991..433512
FT                   /locus_tag="Apar_0376"
FT   CDS_pept        432991..433512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50807"
FT                   /db_xref="GOA:C8W9L9"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50807.1"
FT                   /translation="MTKKTFIGNALFLGVLTVLGIVLMVLRQTLAQDPYTPLFYAYFVA
FT                   PIVLYFSIAGLVGLLIARYTSFSLTKTVAVVLRTLAAIFFVLPFFFFLIVMLPWAILRG
FT                   LFAILMVVMLYAPWFWMFFGLFYGLSWAQQKLVEDVAADPFAEDTTAQKIAGEKTNAAD
FT                   TDTTDEGAKN"
FT   sig_peptide     432991..433086
FT                   /locus_tag="Apar_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.995 at
FT                   residue 32"
FT   gene            433560..436952
FT                   /locus_tag="Apar_0377"
FT   CDS_pept        433560..436952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0377"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase; KEGG: pfo:Pfl01_2215
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50808"
FT                   /db_xref="GOA:C8W9M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50808.1"
FT                   /translation="MLELKGISKRYNTGGFEQIAMDHISVAFRDNEFVAVLGPSGSGKT
FT                   TMLNVIGGLDRFDSGDLLVDGISTKEFKERDWDTYRNNRIGFVFQSYNLIPHQSVVSNV
FT                   ELALTLSGVSKAERHERALEALDKVGLKEHANKRPNQLSGGQMQRVAIARALVNDPEIL
FT                   LADEPTGALDSSTSVQVMDLLKEVAQDRLVIMVTHNPELAHQYATRIVELADGQITADS
FT                   DPFDVASVARREAKPSRKTSMSLLTALGLSFNNLMTKKGRTLMTAFAGSIGIIGIAAIL
FT                   ALANGTNEYIKKIEEDTLSMYPLTISEQAVNISSFISGSGSSSDSADSQGQSVQSEMTQ
FT                   NQKNAEAAKLENQPAEGAIPTNNRLGMRAESIGSNDLTSLKAFLDKNGDDINTYASAIT
FT                   YGYSVSPFIYLPAGADSNSSDPVQVQPDVTFSKVSPKIPSYNPLASFVSTTLFNELPDN
FT                   PSIYEDSYTVRAGRWPTAWNEAVLVLRPNGTIDDFLEYTLGLRDYAGLRSTVDKIANGE
FT                   SGTIEESNSRYTYEQLMSPTFKLVMPNQRYVWDGNLGVWTDKSDDQTYMNDLISNAPDL
FT                   HIVGVVQAKDPTTTGALSEGIYYTPQLTQKMISDAKASPIVQDQMNRPDVDVFTGKTFE
FT                   DEKNGQTSEGLSIGSLISVDSNVLSSAFNFNPQALSFSSINLSGLDMSSLDLSDVQLPA
FT                   FDPSQLNLSDSDVLSSVTSSLDPSALAAAFPELSAADIQQILSGITVNFKPGGQAAISS
FT                   LMGTIALGWNSWSAANPGKTMADYLATDQVRTQIVNTVSSAIDTDDLQKQLVTALANKL
FT                   GTNPDLPSVQAEVSQRLMSAYQSQIASALSAAITRAMSAYVQSALTSVMTQVASRMQNQ
FT                   IAGALNSAMQGVMANMSNAMQIDKATLASAFKLNADPSQLTAIAASMLRAKPATYESNL
FT                   TKMGYADLNKPTSINIYPKDFASKEKIVEILNKYNADAKAAGEESKVVTYTDLVGALMS
FT                   SVTLIVDMISAMLIAFVSISLVVSSIMIGIITFISVLERKKEIGILRSIGASRRDIANV
FT                   FNAETFIEGLISGVMGIAITQMLILPANAVVKAMFNVDNLVVLPLNGALILIMISVVLT
FT                   LLAGLIPAGRAAKSDPVQALRSE"
FT   gene            complement(437076..440108)
FT                   /locus_tag="Apar_0378"
FT   CDS_pept        complement(437076..440108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0378"
FT                   /product="Peptidase M16C associated domain protein"
FT                   /note="PFAM: Peptidase M16C associated domain protein;
FT                   peptidase M16 domain protein; KEGG: predicted protein;
FT                   K06972"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50809"
FT                   /db_xref="GOA:C8W9M1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M1"
FT                   /inference="protein motif:PFAM:PF08367"
FT                   /protein_id="ACV50809.1"
FT                   /translation="MALEGTRWSKNGITAHVSFRIDWQLMTSKYLQMDSAFSVGTLHAE
FT                   DKSFEIISAEWVNEISGYAYIFKHVPTGGRLMWFACDDDNRSFAIAFKTPPVDHTGVFH
FT                   ILEHSVLCGSDAYPVKEPFVNLLKTSMQTFLNAMTYPDKTVYPVASTNVADLENLMSVY
FT                   LDAVLHPAIYKRKRIFEQEGWHLEADDQGNLSYNGVVFNEMKGALSNPDRVLYDSVSEA
FT                   LFPDTAYGKESGGKPRAIPKLTYENFLDAHARHYDLSNSYTFLYGDLDCERELSFIAQR
FT                   FAAAEKRDAGAPNPLNLQTPVLPKPCQIHMNTTADNSSVGLGYVLGTPDQRNKMMAADI
FT                   LFDTLMGSNESPLKRAILDAELGDDFSYYLSDDLAQPMLFLQLKGLKKGAAQKFRELVE
FT                   STCQKIATEGINQKKLSASIALAEFNLRENDQPYSNGIEYTLRSLSSWLYDDARPLDYI
FT                   RYEDAIAYVKELAAQRGFEKLLLELICNSKHAAQVELVPTDEGDAQEEATELEQLRSTL
FT                   TDKDVEKIRAEVEALRLEQETPDAPEDLAKLPSLSLSDIGAGRERPAGFEVKAPLPCVA
FT                   HELDTHGIDYVYHYFDLTHAVTFEELPLVGVLAEVLGKLDTAAHTASELDILIESNLGH
FT                   LSFFTDIYDQDTLDQAYPAFIVAASALTEKTEELASIPSEVWSSTRFDDLNRLKNILTQ
FT                   RRIAQEQYFVGAGHTAAQNKALTSYSAASRVNDALAGVGFYEYLKNLLSNWNQRAPQLA
FT                   KDLDALTHKIFRVDNVTVSFTGSMQSRDAFWKVAGDLNLKKSNESQADSARSTLVVPEG
FT                   KLQRVAYIIPSNVSYVGLSYPNVAHATNEQQGDWLIATKVLGLDYLWNEVRVKGGAYGV
FT                   MFRNSIAGLQSFVSYRDPSLDATLDRYVGAGSWLSKWTPDQDEFEGYVVASVAGVDAPV
FT                   PARMLARRQDIEYFNHRDPERLLKLREKILHAQVEDIKELGNTIPQSHDDLSVVVFGAK
FT                   DAIEASKLDLKVVDLFGDQVN"
FT   gene            440259..441224
FT                   /locus_tag="Apar_0379"
FT   CDS_pept        440259..441224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0379"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ent:Ent638_0033 carboxylate/amino
FT                   acid/amine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50810"
FT                   /db_xref="GOA:C8W9M2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV50810.1"
FT                   /translation="MEPSKITDGAKTAVEDEVLGSDDAEITPDNKKKIYRGMLFVLIGG
FT                   ASWGAFGTAAKYLLDTYHVDPMWLIDIRELCACWLFLGTAFAFDRKNLMTVIRQPKELA
FT                   KIFVVSLFAILFSQVAYIYAVNATNSGTATIMQSLGMLGVLAFVCVVGRRWPRRREILG
FT                   IVLALIGTYLLVTGGNPGKLNLPTAGIFWGVMCAFAQAALSILPKPLMEKWGSFTVNGL
FT                   AFLFSGMLIAVFYQPWNHMPQLDAFGVLLVVIGVFVGTFLAYGLYLQGVKDAGSLRAVL
FT                   LGTVEPLMATITTVLVLGTTFSIADLIGFALILAMVVLTA"
FT   gene            complement(441371..442483)
FT                   /locus_tag="Apar_0380"
FT   CDS_pept        complement(441371..442483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU34800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50811"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M3"
FT                   /inference="protein motif:COG:COG3883"
FT                   /protein_id="ACV50811.1"
FT                   /translation="MRTNWKPPIAEVDLNNHMRHRRLPSCSSLMTALLATVLVVNTFLF
FT                   GVSKAQAETLEELQAKVEQTNSDYDAANQRVAELQKQIADNEARIAEIEQQLPEQRIRA
FT                   AESIRAMYRMQQGSMGIIDLLLSADNFNDLIAVVQYLEIIQNKNSDAINHLVDLSKELS
FT                   NTQSSLNAQMAEAEEQKKAAEDAMNEAIATREKLQAEQAQQAAAEAAAAAEALKEASAE
FT                   STFTNASGNTTEVTTPSTPSAENVDWSSDKTNFVSSWGARIDAYLSGSPLAGYGSTFAE
FT                   AAWAYGVDPRFSPAISAVESTKGRYNFLSYNAWGWGSESWSSWEEAIWDHTAGLAAGYG
FT                   GRLSVSGAAKYNPANPNGWYSAVLTQMELI"
FT   sig_peptide     complement(442325..442483)
FT                   /locus_tag="Apar_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.933 at
FT                   residue 53"
FT   gene            442739..443671
FT                   /locus_tag="Apar_0381"
FT   CDS_pept        442739..443671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0381"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   rme:Rmet_2705 undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50812"
FT                   /db_xref="GOA:C8W9M4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M4"
FT                   /inference="protein motif:PRIAM:3.6.1.27"
FT                   /protein_id="ACV50812.1"
FT                   /translation="MESAILWIEALKSALFGVVEGITEWLPISSTGHMLLLNQFLPLNV
FT                   SEDFWNMFLVVIQLGAILAVCVGFFHKLNPFSPKKSKEEKRSTWKLWAKVVVSCVPAAA
FT                   IGLPLNDFIEEHLGSPFVIAATLIFYGIIFILLELHREKVAATVKVEAPRGKHMRPDAG
FT                   ASLKASSADDLARVKDIDNLDWKTALGIGVFQVLAIVPGTSRSGATILGGLALGCSRAV
FT                   AAEFTFFLAIPTMAGASALRLVRYFMKGNTFTTPEALILSVGCLVAFIVSLIMVRALMG
FT                   YVRKHDFKPFGVYRIILGIAVIAYFLLVK"
FT   gene            443825..446263
FT                   /locus_tag="Apar_0382"
FT   CDS_pept        443825..446263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0382"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bcr:BCAH187_A0377
FT                   ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50813"
FT                   /db_xref="GOA:C8W9M5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M5"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACV50813.1"
FT                   /translation="MQIDLEGLNPAQHQAVMTTQGPLLVLAGAGSGKTRVLTFRIAHMI
FT                   ADEGVRPWQVLAITFTNKAAAEMRERLEALLPNNIRGMWVCTFHAMCVRLLREDGDRLG
FT                   YGPNFAIYDDDDSKRLVKAILSDLDIDVRQFPLNSIRSKISAAKNALLYPDDVEAQAAS
FT                   PMDHVVARVYRALQTRLDKANAMDFDDLLIKAFELLSKYPDVLAKYQERFRYINVDEYQ
FT                   DTNGVQYAITKLLASKYRNLMVVGDDDQSIYSWRGADIKNILAFEKDYEEAVVVKLEQN
FT                   YRSTGHILAAANAVVAHNSHRKPKRLFTDEGDGEKIQVYQASDERDEGAWIGSEIEKLH
FT                   DKGMSYDSIAVFYRTNAQSRILEDMLLRAGVPYKIVGGTRFFDRAEIRDVMAYLKVVVN
FT                   PDDDMAAMRVINTPRRGIGATSIQKIQTYALHNGLSFFSACEACVMEESLLTAKVRNAL
FT                   VEFTSAIEHGRHIDGELDEVVEAIIDRSGLIRALEAEHTIEADGRIENIREFFGVAAEF
FT                   DESHDDVEETLESLQQLREAGVLDAQDAASLNATGFNAATGTLSSVAVSPTPTSQEENL
FT                   HPQVVAEKLPAFMEWLALRSDLDSMDGSTSAVTLMTIHSAKGLEFPAVFVAGMEEGIFP
FT                   HANYEAEAAQLEEERRLAYVAITRARKRLYLTYASTRRTYGSVQANPVSRFVGEIPQEH
FT                   VKAIGVGSAGFSGVGWAKRGDRHGTFGSGRGSEVYGGNVFGSRTRSTGGSQAPRPAPIQ
FT                   KDPVRASASFAVGDQVSHKTFGPGIVLAVQGDTIEVKFTRTNKTKKLMKGFAPIVKIEG
FT                   "
FT   gene            446266..447048
FT                   /locus_tag="Apar_0383"
FT   CDS_pept        446266..447048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0383"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pha:PSHAa0396 mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50814"
FT                   /db_xref="GOA:C8W9M6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M6"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACV50814.1"
FT                   /translation="MMLMHDGLILDLTPQDFIFKAVIFVVVFFIAFLIEHFAVKLSKKA
FT                   LDSSKLPSASIFVNIIRGIIWAFAILAVLQPVFGIQPTAFVTALGVTSIAFSFGLQDTI
FT                   SNLVGGLGLMLGGVVKPGDQVSIGNISGEVIDMNWRTTIVRDRGGKVDIIPNSVLNKTA
FT                   LVHRTRWDVTEVPVTIVLKPSADLDVVTQEIIETIKETVASQLDRTFPIEVEAASIADT
FT                   GITVIIHVHIKDDANDMSVRDKIVRALAGSSWLAGVGA"
FT   gene            447050..447748
FT                   /locus_tag="Apar_0384"
FT   CDS_pept        447050..447748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0384"
FT                   /product="Adenosylhomocysteine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   bha:BH3238 5'-methylthioadenosine/S- adenosylhomocysteine
FT                   nuclosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50815"
FT                   /db_xref="GOA:C8W9M7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M7"
FT                   /inference="protein motif:PRIAM:3.2.2.9"
FT                   /protein_id="ACV50815.1"
FT                   /translation="MKIGIIGAMEPEIALLKEQMTIERTYEQAHMQFVEGLLGEVPVVV
FT                   VQSGIGKVNAAACTQILIDTFAVTHVINTGIAGLLSPELQVGDIVISSDLVQHDMNVGP
FT                   LNYAAGQIPGLPVFSFKADESLVEHALTSVQEVAPELQVISGRVASGDQFVSSSELADH
FT                   IYTTFGADCCEMEGASIAQVAWLNHTPFVVIRLMSDKPGTTSSVDYLTFERESSERSAQ
FT                   ITAAIIKKLS"
FT   gene            447899..448948
FT                   /locus_tag="Apar_0385"
FT   CDS_pept        447899..448948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0385"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: sfu:Sfum_2275
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50816"
FT                   /db_xref="GOA:C8W9M8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M8"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACV50816.1"
FT                   /translation="MITLGHFFEMIVANPFLALVIVLVFGCIFVNGATDAANAIAEAVG
FT                   TRSIKVNNAIIMSVVCNFIGLVAMCLISTAVADTILGMVDFGSNDHEALVALAAGCVGI
FT                   VTWAVGAWALGIPTSESHALIAGLTGAALAIHGDFGAVNWGEWSKVLIGLFFSTTLGFA
FT                   AGWIIVKAINKLCVNVNRQHADEMFGHLQVVGSAFVAAMHGAQDGQKFMSIAMLAIALS
FT                   AGHGVAGADAFPLWLQVLCAALMSIGTAIGGRKIIKKVGMEMVKLERYQGFAASFSASA
FT                   SLLLSTLTGLPVSTTHTKMTAMMGAGAAKNIRSVNWGVAKEMVAAWVFTFPGCGLIGFL
FT                   FAKLFLMIF"
FT   gene            449008..449628
FT                   /locus_tag="Apar_0386"
FT   CDS_pept        449008..449628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0386"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   glo:Glov_0586 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50817"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9M9"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACV50817.1"
FT                   /translation="MLGKPKEDVFYTMFREFGDKIVETAEEYAVIMEGYPETAARIPQM
FT                   KVYERECDEKVQHIMKELYASFVTPFEREDISDLALRLDDIVDGMNSVAERLDLFNVDD
FT                   TRKEAMQLAELTLRACKTVQEMLSILSDYKKDPTVMEKAIAVGHVEDEGDLIYHNALSR
FT                   LFRDEMPGRHTVAWLRIFDRMETVLDSCDDAAGVVRSVVMKNA"
FT   gene            449752..450447
FT                   /locus_tag="Apar_0387"
FT   CDS_pept        449752..450447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50818"
FT                   /db_xref="GOA:C8W9N0"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50818.1"
FT                   /translation="MSGFKRFCYILYVLASVFVFLALALTWFGSWTHQATSLLFTKPYL
FT                   IALNVCAAISIFGLIVVLFRALFIRKTVKLIVATVEGGTISVTKDAISSQAAHIIEEDG
FT                   TCLAHRVNVKISKNNSVSVQVDILPKEPVDVTAKGSEFYSALQSGLAIVCGPCVSDINL
FT                   SFIKPSSFSPKDEEGTSLLQSKDVVAKSEIVEEQACDQLSEQASAQQTGKDIRLSISEP
FT                   EAKEVKDNG"
FT   sig_peptide     449752..449850
FT                   /locus_tag="Apar_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.504 at
FT                   residue 33"
FT   gene            450440..450682
FT                   /locus_tag="Apar_0388"
FT   CDS_pept        450440..450682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50819"
FT                   /db_xref="GOA:C8W9N1"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50819.1"
FT                   /translation="MDKSFFQKMQEQCKKYVLDHPGAIIGGFAGLLFAILLFTFGLFKM
FT                   LIVVLFVLVGVAIGQIFDGKATILAKIRSLFTDRN"
FT   gene            450696..451184
FT                   /locus_tag="Apar_0389"
FT   CDS_pept        450696..451184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0389"
FT                   /product="protein of unknown function DUF322"
FT                   /note="PFAM: protein of unknown function DUF322; KEGG:
FT                   bha:BH2786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50820"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N2"
FT                   /inference="protein motif:PFAM:PF03780"
FT                   /protein_id="ACV50820.1"
FT                   /translation="MAEELTNSQETTSEEIIPAEETTDVLSDADLEDTDSLTFSGGVVE
FT                   KIVSLALRDVPNVVGARGNWLNRVQDVLGASDTAKGVTVEVLPDSSLNVTVSVLIKYGS
FT                   YAPQIFEDVKHTIVEKITGMTGLEVSGVSLRIEDVLTDEEYDRLKQRPEEPEQLDKEE"
FT   gene            451397..452161
FT                   /locus_tag="Apar_0390"
FT   CDS_pept        451397..452161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0390"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bce:BC2521 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50821"
FT                   /db_xref="GOA:C8W9N3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N3"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACV50821.1"
FT                   /translation="MELKADKKVIVERNNKVVYDNGDTVVKVFSGSKPSADILNEALNL
FT                   TRAEQAGINVPSLVEISKVGNCWAISTRKVEGKTIRQLIEEHPEKEDEYLNKFVNIELA
FT                   IHAHKAPLLTRQKDKFTRMINSIPDILDEATRYELLLKLDGMKPHTKVCHGDFVPSNVI
FT                   LAEDGAPVILDWAHATQGNGAADCATTYLHLLLHGDEELAEKYINLYCTKQGCTRQYVN
FT                   EWLGIIAAAELARGRVKETEFLLKWVNVFDAM"
FT   misc_binding    452381..452492
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 65.57"
FT   gene            452514..453287
FT                   /locus_tag="Apar_0391"
FT   CDS_pept        452514..453287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0391"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: prw:PsycPRwf_1445
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50822"
FT                   /db_xref="GOA:C8W9N4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV50822.1"
FT                   /translation="MKKLSQFALQVISLTSFLALWQLVIVVGIIPNYLVPTPIQVVFAL
FT                   VKDFQLLMTHTGITLLESFVGLAIGVLIGFLLAVFMDFFKTLDKLLSPLITISQTIPVV
FT                   TIAPLLVLWLGYGLLPKIVLVAISTFFPITVALNSAFKAIDPDMVDLMTTMGATRMQVF
FT                   WHVKLAAAAPQFFSGLKMSVTYAVIGAVIAEWLGGDAGLGVYMTRVRKAFAYDRMFAAI
FT                   VVVSALSLVLMKLVELIQKCALPWDTSQNVKESAK"
FT   gene            453323..454378
FT                   /locus_tag="Apar_0392"
FT   CDS_pept        453323..454378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0392"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   prw:PsycPRwf_1444 NMT1/THI5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50823"
FT                   /db_xref="GOA:C8W9N5"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N5"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACV50823.1"
FT                   /translation="MNASNCKSMTRKGFLAAMGFSTAGFCAGCSLEQPSAPSNGGNNGT
FT                   GQNTGGTTEITFALDYTPNTNHTGIYVAQEKGYFDEVGLKVTIQQPPADGADALIGAGG
FT                   AQMGVTYQDYIANSLSSSNPLPYTAVAAIIQHNLSGIMSREDDHIVRPRDLNNHTYATW
FT                   NLPVEQATIRSVIESDGGDPSTLKMVPYEVDDEVSGLKAKMFDAVWVYEQWAVQNARVQ
FT                   NFAYNYFAFSAIDQNFDYYTPVIAANDDFAKKNPDAVKAFLSATRKGYEFCVSNPDEAA
FT                   EILLKAVPELDADLVKASQKFLASKYIDDAEKWGVIDSARWQRFYNWLNNQKLLENKID
FT                   PSAGFTSEYLG"
FT   sig_peptide     453323..453421
FT                   /locus_tag="Apar_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.568 at
FT                   residue 33"
FT   gene            454410..455255
FT                   /locus_tag="Apar_0393"
FT   CDS_pept        454410..455255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0393"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: prw:PsycPRwf_1443 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50824"
FT                   /db_xref="GOA:C8W9N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50824.1"
FT                   /translation="MGALGEKSPEAAPAHESQQSAPALEAQNLTLVWGNGQVVAKDISI
FT                   ELQPGTITCLVGRSGCGKTTLLHALAGLLQPQEGKVLLHGADITGHPGHIGYMLQKDLL
FT                   IPSKRIIDNVALPLELKGIPRFEARQKAQEMLERGGLERVAQSWPHELSGGMRQRVAFL
FT                   RTALIGSDIMLLDEPFSALDALTRREMRAWLMSSVKEFGFSVLVITHDVDEAVAMASRI
FT                   YVMAGSPAQGVVTKIVGFVEPQDCVETVDTDSSQDADLASFDLSDEFLAAKREVLLLLG
FT                   "
FT   gene            complement(455391..456812)
FT                   /locus_tag="Apar_0394"
FT   CDS_pept        complement(455391..456812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0394"
FT                   /product="peptidase M18 aminopeptidase I"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   ppr:PBPRB1552 putative aminopeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50825"
FT                   /db_xref="GOA:C8W9N7"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N7"
FT                   /inference="protein motif:PFAM:PF02127"
FT                   /protein_id="ACV50825.1"
FT                   /translation="METTNAWKKYTSQDLDKLQSFTEGYRNFISKNKTERECAASAIKL
FT                   AEAAGYVKLSDAITAGKTLKAGDKVYADIRGKSVIFIQIGTKSLEEGLNILGAHIDSPR
FT                   LDVKQNPLEERNELATFDTHYYGGVKKYQWVTIPLAIHGVLALKNGSVVNVCIGEDPTD
FT                   PVFCISDLLIHLSAEQLGKPASKVIEGEMLDLIVGNRPLIWGQNGEKPADIEGDEPKEA
FT                   VKANVINILKDLYGIEEADLLSAELEIVPAGPARDMGFDRSMILGYGHDDRSCSYPSLI
FT                   AQLECNAPARTSVTILTDKEEIGSVGATGMNSLFFENVMAEILALAGFESPLSLRRCMA
FT                   NSYMLSSDVSAGYDPNFASSFEIKNSAIMGHGLAFNKFTGSGGKGGSNDADAEYVALIR
FT                   RIMDNAGVQFQTAELGRVDAGGGGTIAYMLAKYGMHVIDCGVPVLSMHAPWEIANKADI
FT                   YEAYRGYRAFLEFNE"
FT   gene            complement(456914..457858)
FT                   /locus_tag="Apar_0395"
FT   CDS_pept        complement(456914..457858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100021983"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50826"
FT                   /db_xref="GOA:C8W9N8"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50826.1"
FT                   /translation="MSYKHFDADKTRFASPAQPTNEAGNEKPSLFKGVSITQILATSLA
FT                   AVTSFMLSNQIGVAGSIIGVAVGAAASAFASQIYQNVIRRSTHKFRSSDNNEYDQQVYP
FT                   NSNQSTLENTQYMPQPQYAPSHNYYPNTASHAGQPSRVNRTPTVSRKHTRALTVVTILS
FT                   IIFTITAVILYAMFLNFITNGSGLGPKVSTSSVVTEKTADTSNSTDKKDDSNSSSEKTD
FT                   ESSKSTDSKDSSETSDSKKSETTSSDSSSSSEKKSDSNNSSNSSNSSDNSSSNNSGTDN
FT                   SSSNSESNQNSNSGNSSNSGSNSSGSSSSTGSN"
FT   gene            458165..459037
FT                   /locus_tag="Apar_0396"
FT   CDS_pept        458165..459037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0396"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: bcy:Bcer98_3856 fructose-bisphosphate
FT                   aldolase; TIGRFAM: fructose-1,6-bisphosphate aldolase,
FT                   class II; ketose-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50827"
FT                   /db_xref="GOA:C8W9N9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9N9"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ACV50827.1"
FT                   /translation="MLVSAKAMLQSAEKGHYGIGAFNENNLEWAAAILDAAEELQSPVI
FT                   IQCTSGAAKWQVSYRVVADMVRRLVEDKNITVPVALHLDHGSYEDAFKCIEAGFTSIMY
FT                   DGSHEPNFETNLKRTEEVVKAAHAKGISVEAEVGGIGGTEDGVTAKGELADPEQCAKIA
FT                   DLGVDFLACGIGNIHGIYPANWEGLSFDQLKAIKERVGDLPLVLHGGTGIPVEQVQKAI
FT                   SMGISKINVNTDLQLVFAEATKKYVEAGLVDTGKGYDPRKLMKPGREAIVERTKELIRE
FT                   FGSDGKAWN"
FT   gene            complement(459292..459744)
FT                   /locus_tag="Apar_0397"
FT   CDS_pept        complement(459292..459744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0397"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   pat:Patl_1237 BadM/Rrf2 family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50828"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P0"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACV50828.1"
FT                   /translation="MAGMFSTKGMYALRAMADLAVHEGWVSLGDVSERQNISRKYLEQV
FT                   IALMHKAGYVDSLRGKGGGYRLTRKPEDYTLGEILRAAEGNLAPASCLNCTNTTLCPQM
FT                   ESCTTINIWRDLGRMTSSFLDSKTLADIAHNEGNMHVSPTENPTAE"
FT   gene            complement(459746..460273)
FT                   /locus_tag="Apar_0398"
FT   CDS_pept        complement(459746..460273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0398"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   lpc:LPC_2694 nitrogen fixation protein (Fe-S cluster
FT                   formation) NifU"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50829"
FT                   /db_xref="GOA:C8W9P1"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P1"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ACV50829.1"
FT                   /translation="MAVNDLYNAEFMDHVSHPDYKYQMDNPTVSHAGVNPSCGDELTFS
FT                   VRIEDGKIAEAAFVGSGCAISQASADIMSDLMIDRTPEEAIELCKLFGRMIRGEETDEA
FT                   VLDKLEDANILHDIAHMPARVKCAELAWHTLEEMLEAHNNGSTAAGTSTTEDNSANAND
FT                   SSADSEYAKGGE"
FT   gene            complement(460274..461563)
FT                   /locus_tag="Apar_0399"
FT   CDS_pept        complement(460274..461563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0399"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; KEGG: bcy:Bcer98_3577 SufS
FT                   subfamily cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50830"
FT                   /db_xref="GOA:C8W9P2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P2"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ACV50830.1"
FT                   /translation="MTDTEVAQITDNPYKADFPILAANPKVAYLDSAATSQRPRVVIEA
FT                   QSRFYETMNANALRGLYRWSVDATAAIEDARASIAKFIGAVDKNDKPESQQIIFTRNTS
FT                   EALNLVASSLGRYALKPGDDVVISIMEHHSNIIPWQQICKATGANLVYLRMNSQYQITP
FT                   EEIASKITERAKIVSVTHVSNVLGTRNDIKAIAKRTHAMGAYMVVDAAQSAPHILVNVH
FT                   DLDCDLLAFSAHKMCGPMGIGVLWGRAELLNAMPPFLTGGEMIDSVTETGAVWAPVPEK
FT                   FEAGTQDAAGIYATGAAIKYLNGLDMAKIEKREELLARYLVQQLCTLDFVDIVGSKLGQ
FT                   NHVGAVAFNVRGVHPHDVSSILDMNNVCIRAGHHCAEPLLIELHESSTCRASVAFYNDK
FT                   HDIDQLIEGLNQVWKIFGSAVNTKQNKELK"
FT   gene            complement(461563..462702)
FT                   /locus_tag="Apar_0400"
FT   CDS_pept        complement(461563..462702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0400"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: bha:BH3470 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50831"
FT                   /db_xref="GOA:C8W9P3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P3"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ACV50831.1"
FT                   /translation="MDNVLINRANVPAAQTWNRLNANSLSVTVPNHADAGKVYLPLPRL
FT                   FERIECGMGQEVTDYVESQVFKSDFYNVPAHTKREEPIVVAVSAAQKQCANTGIIVREG
FT                   AEAIVVIAAFAGEKSTDAASNNALPTSAALTRIVVEAGAKLHLIEMLGVNEDQQHLESV
FT                   GLEIHQDATVDVKQYALGGSTIGLGLTANLVGARARLDLNNRYHATHKETLDINHLVRM
FT                   RGTSTRAQLTESGVLNEAAKKTLRATIDLVRGAKDAQGNEIETVMILGDDVVNKTMPVI
FT                   LCDEDDVAGNHGATIGSVSPDQLDYLAARGLSRQAAEQLFVRALFEDAIINAPEEISHR
FT                   VAVERCEAELGAEIAHDYDEAAANDNSSSEANSNKGGVA"
FT   gene            complement(462702..464120)
FT                   /locus_tag="Apar_0401"
FT   CDS_pept        complement(462702..464120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0401"
FT                   /product="FeS assembly protein SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD
FT                   protein; KEGG: bcy:Bcer98_3575 FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50832"
FT                   /db_xref="GOA:C8W9P4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P4"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ACV50832.1"
FT                   /translation="MSEKKRSEVADVDRSLYDFTKSEEGYERYDDGLTPEIVRAISEKK
FT                   EEPEWMLQMRLSALETYHQRQMATNWGPSIAGLDLNHISTYVSPKTQQANSWDDVPEDI
FT                   RDTFDRLGIPQAEAESLAGVGAQYDSEIVYHNMREEVAEQGVIYTTIEDALHDSQWEPV
FT                   VKEYFGKLIPPSDHKFAALHYAVWSGGSFVYVPKNVTLDYPLQSYFRLNAQGAGQFEHT
FT                   LIIVEEGADLHFIEGCSAPKYYAANLHAGAVELFVKDGARLRYSTIENWSKNMYNLNTK
FT                   RAIIGSNAKMEWVSGSFGSHVSYLYPSTIMNGDSSNCEFTGITFAGATQDLDTGCKVII
FT                   NGSNNSANVDTKSISKDGGVNTFRSAVTVGRKAENARVAFSCQSLMLDNISRSDTIPEM
FT                   DVRNSTAQIGHEATIGRISDDTVLYLMSRGCSEAEARTMVVNGFANPVSKELPMEYAVE
FT                   MNNLIKLEMEGAIG"
FT   gene            complement(464120..464887)
FT                   /locus_tag="Apar_0402"
FT   CDS_pept        complement(464120..464887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0402"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC
FT                   transporter related; KEGG: oca:OCAR_6000 FeS assembly
FT                   ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50833"
FT                   /db_xref="GOA:C8W9P5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P5"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ACV50833.1"
FT                   /translation="MATELLRVNGISAGTEEKSILHSIDLSIGDGQAHVLMGPNGAGKS
FT                   TLGRVIMGDPTYKITDGSLIFNGEDVTELAADKRSLAGIFLSYQAPVEVPGVPLYSFLR
FT                   TITQMRPELKMTARQFRQRVGQISDQLELDQGFLMRELNVGFSGGEKKKVEMLQLLLLQ
FT                   PKLAILDETDSGLDVDALSVVSKGIQAYRETCDGSLLIITHNTRILERLEIDRTHVMVK
FT                   GHLVADGPADLINQIDHEGFEHFENQTDEGGAN"
FT   gene            465219..466529
FT                   /locus_tag="Apar_0403"
FT   CDS_pept        465219..466529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0403"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: ade:Adeh_1510 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50834"
FT                   /db_xref="GOA:C8W9P6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P6"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ACV50834.1"
FT                   /translation="MGQRIQGTEDLYGGYMRSWEHMQDVARHLFGTYGFDRIETPALEQ
FT                   VDTFVHGIGESTDVVRKEMFRVFSGALLDDLLAAGNESGLKPRQRMAMRPEGTAGVVRA
FT                   AVEHNFVPQGGTPAKLWYAEAMFRGERPQKGRLRQFHQVGVEWLGASDPAADAESIIML
FT                   MKFYEQMGFSPANMKLMINSMGDAECRPAYREKVKQFILDHKDQMCEDCLERAEINPLR
FT                   AFDCKNEGCHAVMKDAPLISDNLCDDCRTHYEQVKAYLDAAGILYIEDPTLVRGLDYYT
FT                   RTVFEVEIPNAGVGAIGGGGRYDGLVELEGGKPTPGVGFAVGFERIMLALEALGVSAEP
FT                   AAPSCVYVACAGAEQAPVVFDAVLALREAGIRCEADRTGRSLKAQFKQADKMGAALCVV
FT                   IGPDEVEAGVVTLRDMESHEQVQVPSDQLVAEVKARQ"
FT   gene            466619..467116
FT                   /locus_tag="Apar_0404"
FT   CDS_pept        466619..467116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apa:APP7_1560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50835"
FT                   /db_xref="GOA:C8W9P7"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50835.1"
FT                   /translation="MRMDRRVKHDIEVRKKAAELFDAGMGSRAVASTLSVPLPTVKVWQ
FT                   HIYHAFGSEVLLTMDGKQAKYTYEQKVAAARAVIEGGMTKTEAMAKFKIMSLAPLERWC
FT                   RLYRTGGAEALKPKPKGRPKGSKSKPQKRTREQELEERCLRLETEVAYLKKLRALVEKG
FT                   EL"
FT   gene            467169..467987
FT                   /locus_tag="Apar_0405"
FT   CDS_pept        467169..467987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0405"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   apj:APJL_1896 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50836"
FT                   /db_xref="GOA:C8W9P8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P8"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACV50836.1"
FT                   /translation="MLSTGVLRTCKGYLLLRTSAPSKANTPRATPRGCRDFSRTTNGCG
FT                   HRQIAMCLRAELGVRIADKTVLKIMREMGVRCKIRRETDYHRYSSYKGVVGKTFENVIG
FT                   RNFSTDSPWKKMGTDVTEFKQAWGKAYFAPIYDFGSKEIVAWSTAKNPNMVQQIALLDQ
FT                   LLSKIPEGRTPILHSDMGWQYQHSTWCRRLKDAGVVQSMSRKGNCIDNGATEQVFGHMK
FT                   DEFFRGRTWPNFESFKADLDAYVMYWNTQRRQVKLKGLTPEEFRNQSLVA"
FT   gene            468232..470397
FT                   /locus_tag="Apar_0406"
FT   CDS_pept        468232..470397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_1389 bacteriocin-associated
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50837"
FT                   /db_xref="GOA:C8W9P9"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50837.1"
FT                   /translation="MKRAYRFIVSIIVVLIALSSFLVGKGFLEIFISREFDAWLSNQPQ
FT                   IYTSQMSNETKETFVSVVRSYAQTHKMILITKKTESITEGPRILTVGVLSSQGNKVNSF
FT                   NSFDVLGTQVINGQKINELLEHSPESYLGYGMDTNNKVGDLPYVLGSVYFKLDQITPGY
FT                   NLGNSCAVLGLSPGEFDELVSQISEATGLHKEKFITNYSGSAVEIGLFYYVAGVTFIIL
FT                   SISFCLLTYYNSLQELKKLGVHVMLGWSKSDYVVHHYFFYCSLAAVLLPLALIWTIVNC
FT                   SGFNITGRFLLFTFTTALPSILVVVISVLISAAPLLTIRPVDAILGRLSQKGLYILTAI
FT                   IYALCCVVVFAGSIYMDAPITMYSNLLSTQENWSIYKDWYIVRNHVVQGNFFNGRPMDK
FT                   SKELFDWYKDHEHDKGVYIAHVNHIGEATLNAYGINSAILKPFDALIASPSYLKEIGVA
FT                   LTDEQVKKAENGTRIYLVPRSYSEEQKSLLRELVSRSDKIFESDIVTPYMQNPSSEFIE
FT                   YDASGGFFTWSTSIDSPSISTNIVVKVVTSNNMIPSESESLVATGLDNSYIKLSPEAAS
FT                   SLLDSSGIVELSDDGFGTQFNSIESFIKDYRKSLQELFLLFGVVIVLMFAAITVIQISM
FT                   ISIVQRLNERKIAVECMLGFGIYKQYINIFLLVNLIAFVGTLCMIVIGSTLGIIMGCLM
FT                   LLISNLTISISANRSTMKIVLENLSKE"
FT   sig_peptide     468232..468306
FT                   /locus_tag="Apar_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.874 at
FT                   residue 25"
FT   gene            470400..471053
FT                   /locus_tag="Apar_0407"
FT   CDS_pept        470400..471053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0407"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH0281 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50838"
FT                   /db_xref="GOA:C8W9Q0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50838.1"
FT                   /translation="MYTFLKVDALNKSFGSNTVLHNISFEIQSGESVALVGPSGCGKST
FT                   LLNIIGLLETLDSGIISLEGRAYPSINSKKATLMRRTEINYLFQSFALINDWKVSKNLL
FT                   LALQYTKLSKQEQERLIRTALESYGIGEKYDAVVNELSGGEKQRVAIARAMIKPGNLIL
FT                   ADEPTGSLDKAMATIVIDSLLDSVHANHKTLLMVTHDMNIAQRCDRIIELPKHQ"
FT   gene            complement(471129..472562)
FT                   /locus_tag="Apar_0408"
FT   CDS_pept        complement(471129..472562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0408"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; KEGG: sit:TM1040_2159
FT                   Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50839"
FT                   /db_xref="GOA:C8W9Q1"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q1"
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /protein_id="ACV50839.1"
FT                   /translation="MVELIVLSAFAVMLIVGTVLSFPLTSILTAGFFLFFGYGLSRKIS
FT                   PKKLLMAAFKSVWEVKTIIALFAVVGAMSAAWRAAGTIPEIVSISASLISPSIFILATF
FT                   LLCTMMSMLLGTAFGTAATMGIICMSIGKAIGASEFFIGGAVLAGSYFGDRCSPMSTSA
FT                   ILVSQLTDTNLSKNINRMLRTSVVPFIVACVIYVAWDFFMANTGTIPDVTGLLSRSFRL
FT                   SLISLTPALLVIVFSLLKVDVIVTMTSSLVLACILCVTIQRVPLADLPIILLFGLRAPG
FT                   ATVANMVNGGGIFSMTNVLMIVTISSSYAGLFQTTGLLRRMCQLVADLSDSSTPFFGVL
FT                   ITSMFTSMVSCNQTLAIMLTNDLCENAENSSSALALDIENSAVILAPLVPWSISNISVL
FT                   SAIGAPSMSLLAASFLYLLPLWTLGISLWLHRRPAKIDGHRARWLGLTSDDVRSCTWPR
FT                   VQETESADSVESLPAAKVA"
FT   sig_peptide     complement(472497..472562)
FT                   /locus_tag="Apar_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.847 at
FT                   residue 22"
FT   gene            472679..473620
FT                   /locus_tag="Apar_0409"
FT   CDS_pept        472679..473620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0409"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: plu:plu0110 DNA-binding transcriptional
FT                   regulator CynR"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50840"
FT                   /db_xref="GOA:C8W9Q2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACV50840.1"
FT                   /translation="MNFQTMDYFVAVAEEKSFTKAAERLSVTQQTLSANIAAAEKELGS
FT                   KLLERTVPLSLTFAGEEFLRYARRFQAQRRAMDQEFLDIAGNERGRLHVGVTATRGHII
FT                   MPRSIAAFQKLHPNISIELDEGENDELVEWLSEGQLDLIVATVNSASYDLVIQKLFDEK
FT                   IVLVVSQALLESLYADKVDSVVSQVKRTGKLTALEACPFLTVGKRDIAGSFARHAFAAS
FT                   GISPTIKVMSRNSETLLALAMRGVGACFLPSELVASSYYDFETSGLHIIELGKEMSYSV
FT                   SVAWRRTDHVWSAIESFAQVLSEHRYVVKRSE"
FT   gene            473622..474362
FT                   /locus_tag="Apar_0410"
FT   CDS_pept        473622..474362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0410"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: bcy:Bcer98_1014
FT                   RluA family pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50841"
FT                   /db_xref="GOA:C8W9Q3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q3"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACV50841.1"
FT                   /translation="MDTLQTNSNLEFLYQDDYLLAVNKPAGMIVHSDGTNEPSLTDLVC
FT                   EKLCALESSNKIDLSQVQALNRLDKETTGIVLFSLKKETQPQFDQLIASKELSKEYLAV
FT                   VKGDFGLNKLLIDKAIGKDRHDAQKMRISDTGKPSQTEVRLIKVASSAQGQIQSLLLVN
FT                   LLTGRKHQIRVHLSSLGFPLVGDVLYGGMSSLQRKTKKKHRPQPLMLHAYRIGFIHPVT
FT                   GAKIVIKTDIPERFSNFGVLEKDL"
FT   gene            474447..476042
FT                   /locus_tag="Apar_0411"
FT   CDS_pept        474447..476042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0411"
FT                   /product="Ferredoxin hydrogenase"
FT                   /EC_number="1.12.7.2"
FT                   /note="PFAM: hydrogenase large subunit domain protein; 4Fe-
FT                   4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dps:DP2379 hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50842"
FT                   /db_xref="GOA:C8W9Q4"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q4"
FT                   /inference="protein motif:PRIAM:1.12.7.2"
FT                   /protein_id="ACV50842.1"
FT                   /translation="MPGTMRGVYTNLTEIRRKVFKEVSTLAYEKADKSVDEIARQMEEL
FT                   PYKIIPGDIATYRESVFLERAIVGERIRMTMGMPMQGVDQPENISDGLEEASRPEVYYQ
FT                   PPLINIVKFACNACEDNVYRVTNACQGCLAHPCREICPKEAISFVDKKAYIDQEKCIQC
FT                   GMCFKVCPYQAIHHHVRPCAAACGMDAIGSDEHGRADIDYEKCVSCGQCLVNCPFGAIA
FT                   DKSQIFQVIQAINEGYTVVPIVAPSFVGQFGKGSVGRLREAFKEMGFAEVEEVATGADL
FT                   CTVQEAEDFVKEVPDKLPFMGTSCCPSWSAMAKKEYPEHADAISMALTPMVLTARLVRK
FT                   QNPESKIVFIGPCTAKKLEALRRSVKSEVDFVLTFEELAGMMESKGIDYTKLDDDNSDF
FT                   ENASHDGRAFAVAGGVAGAVVNVIHQKYPDKEVPIMAVDGLAECRAMLKDAVKGKYPGY
FT                   LLEGMACPGGCVGGAGTLSAVNRAAAAVKRYAKTASSEFASANKYNNLIPELAGTVSAE
FT                   VEIAEVLEVQKPVE"
FT   gene            complement(476189..476497)
FT                   /locus_tag="Apar_0412"
FT   CDS_pept        complement(476189..476497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50843"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50843.1"
FT                   /translation="MGKKSSEVLQISYEDLAEYLHSNHSVYMQVGNQVYYLTDVNYESW
FT                   RAQDTSIRNSKNHFVDCSELVPTVDEFLTLPFINGKTIKDVFSHATFYASLKNEKSE"
FT   gene            476774..478741
FT                   /locus_tag="Apar_0413"
FT   CDS_pept        476774..478741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0413"
FT                   /product="Glucan-binding protein C"
FT                   /note="PFAM: Glucan-binding protein C; KEGG: similar to
FT                   GTPase, IMAP family member 4"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50844"
FT                   /db_xref="GOA:C8W9Q6"
FT                   /db_xref="InterPro:IPR013574"
FT                   /db_xref="InterPro:IPR036234"
FT                   /db_xref="InterPro:IPR041324"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q6"
FT                   /inference="protein motif:PFAM:PF08363"
FT                   /protein_id="ACV50844.1"
FT                   /translation="MKRVSTSSFTRVAAVSLSLLLILTLFPLNPVKAYATDPAKGIEVR
FT                   EDASKLEASVAAAKAAGVDVQKDDDVDKGSVESSSDIDAKKSEIQDDYNKQSQDLDAIT
FT                   EEAKQKLADYATKKAAYDTAKAKYDADKAQYDADKAQYDADMIAYNKAMAELEQKKNED
FT                   GYMTKPYPQLLTFKSEPNAVLTLSGRKYTHDEFSAEVRSWNLGSEPWRYSYFDALNNGQ
FT                   AANAARVMLEKDKPFTATYTNLTNSSYNGKKISKVVYTYTYKGSSGVNVPNKLPVVLQK
FT                   DPTVTIWYNDFFGDARINVTVKFYDEDGNVIDPTGSLLSFSSLNRGNGSGAVDKDAIEK
FT                   VGYFNGEYVPISGSTIKPHADGSAYSDTNNAEKAYGSRFNTADWDTPTSPKAWYGAIVG
FT                   RVTSPEISFDMASHKSGIVWFALNSDIKAINVPTKPVEPTPPTPPAEEPEKPTFSARYH
FT                   LDVFYVKPQLEKKALSEDDKDINSNTVKTNSVVKFALNTTPFPAGHEKIDSVVFHDVLP
FT                   EGYEVNLEDTKKASPDYEVSYDEGTRTLVFTANASLLSQINADPTKEADVPAPVIVGKV
FT                   TKDGAVYENDFDIDINNTYTRSSNKVTVKTPEPPNPPKKRKKKAKTPYTGDAGVFSSIA
FT                   LCTGSIAVLGGSWFIKKKKK"
FT   sig_peptide     476774..476881
FT                   /locus_tag="Apar_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.701 at
FT                   residue 36"
FT   gene            complement(478840..479493)
FT                   /locus_tag="Apar_0414"
FT   CDS_pept        complement(478840..479493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0414"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: dal:Dalk_1233 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50845"
FT                   /db_xref="GOA:C8W9Q7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACV50845.1"
FT                   /translation="MSYKAAVFDLDGTLLNTIDDLAWATNYALKQFNMPTYTVDEVRQM
FT                   VGNGVAKLIRDAVPEDTDDATYQQVLACFKEHYADHSLDNTVPYPGILDAIDILKAAGV
FT                   KCAVVSNKPNFAIADLMKNFFPGRFDFALGQRNDLKRKPDAEPVHYTLAQIGVNPKDAV
FT                   YIGDSEVDVKTAQNSNMPCISVTWGFRDKDTLLAAGATTLVDTADEMVQKILNN"
FT   gene            479696..479941
FT                   /locus_tag="Apar_0415"
FT   CDS_pept        479696..479941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50846"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50846.1"
FT                   /translation="MSDDFRKLVTALQSDYSLAIDFLDDPSCFLKNYQLNENEYKALST
FT                   SDFSLLAELCGSEQVAAGALSGAHSSLCTKTTPVIK"
FT   gene            479938..481440
FT                   /locus_tag="Apar_0416"
FT   CDS_pept        479938..481440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0416"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase-like
FT                   protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50847"
FT                   /db_xref="GOA:C8W9Q9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Q9"
FT                   /inference="protein motif:COG:COG1506"
FT                   /protein_id="ACV50847.1"
FT                   /translation="MSVIEQYNFYYLGTCKYCIFSSPEDILIKEILFFSVSDKKDSYCV
FT                   VTEMEGCRFNLIVYLNAFGYISWSFSFRVLDVFWVGSRICLMLENYFIIFDPILKKRMV
FT                   LTLPSYRIHKIISLDSSEYVYSTFSKSINYCSIVKHDIIINKDITIKEISCYGKEVKEN
FT                   IGNLNQNQQNAIDNFVSTLSIYGQVSFVGKINNAIVQFKYNRLNTEIVAEEKVRWTIPG
FT                   FIQSGGIFKSKLIILWSNFLNEPQLACLDEKQYDKFHFTNTSSISYCIDSSTLQPYYFV
FT                   GNKKSKDYVLFLHGGPTGQFVNRYDFLYKCLLETNCNLLFLNYIGSSGYTSEYQSSLVN
FT                   RGGKLDVKLIKEFIENFIKNYEINRLVVVGMSYGGYLSILLSKRFSTREFIKFVSISGF
FT                   CNVMFQYLFSSARNVILLYLLNDYEKNKYSIDPVYINFLDVKNLSFIHGLNDTYCPLEQ
FT                   IEQFCIKNNFKLSILKNLNHISMSLLDKLDVARILMKEMEND"
FT   gene            481701..482939
FT                   /locus_tag="Apar_0417"
FT   CDS_pept        481701..482939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0417"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   bcr:BCAH187_A4758 serine/threonine protein kinase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50848"
FT                   /db_xref="GOA:C8W9R0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R0"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ACV50848.1"
FT                   /translation="MFRAEDYLKNIEKDQLGIWAYPSDNIYDNLPTSGIKVHISAIPQN
FT                   SEYIFKAVYPFLQEKNLLFKVLVSDQILMRENSGEFGYSQLGKFITIYPKSENELVSIV
FT                   PALHILTIGFSSIRIPSDCRYTNDSIIYYRYGEFKSDENFIDNRLSTSTTKNLIPDDLK
FT                   YVQKELSIIKEFTPIKCIRARGKSCVYLGIMNCNRKIVIIKMWNHIGEGLDYSGFELFK
FT                   HEYKLLKSCEKLNSIPNMIDSFYYKDCYVIVEENMTGHLLQDFLLKEVSRKKRKLIMCG
FT                   IISELEKIVCNGFIPFDIAPSNLLLKGNKIKLIDFEFFRSIDEDLPTYNFGTPGFMHDN
FT                   VQPSRQFIFSLAMIDYYLQNSVQYKTLLENNEVNEDTKDYVYNKFSFILSKENTTSLED
FT                   CLRILKEYIEEER"
FT   gene            482941..483843
FT                   /locus_tag="Apar_0418"
FT   CDS_pept        482941..483843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0418"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: prw:PsycPRwf_0606 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50849"
FT                   /db_xref="GOA:C8W9R1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50849.1"
FT                   /translation="MKSIKFDDVSYHYHNSDKGIRNFSLEISKGEFIAVIGKNGAGKST
FT                   FLNLVAGLLKKYDGKITVEEEIPFRDVGVCLQKQSIDWYLNVFDNVYLGARLSGQTSSD
FT                   AKISTHKIINLLGLFEFKESLPDGLSGGQQQLVQVARALVHKPNFLILDEPTSGLDVIK
FT                   GDNLFKYLRKECDNRNCTVLVSSHDLGLLEEYCDQVLLIEDGKLKFFGRISDFFLQYSY
FT                   EKLARITFDGLLSPDNQRDLMSCCPFSIEENEMTISEDYFLKLPVLIGKLQKFVSIKNI
FT                   TFNNLTLRQIILEGSANEF"
FT   gene            483833..484621
FT                   /locus_tag="Apar_0419"
FT   CDS_pept        483833..484621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0419"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: pol:Bpro_0632
FT                   ABC-2 type transporter, NodJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50850"
FT                   /db_xref="GOA:C8W9R2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV50850.1"
FT                   /translation="MNFKKESFGLSSFVIVVETELNALKSNKHIIYSSLLTPILYYVFY
FT                   AIGIQSTFGDIYFHGQYMSFLSFAFAGILIMCLFQQMNQSVYRLVIDKRWNILPIKLES
FT                   GINPECYVLGISTLPFVVTLLQLIILLAISMITGMQISLWQVIGMFLFLCIFIVFWTSI
FT                   FSCIALLINDYKQRDFILSVVMTPLIFAAPLFYSLDNAPMILQVISRCNPLTYQLELIR
FT                   DILIGNLDWKMTFISIVISLLSLIIAGNVLKKVDYASGEH"
FT   gene            484803..486629
FT                   /locus_tag="Apar_0420"
FT   CDS_pept        484803..486629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0420"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); tRNA synthetase class II
FT                   (G H P and S); GAD domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: dal:Dalk_2756
FT                   aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50851"
FT                   /db_xref="GOA:C8W9R3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R3"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ACV50851.1"
FT                   /translation="MDCSAQITPNYSAHAAVDQHSMHTHTCGELRAEHIGQTVTLTGWV
FT                   WRRRDFGGLIFVDLRDREGLTQILFDPDVNADVFATAETIRPEWPVLITGTVQHRSEGQ
FT                   TNEALVTGEVEVLASKIDVLNTSAVPPFQIENHIDVNEDLRLKYRYVDLRRPQMAQNLR
FT                   LRSDFAFALREAFHKRDFTEVETPALFKSTPEGARDFLVPSRMQGGNFYALPQSPQLLK
FT                   QLLMIGGVERYYQITKCFRDEDLRADRQPEFTQVDMEMSFVREDDVMSELEDILGDAFA
FT                   KMGIEFPTPLRKIQYWDAMDTYGSDKPDTRIGMELHDVSGVFAQSGFKLFSSAANTEGQ
FT                   FVKAINVKGAGTWPRSQVDKLAEVAAGFGAKGLAWVAFKEDGSVGGPITKFFSPEELEA
FT                   LRAEMSAEPKDLILFAVGGRLETDEILGGMRLHMARVLEVPREGHDFLWVVNFPLFHWD
FT                   EETQSYASEHQPFTLPREEELDLLDTNPLAMGSYTYDFVMDGFEAGGGGMRIHNADLQL
FT                   KILEKLGFTEERAKAQFGFLMEALTFGAPPMGGFALGLDRVCMLLTGSDSIRDVMAFPK
FT                   TTSGSDLMSSAPSPVSNEQLKEVSLQTLPKEA"
FT   gene            486675..488477
FT                   /locus_tag="Apar_0421"
FT   CDS_pept        486675..488477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0421"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   bcb:BCB4264_A2400 ABC transporter, permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50852"
FT                   /db_xref="GOA:C8W9R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50852.1"
FT                   /translation="MNDVSVKENSPSARAELKVILDHFGAYKKDFVMSGLCVFTESLLE
FT                   LMIPILMAQIVDQGILQGNLQIVFVNGIVMVVFALLAMLAGIGYARYSAKAAMGLGAQL
FT                   RQDEYRRMEEFAFANLDRYDSSSLVTRLTSDVTIIQNAFAMGTRPFMRGPIMLVMGLVM
FT                   AFIMSPELAIVYFAVLPFLAIALFFIVKRVSPLYRVMQGAMDKLNEALQEDFAAVRAIK
FT                   AYVREGYVSERFEKVNTQYAQTATKTFGTSVLNLPIFQASMYVTNVAILWFGGQMIMAG
FT                   RLGVGELTGFMSYVLLIMNSLMMISGVFLLTARAITSVRRIGEILSEEPAIESPQNGLT
FT                   HVKNGAVRFENVSFKYSSDAEEDVLEDISLSFEPGSTIGILGGTGSGKTTLIQLIARLY
FT                   DATEGTVFVGENDVRSYNLVSLRDAVSVVLQKNVLFSGTVRDNLLWGDPNATDEELLHA
FT                   CSIACVDEFLDRIGGLDGDLGQGGVNVSGGQKQRLCIARALLKKPKIIIFDDSTSAVDT
FT                   ATDAKIRAGLAELADMTKIIIAQRVNSVMDSDQIVVLDNGRVHMTGTHAELLAKSPIYR
FT                   ELYESQMGGSQLDIDAAGKEVSHG"
FT   gene            488470..490290
FT                   /locus_tag="Apar_0422"
FT   CDS_pept        488470..490290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0422"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   bcy:Bcer98_1782 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50853"
FT                   /db_xref="GOA:C8W9R5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50853.1"
FT                   /translation="MANRAGGARPQNIGHTIRVFVSYLGHAKKRLMLVALLVSISGLAA
FT                   LLGTYMIKPVVAAVGRGDVNAFTNLIVFTAVVYAIGALTSVGYTQIMVRAAQRIVFDIR
FT                   RDLFEHIESLPLRFFDQRTRGDIMSFFTNDVDTISEALNNSFANLVLAFIQMVGTLVLL
FT                   IVLNWQLTLITILFDVLIVVYARYASKRSAKHYSVQQKSLGVLNGFAEETISGLKVVKV
FT                   FNHEDANFTDFQKVNEELRSSGTSAQSYAATMVPITVSLTYINYAVVTVVGALLAVNGH
FT                   ADVASLASYLVFVRQAAMPFNQFTQLSNFLLTALAGAERIFAVMEMTPEVDEGKVKLLR
FT                   VSGYESGDESWAWVKPSGEKIPLAGDVRFDEVTFGYDEGQTVLANLSLFAKPGQKIAFV
FT                   GSTGAGKTTITNLINRFYDVRSGTITYDGIPINDIKKSALRSSLGIVLQDTHLFTGTIA
FT                   DNIRFGKLDATDDEVIAAAKIANADKFIRRMPRGYNTVLTSDGANLSQGQRQLLAIARA
FT                   AIADPPVLILDEATSSIDTRTEALIEKGMDALMAGRTVFVIAHRLSTVRNANAIMVLEH
FT                   GRIIERGTHDELIAQHGEYYQLYTGSRELE"
FT   gene            490302..490673
FT                   /locus_tag="Apar_0423"
FT   CDS_pept        490302..490673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0423"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: bph:Bphy_1762 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50854"
FT                   /db_xref="GOA:C8W9R6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R6"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ACV50854.1"
FT                   /translation="MLEALAVALGGALGSLGRWQLGVLFKQWIPNLPVGTFAANVVAGL
FT                   IIGFVTGIDLASLLQPQVKLFLAVGLCGGLSTFSTFSNETLAFIQAGNWTAAGVNIAAN
FT                   IITCLVAVFIGLKVAAAVS"
FT   gene            490778..491623
FT                   /locus_tag="Apar_0424"
FT   CDS_pept        490778..491623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0424"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: bce:BC4832 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50855"
FT                   /db_xref="GOA:C8W9R7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R7"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACV50855.1"
FT                   /translation="MIESFNNTIDYIDTELANTIDEKKIAQLSGYSFPLFSRIFSILTD
FT                   MTLSEYIRNRKLSQAAVNLRNTNEKVIDIAMKYGYESADSFTAAFKRFHGFTPTEVRSG
FT                   KPFKVFSRVQLALSIQGGRTMEVKIQRKPGFKIAGISAQEIETSLCNGVWKKLFSKCSF
FT                   EELSKIGNGQSFGMCYDVENINSINYLAGFDVTDVDRAQKYGLEIVDIPEAEYAVVKLH
FT                   GPIPTCIHDGWKYVMEVFFPEHGYVHAGTPDFEVYSEGDMNDSAYEMELWIPVVKASKA
FT                   "
FT   gene            complement(491653..493110)
FT                   /locus_tag="Apar_0425"
FT   CDS_pept        complement(491653..493110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0425"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bsu:BSU02670 drug-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50856"
FT                   /db_xref="GOA:C8W9R8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACV50856.1"
FT                   /translation="MFERKLNTKLVLSVIATGIMSFSGVVVETAMNVTFPTLMEEFSIG
FT                   TSTVQWMTTSYLLILAIIMPMSSFLNRRFKTKSIFTVAMIFYISGILCGFAAPTFMLLL
FT                   LGRILEGIGTGLALPLMFNIITEQAPLKNMGVMMGIGMLVTAVAPAVGPSAGGWIAEHL
FT                   GWRMIFAGLLPFLIVAFVLGISSIQQSHETEVISFDVFGWLLLTVSFIALIFVIDESGA
FT                   FGLLSIPVLLAMVIFAGSLALFIRHENSLKSLTKSLPNKMQSSKQSPKIPLIDLAVFSE
FT                   KAFVLSLFAIIALQFIILGQSYLLPNFSQLTLGAGATVAGAQMLPGCAIGAVMAPISGQ
FT                   IFDKLGARKPIMTGILFCLISEILFLAFTPLLTVELIACIFCIFTIGQALQIGNNFTVA
FT                   LKHLPENLKADGNAVINTMQQLFGALGTSIISGIVAASQLGTSDIATSTLAGAQNALFV
FT                   LVCVACIPLVTMGIVLFVLPRKENIKK"
FT   sig_peptide     complement(493030..493110)
FT                   /locus_tag="Apar_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.366 at
FT                   residue 27"
FT   gene            complement(493285..494046)
FT                   /locus_tag="Apar_0426"
FT   CDS_pept        complement(493285..494046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0426"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: bba:Bd2727 phosphoglycerate mutase; TIGRFAM:
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50857"
FT                   /db_xref="GOA:C8W9R9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9R9"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ACV50857.1"
FT                   /translation="MAEDQYMHLVIVRHGESEWNKLNLFTGWTDVDLTETGHEEATAGG
FT                   RALKEAGYDFDVCYTSLLKRAIHTLNHVLDELDRNWLPVHKTWRLNERHYGALQGLNKA
FT                   DAAKEHGEDQVKIWRRSFDVQPPALEPGDERDPHIQEMFRDVPAEDLPYTECLKDTIAR
FT                   AWPYFEQEIKPQLEAGKRVLIAAHGNSLRALVMQFEHLTPEEILEVNIPTGIPCAYTFD
FT                   KDWNIVDKHYIGDPAVIEAKINAVANQGKAK"
FT   gene            494347..494550
FT                   /locus_tag="Apar_0427"
FT   CDS_pept        494347..494550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50858"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50858.1"
FT                   /translation="MSPIDILIVLIVIALVVLCVRSQLKSAKEGSCSGCSSSSSCGTHH
FT                   GGDGHCGVAQKMISDVDKAFDA"
FT   gene            494679..495992
FT                   /locus_tag="Apar_0428"
FT   CDS_pept        494679..495992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0428"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region;
FT                   glutamine synthetase beta-Grasp; KEGG: sat:SYN_01628
FT                   glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50859"
FT                   /db_xref="GOA:C8W9S1"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S1"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ACV50859.1"
FT                   /translation="MSTDKKIDYILRTVEERDVRYLRLCFTDVLGGLKALSISPEELEE
FT                   AFVEGIGFDGSNVDGFASQEQSDLLAFPDADTFQILPWKTDDGVVANVFCDIQTPRREA
FT                   FAGDPRLVLKNAFIKAEDLGYVANVGPKLEYFYFVNGIEPKPIDQAGYLDLNSADLSHS
FT                   LRYSTSRALENLSIPVQYSFHAAGPAQNGVELRYAEALTCADNIVTARLVIRHIATLHG
FT                   VFASFMPKPLQGVPGSAMLLNQSLLNHDGESLFWAPKTENEAHLSELAQHYIAGLIKYA
FT                   PEYMLITNPTVNSYKRFDRDAIPAYATWGRKNRSAMVRIPTHKPGKHVATRAELRIPDP
FT                   TANPYLANAVTLMAGLKGIEEGLSLPEEFVGGNPADYGEKLPTNLGEALERFKQSELLK
FT                   DALGEHIFSYLCERKAEEWREFCLTVTDWDTHKYYAGC"
FT   gene            496355..497206
FT                   /locus_tag="Apar_0429"
FT   CDS_pept        496355..497206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0429"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: efe:EFER_1174 cystine
FT                   transporter subunit ; periplasmic-binding component of ABC
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50860"
FT                   /db_xref="GOA:C8W9S2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S2"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACV50860.1"
FT                   /translation="MKSSFATTVKKTALKGVAVVSMACALMGLIACSSPKQETAQQSTT
FT                   SQSESGYTLVTKGHLTVVAELGFQPFEYFEGNSTTPVGFDVDLITEIAKRLNLEVTYLP
FT                   NQKFDTLVPTIKQGGKADVAIAGITITDERSQEVDFTTSYLDSNQSLVVKSGSTETEQT
FT                   LNDASKKIVVQTGTSGEDWAKENLPNATIVSVDDVAAAMAGVQTGLYDAMVIDLPVASN
FT                   LISTSYSDLTIAKEIPTGEQYGIAVSKDNPALTEAINKVLADMEKDGTMTALKTKWFGS
FT                   NI"
FT   sig_peptide     496355..496456
FT                   /locus_tag="Apar_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.568 at
FT                   residue 34"
FT   gene            497392..498741
FT                   /locus_tag="Apar_0430"
FT   CDS_pept        497392..498741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0430"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dps:DP1983
FT                   glutamine ABC-transporter, permease protein (GlnP)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50861"
FT                   /db_xref="GOA:C8W9S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S3"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV50861.1"
FT                   /translation="MPQNMAHDSAESKCPHVRVYSSLFVVFLATFLLSGLFFMSLSVFS
FT                   AESAFALTTNKATAKSNQTEGNGVIGGKETRLTWEGTVEDEQISQLTLQLPEGSDLQSA
FT                   TTKVTVLSGLTREKIEATASVQGTQVVISFATPVDAQKLIRVEISGMKFPSDGGAYTVE
FT                   GTYTTEQGTQKLVSSPEITVISNTPVQAIVNWLDVQPWVEAWNSNHFLGMFLKPQLIVS
FT                   SVVMLFPGWLVCLAIVICAYPVAIVLGMGFALLKISKNPLLRALAVVYINLLRGTPFFL
FT                   QIYILFFGLPMLNINLDTNLLGFIVVAINSSAYLSEIFRAGIQSIPQGQYEAASSLGMN
FT                   RFQTMTFIIIPQTIRRVIPPLTSDFITSYKDTSLLSSVGVMELMMFAKNLTTSTGNMTP
FT                   YMTAALFYLAITLPLIKVVGSIEKRMEQSETGQTASTKTSKTQAISKEEN"
FT   sig_peptide     497392..497529
FT                   /locus_tag="Apar_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.867 at
FT                   residue 46"
FT   gene            498741..499601
FT                   /locus_tag="Apar_0431"
FT   CDS_pept        498741..499601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0431"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: rsh:Rsph17029_3103 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50862"
FT                   /db_xref="GOA:C8W9S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50862.1"
FT                   /translation="MSFFSFNKKSNTEYPALDAEIAAQEAFERDKLLTNHAFEAGEHPI
FT                   VRIEHLNKSFGATHVLNDVNLTVWPGEVVVVLGPSGSGKSTMLRCINLLETPSAGHILI
FT                   EDQEITGTNEAEVNALRRDVGMVFQQFNLFGHLTVKENVMIGQIKVLGKSKEEAEAEAL
FT                   KQLEAVGLADRADFKPGALSGGQQQRVAIARAVAMHPNVLLFDEPTSALDPELVRGVLD
FT                   VMRDLAKNSGMTMIVVTHEMGFAKDVADRIVFMEGGVVVEQGTPDAIFNNPQSSRTAEF
FT                   IGAIV"
FT   gene            499757..500431
FT                   /locus_tag="Apar_0432"
FT   CDS_pept        499757..500431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0432"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: glo:Glov_0588 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50863"
FT                   /db_xref="GOA:C8W9S5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S5"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACV50863.1"
FT                   /translation="MHHKNILLVSATTRLHERMRELSHVIDVSIALANVASFAQATVSG
FT                   HTFDLIILDQKDLSQDVVSTVENYSAQNGGIARLFVADLDNLSKFVLPVQGKSDFILST
FT                   ATIQEFSLRCSLLLWPGTESTSRDLVIVDNIKINLATYQVYIDESPVDLTYMEYLLLSF
FT                   LATHPSRAYSREALLQRVWGFEYCGGTRTVDVHVRRVRSKIGPQAAAHLETVRGVGYLF
FT                   RA"
FT   gene            500625..502040
FT                   /locus_tag="Apar_0433"
FT   CDS_pept        500625..502040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0433"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein; KEGG: dar:Daro_3371 peptidase S1 and S6,
FT                   chymotrypsin/Hap:PDZ/DHR/GLGF"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50864"
FT                   /db_xref="GOA:C8W9S6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S6"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACV50864.1"
FT                   /translation="MENKTYSLTTDSVVYKRFSPVKRDGFMSKLRSSSIKRTACAIAFA
FT                   VVCVPTIALGEGVAKLPAVSGQATISQAAARPAAEPTDTKTAETVASKVLPSVVSVKAT
FT                   SDSSGSTGSGVVLNTNGDILTNYHVIEGMDTFSISINDKEYDCTVVGTDPTSDLAVLHA
FT                   DLKGDSVTPIEIGNSDNLAPGSWVMSVGSPFGLDHSVSAGIVSALSRGDMLETEGGETT
FT                   IYANLIQVDAAINPGNSGGALVDSNGQLVGICTLYSSDTKSFAGIGFAIPINYAIDIAN
FT                   QILSGQPVKHAYIGLSMQTVTPRAAKRNNLSVDYGAYVAGLLDDSPAGNAGIKKGDVII
FT                   SIGGERVISADAAIIAVRSHKVGETVPVEIMRGEDRLTINVTLGSDETLSSMKDKEKNN
FT                   KNNTNDTDDKQDRTEDDDDSYRHYRQQNWWQEFWDYFTNPYGDSDTDSDNPFENFVESI
FT                   TNSIAEAIYGIFG"
FT   sig_peptide     500625..500792
FT                   /locus_tag="Apar_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.849 at
FT                   residue 56"
FT   gene            502117..503466
FT                   /locus_tag="Apar_0434"
FT   CDS_pept        502117..503466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0434"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   bte:BTH_I1701 RmuC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50865"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S7"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACV50865.1"
FT                   /translation="MLLVLTVVFILLIVGLVTLSSKLSQVKTLQEQNQTSSSELLRNSQ
FT                   DLDRRISDNMTAMHQLMDTKLDQVREVVDQKLTTTLQAQTKQTDQRIAQLDARFDAFQR
FT                   RVDENMKTTSQTSTEQLGKVRETVDKQLSDMRKENEAKLELMRQTVDEKLQKTLDERMT
FT                   QSFQRVSTQLEQVHQGLGEMRGLAEGVGDLKKVLSGVKTRGIVGEIQLGAILRDILSPE
FT                   QYEENVATVSGSSERVEFAVKLPGESGESVWLPIDSKFPGDTYEHLVDAINTGNEEAII
FT                   AAKKSLEARIKAEAKDISTKYIAPPETTNFAILFLPFEGLYAEVVSQVGLLEQLQREYR
FT                   VNVCGPSTMAALLNSLQMGFQSVAIQKHADEIQRVLSAVKTEFETYKGQLEKARSQVQK
FT                   AEKALDTILTTRTNVMSRKLRTVTALENLGEAQKTLGISDMVDDGDEDEK"
FT   gene            503556..504542
FT                   /locus_tag="Apar_0435"
FT   CDS_pept        503556..504542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0435"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU02750 Na+ ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50866"
FT                   /db_xref="GOA:C8W9S8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50866.1"
FT                   /translation="MIQQESNLDHDTLLPLNVKKVSRSYRIKEGKRIVLDNVSFSVHLG
FT                   EIVCVLGPNGAGKTTLVKIASSLLLPDCGEAEVCGVDVLKYPRKACKNISLVLGGENGF
FT                   YLHATAINNLRYFAQVSGVPFDEQESRIKNALQQVHLVEFSNQNVSTFSRGMRQRLHLA
FT                   RALISAHSLILLDEPTSGLDPNNAADVRQLIAELRHIPSGILLTSHSMREVELLADRVL
FT                   ILKKGKCIFLGSLEELRQKVIIEGVYTFITNCLDESKVKILKECSGIASVEVFEKFDSI
FT                   YVDVSGNKKMIFDLCVDDFGWKNVNERRASLEEVYLAIMGKDDERQY"
FT   gene            504526..505290
FT                   /locus_tag="Apar_0436"
FT   CDS_pept        504526..505290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0436"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: abc:ACICU_01702
FT                   ABC-type multidrug transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50867"
FT                   /db_xref="GOA:C8W9S9"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9S9"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV50867.1"
FT                   /translation="MKDSINSIFDIRSELRMLRFHTSMFLTTSFFLISVLGSCFSFSLF
FT                   KIFSMIQGSNNHSFWVYSSIATIWASTILSTGIIGYQRYQGTLDYLFVSPKGIANIFYP
FT                   IIFSATTLGLVLGVPCSILLSLFFDVPITLSIHEILALFFSTIACASSALVLSSLYVLT
FT                   KNASSFESLILTGIWIGSGIVLPIENFPLPIRIIAYVHPLTPAVKLITSVTIQDFFLYS
FT                   VVCLIFSIAYAFLGWFLIKLAFSNLRKNGDYL"
FT   gene            505293..506078
FT                   /locus_tag="Apar_0437"
FT   CDS_pept        505293..506078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0603 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50868"
FT                   /db_xref="GOA:C8W9T0"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50868.1"
FT                   /translation="MKRITSYVYPAICIALTSLSSYGSILAFCIQFFIEPIFSYLYFIL
FT                   FGMQLSASSMSLLIGILTLSSWLSAMQCSANIIVQDRFAKTIFMYLISQNHAIVFFLIR
FT                   YITITVICFMSSFLTSVIVLYIAGADVLALLFPLCISLILASLGGAIFGVFSSVIGLLF
FT                   TDGFAVLNLLSISIPILSGAVIPLYLFPSSLISICKCIPISWIVDGVGLFLSSNTNDAF
FT                   LLCGYALFLEFLWILITLAFISFCNSRQRITGQIEGMHL"
FT   sig_peptide     505293..505364
FT                   /locus_tag="Apar_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.921 at
FT                   residue 24"
FT   gene            506157..506480
FT                   /locus_tag="Apar_0438"
FT   CDS_pept        506157..506480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0438"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bsu:BSU33520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50869"
FT                   /db_xref="GOA:C8W9T1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T1"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACV50869.1"
FT                   /translation="METRSAVEKKSCHHCGYKATPRSSELKSGVSRRINRAIGQLNGIK
FT                   TMINEDRYCGDVLIQLAAVESAVKAISREVMQDHLESCVVDRIQSGDTEVIDEVMDLFK
FT                   RFM"
FT   gene            506490..509093
FT                   /locus_tag="Apar_0439"
FT   CDS_pept        506490..509093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0439"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; copper ion
FT                   binding protein; PFAM: E1-E2 ATPase-associated domain
FT                   protein; Heavy metal transport/detoxification protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   abu:Abu_0480 heavy-metal transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50870"
FT                   /db_xref="GOA:C8W9T2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T2"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACV50870.1"
FT                   /translation="MNQKVFDVQGMTCASCSAHVEKAANSVSGVSEARVNLLKNSMEVD
FT                   YDGNPDTLKQISDAVSKAGYEATPRSDKKDSAAAIKADATDASERAVKQKRVELISSMA
FT                   FAIPLFYLAMGEMMGAPVPPAVSGMNGMMNLALTELLLCIPILFICRHYFIGGFRSLLH
FT                   GAPNMDSLIALGSAASFAYSVVSLYQMANAFVAGDVTAAHHAMHGMYFESAGLILALIT
FT                   LGKFFEARAKGHTTGAINALMNLAPKTAILVKDGVEQEVPAETVVVGDMLVVRAGQSIP
FT                   VDGQVIEGEGSVDESAITGEPVPVSKTVGDFVTGATVSTGGWFKMRATAVGDDTTLAGI
FT                   IRLVDEATSSKAPIERLADSIAGVFVPVVIGIALVTFVAWFGFVAPGDFAVALSHAVSV
FT                   LVISCPCALGLATPTAIMVGTGLGASNGILVKSAEALEGAVRATVVVLDKTGTLTEGKP
FT                   SVTDVLCAGSVSKDQLLEYAYALEQKSEHPLAQAIVTYAQEKLGKSEAGSLDVQEFSQV
FT                   AGGGLTAKVGEKHLVAGNARLMEQEDINTQELISQAQQLAEQAKTPLYFALEGKLLGVI
FT                   AVADKVKQTSASTIDRLRAMGVKSVMLTGDQATTANVIGKELGVDQVISDVLPSQKESY
FT                   IRQFQDAGENVVMVGDGINDAPALARANVGIAIGAGTDVAIESADIVLMKSDPADVATS
FT                   IELSRATMTNIKENLFWALFYNTICIPVAMGLLYPFGISLNPMIGAAAMGFSSVFVVCN
FT                   ALRLRTWKPKNASSVTHQDAHDTKAVIDVQSKSTNDTSVSQKEESYMKKKLNVEGMSCQ
FT                   HCVAHVTHALEAVEGVSKATVSLDEKSAVVELSSDVPDSALVDAVVQAGYEATIA"
FT   gene            complement(509083..510081)
FT                   /locus_tag="Apar_0440"
FT   CDS_pept        complement(509083..510081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0440"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: hdu:HD0377 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50871"
FT                   /db_xref="GOA:C8W9T3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T3"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ACV50871.1"
FT                   /translation="MSSCALIDLHVHLDGSIPLPAAAQLAAEAGLNFSLDELQEKMQVP
FT                   AHCQDLNQYLATFELPLKLMQSEQGIRAVAKAFHKQLDAEGILYAEPRFAPGSLTAEGL
FT                   SQQEILEAALAGRADFFAENPQSELHTAYILCAMRGTGEELKRKNEQSIDLAVAYLGKG
FT                   VVAADLAGAEALFATENFSSLFAEAQRKDVPFTIHAGEAAGPESIKAALRLGAQRIGHG
FT                   VRSLEDVSVIQDLKAANVTLEICPTSNLQTRIFESIERFPLEQLLDAGLTVTINTDNMT
FT                   ASNTTLSHEFELLQQYCGLDKNTARELAENAARAVFSDSSEKDCLLAYLRQ"
FT   gene            complement(510127..511161)
FT                   /locus_tag="Apar_0441"
FT   CDS_pept        complement(510127..511161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0441"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   eum:ECUMN_2431 putative (phospho)hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50872"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T4"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACV50872.1"
FT                   /translation="MNAARKIKLYRMLTALAYGDAYGMPTEMMSPRQIDFVFPDGIQSL
FT                   SSPPKNDFFGRPFTAGQTTDDTANAIILTKNIIDNQGIFNQSRYFDALENYVATEPNAA
FT                   QVVGPSTRAALANRLSGHSLKTCGRLGTTNGCAMKCAPLASIVNWKDKHALIDSVTELA
FT                   LPTHGTNVAIMGAAMIVAAISRGLSENSFTVEDALETALSYGHRALYTKIGTQMPMPSM
FT                   YQKCIIALEFCEGAKNLEAPLAASRDIYDYCGCGYETIETIPAVLAVVKLSKGKVSRAA
FT                   RIAAEMGGDTDTIGSIACAICSQIHYDILPDEVSLLEHVNGYQFEKLANNLENATSLPY
FT                   DVAI"
FT   gene            511593..512555
FT                   /locus_tag="Apar_0442"
FT   CDS_pept        511593..512555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50873"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50873.1"
FT                   /translation="MPAILTHDFFGKDAFDIAAGKLGFSTMEEREAFLLGNQGPDPLFY
FT                   LAADPLLHRYAKYASIMHKEKTPELLLSMRDAIAPLPLKDVAVARAYIAGFLCHYMLDS
FT                   TAHPLVYYWQNMLTSQGVEGLDESAKNQVHAEIEKDLDEAILYAHLGKTVATYRPYSEV
FT                   LRASLHTLYVLDRVFFFALLWTYEKPTDTRIFSSAVVDFRIIQHLAYSPTGKKRKLLGH
FT                   LERTFGTNRFSLIEALSHGVRKSSDSDFDNRAGNEWIDPFTGEVRKDSFWDLYDHALAN
FT                   VPYALDVFFSPDFNLDTARELTQNLNFAGQKLADEDSTE"
FT   gene            512562..513341
FT                   /locus_tag="Apar_0443"
FT   CDS_pept        512562..513341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0443"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bbt:BBta_1036
FT                   putative serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50874"
FT                   /db_xref="GOA:C8W9T6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACV50874.1"
FT                   /translation="MATYVFSDIHGHVEPLKRALERINPTESDVFYCLGDMIDRGPSSL
FT                   DTIKVIRALPNCTVLMGNHEQLALQALAPEANIEAQFMWQINGGDATLAELKTLSEEEY
FT                   CELIAWLQTLPLYAIVEVQGKDFVLVHAGVKSNGVPVPTAWDKASLEQYLNKQSENDLL
FT                   WIREDFWQHPTDFRTSDASYPIVICGHTPTPLLESFGAKNLNRSATTEGGLAQWVQSDD
FT                   DKWGIDTGTTGGAGYGQVTILRLDDLQEFVEPLQEGE"
FT   gene            513344..513901
FT                   /locus_tag="Apar_0444"
FT   CDS_pept        513344..513901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0444"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   cff:CFF8240_1263 Mug G:T/U mismatch-specific DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50875"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T7"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ACV50875.1"
FT                   /translation="MAVKKPQPAADTAKTTLTHVENTLDPIIFPDSRVLLLGSMPSPKS
FT                   REIGFYFGNPQNRFWRVVATLYGEKPLQSIPEKIDFCKRHHLALCDVLKACDIKGASDA
FT                   SIANPVPHNIGALIQDSSICAIFTLGGTATKFYKRYTEQQTGILARQLPSTSPANARMS
FT                   VDDLVEEFSIIKKFTNCELTIS"
FT   gene            514106..514759
FT                   /locus_tag="Apar_0445"
FT   CDS_pept        514106..514759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0445"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ccv:CCV52592_0287
FT                   ABC transporter membrane- spanning permease - glutamine
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50876"
FT                   /db_xref="GOA:C8W9T8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV50876.1"
FT                   /translation="MDWSFIGEHLPLYAEAAKITLTISFFGVIFSLIVGLISAQISLSK
FT                   IPILSQLNSVYVELSRGTPLLIQLFLIYFGLTKVGLKMDAEAAAVVGLTFLGGSYMAEA
FT                   FRAGFESVAAIQFESAQVLGLSKIQTLQHVILPQALSVAVPGFVANVIFLIKESSVVSG
FT                   IALADLMYVTKDIIGMQYDTTEALFMLVIAYVIILVPISLIGSWLERRLDYARR"
FT   gene            514746..515423
FT                   /locus_tag="Apar_0446"
FT   CDS_pept        514746..515423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0446"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: asu:Asuc_1950 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50877"
FT                   /db_xref="GOA:C8W9T9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9T9"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV50877.1"
FT                   /translation="MPVDNILLQEGVLTRLFGGLATTVYIGLISVVLSIPLGILVGLFM
FT                   TSNNKIVRTLLRVYLEIVRVMPQLVLLFVVFFGTSEWFDVNFDGIEASIVVFTFWGAAE
FT                   LGDLVRGALESIPASQYDGAFVLGLSRQQTFFQVILPQALRRLLPPAINLITRMIKTTS
FT                   LCNLIGVVELLRVGSQITDFYRFMFPTDGALWIYGAIFFLYFAACFPLSYLSRRLERSA
FT                   SHE"
FT   gene            515416..516171
FT                   /locus_tag="Apar_0447"
FT   CDS_pept        515416..516171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0447"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hhe:HH0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50878"
FT                   /db_xref="GOA:C8W9U0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50878.1"
FT                   /translation="MSNTVLAVKDLTKVYPSSQKPVLDKVSLSINKGEVVVVLGPSGCG
FT                   KSTLLRAIVGLEDIQGGEVLLHDQVTSGQKRESAATGIGMVFQSYDLFPNMTVLKNVTL
FT                   APLVVQKRSEDEVLAQAEELLRRVGLWEKKDSYPSALSGGQKQRVAIVRALMTNPEVLL
FT                   LDEITAALDPEMVHEVLQVVMELAEQEMTMLVVTHEMRFAQAVADRVILIDQGHIVEES
FT                   SDAQEFFSAPKTQRAQEFLRTFEFERVHK"
FT   gene            516230..517126
FT                   /locus_tag="Apar_0448"
FT   CDS_pept        516230..517126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0448"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ccv:CCV52592_0290 acriflavine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50879"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U1"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACV50879.1"
FT                   /translation="MNFFENTSTSLSRRAFLGATALSAATLLAACKKKDSDGAQGGSSD
FT                   TDSKFRTLDDIKKAGTVNIGVFSDKAPFGYVDANGNYAGYDIVFAERLAKDMGVKINYI
FT                   ATDGQNRVPFLQSNKADIMLANFTVTDDRKEKVDFSLPYMKIKLGVVSPASAPITDVSQ
FT                   LDGKKLIVSKGTTAEVWFAKNAPKVELVKFDSYADAYNALLDGRGDAFSTDNTEVLAWV
FT                   KSNPGFIVGIDDLGDSDTIAAAVHKGNSSLLEFINNEITGPLAEENFFHKAYEETLAPI
FT                   YGDEVDPNTMVVEGGKI"
FT   sig_peptide     516230..516319
FT                   /locus_tag="Apar_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.626 at
FT                   residue 30"
FT   gene            517328..518323
FT                   /locus_tag="Apar_0449"
FT   CDS_pept        517328..518323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0449"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="PFAM: 2-keto-3-deoxygluconate permease; KEGG:
FT                   see:SNSL254_A0708 2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50880"
FT                   /db_xref="GOA:C8W9U2"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U2"
FT                   /inference="protein motif:PFAM:PF03812"
FT                   /protein_id="ACV50880.1"
FT                   /translation="MAAEQQKATRKIGVPRFPGDIMLYPLSVGLLLHSFFPQVLEIGSF
FT                   TTAVAKGAPAIVGIVLLFVGASIDLKTVPKVLKTGLTILIPKLAIAIAFGLFVAKFMDD
FT                   NFFGLNALSIIGGITFCNVALYIGITAEYGTPDEQGAAAVLSLVAGPAVTMIALGAAGV
FT                   AAISPTALIGTLLPLVLGVVLGNLSPFIRSLLVPGINPCIAVVGFALGCGMSVENLITG
FT                   GLSGILLAVLCIIAGILTMLVERLLGGSGKASLASATIAGTATTTPAAVAAVDPTYTAQ
FT                   VVANANAQLAAAVVITALVAPAFTGWLDKKLAKKNDDAEMQTSEEVPATE"
FT   gene            518470..519558
FT                   /locus_tag="Apar_0450"
FT   CDS_pept        518470..519558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0450"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ftn:FTN_0894 GDSL-like lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50881"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U3"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACV50881.1"
FT                   /translation="MEVGEWSISSPASRFLLGAPWSEKLAHGWVHPLRISPNQLRVIGS
FT                   CSSWHPGLFKQMAACTSDIQVTFTTDSSEVVLDLKIDELPKGSSSVLQLLKATYLKKLS
FT                   SVFVTVDGKPYKNFSLDDVGEHTLSIHLETETSEDDLARLPGFNDTHRVNVYLPCLQSA
FT                   SVKNLRGNGTFFSPGEPKKKLVVFGDSIAQGFVVERPDKTWPHCLAKRMKLDAVNQGIG
FT                   GQVYQPGSYAFIEDASLVVVALGANYRYEKCSKSQVTYDIQNSLWQISQMYADTRVVVL
FT                   TPTPYFEDTYPTHPYSCFAEVPQIIEEVAGKFGLQCISGEKLLPQEKKYFADDVHPNSK
FT                   GAALLAKNLFEALKQPVQDSLF"
FT   gene            519657..520898
FT                   /locus_tag="Apar_0451"
FT   CDS_pept        519657..520898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0451"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="KEGG: dol:Dole_1124 metal-dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50882"
FT                   /db_xref="GOA:C8W9U4"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U4"
FT                   /inference="similar to AA sequence:KEGG:Dole_1124"
FT                   /protein_id="ACV50882.1"
FT                   /translation="MNITNPFAPHMTGQLSEETQALVAEQIAKGTLSPYACKNEDIIRR
FT                   DSTHDQASLLRPAFMRDVEKIMHTPAYNRLNGKTQVFSFRAHDDITRRGLHEQLVCRVA
FT                   KDIGRALCLNLDLIEAIALGHDVGHTPFGHAGEYFLNDIYHEQTGRWFFHNVQSVRVLD
FT                   GLYARNLSLQTLDGVICHNGEFEQQVLQMSNLSTFDEFDKVVEDCWDRGPQAIAHLRPM
FT                   TLEGCVMRISDIIAYVGKDRQDALRAGAATEETFDDGLGGAYNAWATSAFVADIVQNSF
FT                   GKPQISLSEEAFKEMKRAKRENYQKIYGASEANGDFSEDIKHLFEKLYEYELSALKSGD
FT                   QNLAIFKHHIEPVSRHLSRYGHTYDWKSDLHRTVVDFISAMTDDYFVATCEALFPEAQE
FT                   LFPKRSYFAEGVRV"
FT   gene            521005..522336
FT                   /locus_tag="Apar_0452"
FT   CDS_pept        521005..522336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0452"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   gsu:GSU2067 recombination factor protein RarA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50883"
FT                   /db_xref="GOA:C8W9U5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U5"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACV50883.1"
FT                   /translation="MDTLFSGIERAAKKANAPLAARMRPTTLDGYVGQEDAVGPGSWLR
FT                   KAIEHDTLSSVLLYGPAGTGKTTLARIIAHTTHAEFVEVSAITGTVKDLRREIEAAESR
FT                   LLTAGRRTILFIDEIHRFTRSQQDALLHAVEDRIVVLIGATTENPYFEVNSALISRSRV
FT                   VELHALSDNAIDELIQRALESEDGLAGAFVLEEDARKEIVTLAGGDGRAALTSLELASQ
FT                   MVDVPESADGKASEPLVITKQNVLEANPRRGLPYDKAGDMHYDIISAFIKSMRGSDPDA
FT                   ALYWLARMIDAGEDPKFIARRIMILASEDIGNADPQALLIAHAAFRSAEVIGYPECRIN
FT                   LAQAVIYMALAPKSNAAEAGIDAALHEVRTGPRREVPSYLRDRTRPGSEEYGNYLYPHN
FT                   YPGGWIEQRYLPEGLERGAFFSPSPRGWEAWRIAATERDRHEET"
FT   gene            522428..523039
FT                   /locus_tag="Apar_0453"
FT   CDS_pept        522428..523039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Adipophilin (Adipose
FT                   differentiation-related protein) (ADRP)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50884"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50884.1"
FT                   /translation="MNYLQIALVVLAVVGVWAIIEVALTLRTTRKSITEITLSANNTIE
FT                   QIQPVISKIDGMVDELDPTIKQLPALMQKVDDAAENANTSLESLNVVLGDVATVSGAAS
FT                   AVTATVSKAASDAVTGVVESVSKLGTGLGGSLNPSKLAEAAQARLSGVTATAQQGAQRA
FT                   QEYLEELPLLSQDKTKHSKPARSEQFYIEYGSESSQKTEE"
FT   gene            523046..523429
FT                   /locus_tag="Apar_0454"
FT   CDS_pept        523046..523429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50885"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50885.1"
FT                   /translation="MAQKIVELSAPADPTFARSVRMMAANLAVLCKMNVDELEDVKMAA
FT                   EEGFVFACGTQRDFVDITFTLEDNTMEIDFDLGDEDPVESETDNSQPLELVELLLSAIC
FT                   DEFALSDDGYTLHLVKISGGAHA"
FT   gene            523422..524276
FT                   /locus_tag="Apar_0455"
FT   CDS_pept        523422..524276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0455"
FT                   /product="RNA polymerase, sigma 28 subunit, Sig B/F/G
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-
FT                   B/F/G subfamily; RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 3 domain protein; Sigma-70 region 4 type 2; sigma-
FT                   70 region 4 domain protein; KEGG: bha:BH0529 RNA polymerase
FT                   sigma factor SigB"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50886"
FT                   /db_xref="GOA:C8W9U8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U8"
FT                   /inference="protein motif:TFAM:TIGR02980"
FT                   /protein_id="ACV50886.1"
FT                   /translation="MPKPEANEAVQASAEEQKAARRAARRASKGIPAWDKDRTRQLFAQ
FT                   YKETKDSEVRDQLIVSHLNLVRFLASKFKNRGEPLDDLIQVGTIGLIKAIDRFEPDRGL
FT                   EFTTYATPTIMGEIKRHFRDKGWSVRVPRRLQELSSKINQVTDDLTKELQRSPSIEEIA
FT                   QRLDTNVEEILEAMESSSAYSSVPLEGGGSGADGDETPSIIDQYVTEDEDLAGSDDRIV
FT                   LDEAIRDFSPREQEIIRMRFVEGLTQVEIAEKLNISQVQVSRLLRRTLKRIQEKIDPES
FT                   VNR"
FT   gene            524276..525658
FT                   /locus_tag="Apar_0456"
FT   CDS_pept        524276..525658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0456"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bsu:BSU27420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50887"
FT                   /db_xref="GOA:C8W9U9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9U9"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACV50887.1"
FT                   /translation="MDQKHQNFSDSIQSWKQRGLMVWTAIGFAALFALALYVLGILGQA
FT                   VELLAIGAIVAFVCSPVTNWLEDRGIPRGISAFAALILTLIVFVGFLILIAQPLVLELT
FT                   TLLKNAPSYASQIGAMAREFWQNFDSQSNPAVRQTVELVIERASSIGISVASGILSWLS
FT                   TSALGNISSMANQLMVFFLGLVLAYWLAKDYPVIVRELAIIAGPQKEDEFRLILAILSR
FT                   STSGYMRGTIITSAVNGILVYFGCLILGNPYAALIGMVTGIFHIIPVVGPVFSAGIALI
FT                   LSILVDPIMTVWTIVILMVAQNVVDNVLSPLVMATSVKVHPGLSLIGIVIGSALGGVVG
FT                   TILAIPLTAALRGIFVYFFEKYSGRQIVSPNGALFNSTQYVDEKGAILPEYDALDDPKF
FT                   FEESRLVDQDTTAHIRSKSSIPAPKILGHDFSQLLFRNTQEVIKEPDKPSSDTVDSDST
FT                   KE"
FT   gene            525684..528329
FT                   /locus_tag="Apar_0457"
FT   CDS_pept        525684..528329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0457"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: rme:Rmet_0831 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase class
FT                   IIc; phosphoesterase DHHA1; Threonyl/alanyl tRNA synthetase
FT                   SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50888"
FT                   /db_xref="GOA:C8W9V0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V0"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ACV50888.1"
FT                   /translation="MADYKTMTTAEIREDFLSFFESKGCKRYPSSSLVPSDPSLLLANA
FT                   GMNQFKEYYQGIKTMKEIGATSCQKCLRTNDIDNIGDSRHLSFFEMLGNFSFGGYTKRD
FT                   ACTWAMEFISSPEHLGLPLDRLYFTVFTDDDEAIEIWKSLGITEDHITRLGEEDNFWAA
FT                   GPTGPCGPCSEIYFDQGPEFEGEAPGDDGDRYLEFWNLVFTQFDRQEDGSLPELPHRNI
FT                   DTGMGLERIAAIMQHEGTNYEGDIMRTLISLGEKLSGKKYHSTDEIDRSLRILADHSRA
FT                   VTFMIGDGILPGNEGRSYILRRLLRRAVYHGRLLGIQGTFMAEYAHEVAVLLGAEYPEL
FT                   VEKSALIDGILTAEEERFGATLDAGESKLTAELEQLEDGAQLSGEVAFLLHDTYGFPID
FT                   LTREIAANAGHVVDMDAFDAAMTEQRERARKSANRDAWGNAQSIWVALSDRLDETVFDG
FT                   YDNNELSGVRVVALVQDGQEVESATVGSEVEVVLDRTPFYAEMGGQVGDTGRLSGPGLY
FT                   VHVTDTKHRDGGLESHIGVVEEGTLSIGDSVTATIDAGRRELIRRNHTATHLLDAALKK
FT                   VLGDHVNQAGSLVAPDRMRFDFTHFEALTKDELDRIEGMVNAEIFAAKPIVTKIMSIED
FT                   AKAAGAVALFGEKYGDVVRVVSAGTEDTPFSRELCGGTHARNTADLGLFKIISESSVGS
FT                   NSRRIEAVTSMGAIEYVDERLAQLDEVAAALKVRPSAVADRVEQLQQDLRAANHKLEAA
FT                   LTGAGSNQVAEALKSAVQLNGYSCVIAKLEGLSGKELRSAWDGIRDASDGQPVACVIAS
FT                   ATADGKVSLLAGATDSAVAAGFSAGDIVKEIAEFVGGRGGGKPAMAQAGGSNAAGIDAA
FT                   LDAARTKLGA"
FT   gene            528333..528755
FT                   /locus_tag="Apar_0458"
FT   CDS_pept        528333..528755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0458"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG:
FT                   afw:Anae109_2535 Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50889"
FT                   /db_xref="GOA:C8W9V1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V1"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACV50889.1"
FT                   /translation="MRVLALDIGEVRIGVAVSDPDGAIASPVCVLPAQEVLSHARTFKT
FT                   VLEDWEPELLLCGRPKTLAGEDGPQAQKITVQAEQIAKNCQLPLEFTDERLSSAEAKKI
FT                   LRAQGLSEKAMRGKVDMVAASLFLQSWLDAQMNKGD"
FT   gene            528756..530111
FT                   /locus_tag="Apar_0459"
FT   CDS_pept        528756..530111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0459"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG:
FT                   gme:Gmet_3021 aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50890"
FT                   /db_xref="GOA:C8W9V2"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V2"
FT                   /inference="protein motif:PFAM:PF02618"
FT                   /protein_id="ACV50890.1"
FT                   /translation="MPTPSNDSSPRRQGAHFSSSVSEGQAQEEQIQEKQTQQDSAHYNA
FT                   GSQEALQQPPVEATGSLPALTGGKLSSRSAQVTHKAKNKQVKHRDRKASKCSRIFATLI
FT                   AFVMVAALGIFVWKVALPELSRTNSDTQEITAGQQVTVTIPDGAGAQEVAKILFENKII
FT                   ATKSEFLDQVKRQDAEQKIKSGSYVITTGTKPADIVHLLVSGPNAPGSGFVVPEGYTVS
FT                   QVADLAQNYFGISRDDFLNQAKASNYVADYPFLAGAVDANDSLEGYLFPKTYTFTESNV
FT                   TADTVIRAMLDQFKAETANLNLDAARITLNKRYNLNLTNEQIITMASIIEREALTDEDR
FT                   PKVASVFYNRLYDDMYLQSDATLAYSLGREATAEELSSMTSDPYNTYAFKGLTPTPICS
FT                   PGYASIKAAMDPAATNYYYFWITSDEHVFSETYDEHQQAIENAREREAASKQ"
FT   gene            530123..530620
FT                   /locus_tag="Apar_0460"
FT   CDS_pept        530123..530620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0460"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /note="TIGRFAM: HAD superfamily (subfamily IIIA)
FT                   phosphatase, TIGR01668; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: bcy:Bcer98_3062 HAD family
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50891"
FT                   /db_xref="GOA:C8W9V3"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V3"
FT                   /inference="protein motif:TFAM:TIGR01668"
FT                   /protein_id="ACV50891.1"
FT                   /translation="MSLIKATQYVSAVEHISVESLVQRGIKLVLLDRDNTCVPRDTKVV
FT                   PSEVSAWFEKAHAAGLMLCLVSNNIHFDEVQRSAHELGIEGEGFACKPLPRALNAAMKR
FT                   FSVTKEQTVMVGDQIFTDIIAGNLAGVSTILVKPQSTEDLWYTNLIRHVERRILKNVTF
FT                   TS"
FT   gene            530685..531233
FT                   /locus_tag="Apar_0461"
FT   CDS_pept        530685..531233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0461"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: asu:Asuc_0264
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50892"
FT                   /db_xref="GOA:C8W9V4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V4"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACV50892.1"
FT                   /translation="MEFRDSRYVVHEGCDHIFFVGFLGAGKSTLARNLGELFHRRYVDT
FT                   DRLAERIAGKSLAEIYENDGEELFRQAETEVLHTLKSKKSLLVSCGGGIVEKDINLALM
FT                   REMGVIVFLDGDLSDSLRQIQRTDRRPDLGSVENATQLYRRLRPRYEAAADITIDIREK
FT                   TFEQVAIDSGKLLWERGLL"
FT   gene            531230..532366
FT                   /locus_tag="Apar_0462"
FT   CDS_pept        531230..532366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0462"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   ccs:CCNA_03104 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50893"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V5"
FT                   /inference="protein motif:PFAM:PF01761"
FT                   /protein_id="ACV50893.1"
FT                   /translation="MSDTIQDELEEELPPAQIKQWVSIPGGSIALRSGVGVLSNFGTEL
FT                   RTAVGRPHRCAFLTSGQADEDLVELLRRDLTTIGFLVTLVEVEDGEAATTVATEARVLS
FT                   SLAEMHLTADDLVVAVGHSGVISLANHVANKWCGGVSLATVPLDLAAVIVSSITPRALD
FT                   TDAEHQRLVTTKPCARFCFADLEVMDLCDDNAKVAQVCMVATAMSDNEAEFGRIWDRAD
FT                   NLTSGVADIVAEQLAESTKTRGRLSDSSAIAIQQSVPYGWVFVEALRPLIPADQPLSAL
FT                   YADALRFSARIAVAKESLSFDDMLAQDEILEHLNIGFVTCDIAPEQLIEALKQECFRST
FT                   NRFMLPIPMSIGRVRLASVDEELLAEHARAWCEAHASH"
FT   gene            532459..533583
FT                   /locus_tag="Apar_0463"
FT   CDS_pept        532459..533583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0463"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG:
FT                   bcb:BCB4264_A4308 X-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50894"
FT                   /db_xref="GOA:C8W9V6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V6"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACV50894.1"
FT                   /translation="MADLQAAAKRVARFREVMAQRGYDAVVLRHNPDLRWLTDAERTFD
FT                   FEQAHTAFITQDALFLHTDSRYYNTFLERLGTDSPWKFDQEATTPTEWVAAHVAEARAR
FT                   VVAIEDTVDLAFFDGLEQALRNRSIAALLPRMHGDIAELRIVKDPAEIELMKHAQSITD
FT                   KAFLHICEYIKPGLTEQQIRAELENYMLSNGADALSFDSIIASGPNGANPHAQPGERVV
FT                   QTGDMIVMDYGAGYLDYHSDMTRTVVVGAPSEEQQHVYDVVRKANETCAAAIHAGVTGS
FT                   DIHNLAVKVISEAGYGEYFGHGLGHGVGVEIHERPFFNPRWNKVIAAGSVVTDEPGIYL
FT                   PGKFGIRLEDFGVVTEDGYDVFTQSTHDLVSVGC"
FT   gene            533833..534831
FT                   /locus_tag="Apar_0464"
FT   CDS_pept        533833..534831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0464"
FT                   /product="Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase"
FT                   /EC_number="2.7.1.69"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   PTS system fructose subfamily IIA component; KEGG:
FT                   ypi:YpsIP31758_2368 PTS system mannose/fructose/sorbose
FT                   family IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50895"
FT                   /db_xref="GOA:C8W9V7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V7"
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /protein_id="ACV50895.1"
FT                   /translation="MVSIVLASHGKFAEGIKDSGSMIFGPQEGVVAITLTPDMGPDDLH
FT                   QKILDAITTLEDQEHVLFLVDLWGGTPFNQISRVLEEEGKEDWVAVTGLNLPMLIAAYG
FT                   SRLGVDTATEVAKEIFSEARMGVKIKPEELEPQEATPTDVPAVATPKGAIPVGTVIGDG
FT                   KLKIVLARIDTRLLHGQVATTWTKMTKPDRIIVCSDGVAQDELCKTMIVQAAPPGVHVH
FT                   VVPIKKIIEIAHDTRFGNTKAMLLFETPQDMLRVIEGGVEIKEANLGSIAHSVGKVVVT
FT                   NAVAMDEDDVKTLEAIRECGTKFDVRKVPADSAENFDAMLKKAKSELANRK"
FT   gene            534848..535663
FT                   /locus_tag="Apar_0465"
FT   CDS_pept        534848..535663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0465"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="PFAM: phosphotransferase system PTS sorbose-
FT                   specific IIC subunit; KEGG: stm:STM1831 mannose-specific
FT                   enzyme IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50896"
FT                   /db_xref="GOA:C8W9V8"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V8"
FT                   /inference="protein motif:PFAM:PF03609"
FT                   /protein_id="ACV50896.1"
FT                   /translation="MTPITILLVVIVALLAGMEGILDQWEFHQPLVACSLIGLVTGHPA
FT                   EGIILGGSLQMIALGWANIGAAVAPDAALASVASAIIMVLALNGGDTDTTAAINTSIAL
FT                   AIPLSVAGLFLTMIARTIATGIVHAMDAAAEKGDFAAIERWHIVAIFMQGARIAVPAAA
FT                   LCFIDPAIVTDALNAMPKWLTGGMAVGGGMVAAVGYAMVINMMATREVWPFFALGFVFA
FT                   AINQLTLIALGVIGVCLAIIYLGLKDLAKQGGGAGGGSGDPLGDIIDNY"
FT   gene            535685..536602
FT                   /locus_tag="Apar_0466"
FT   CDS_pept        535685..536602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0466"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IID subunit; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component; KEGG:
FT                   asu:Asuc_0288 PTS system mannose/fructose/sorbose family
FT                   IID subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50897"
FT                   /db_xref="GOA:C8W9V9"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9V9"
FT                   /inference="protein motif:TFAM:TIGR00828"
FT                   /protein_id="ACV50897.1"
FT                   /translation="MENKIQLSKKDRMSVALRHQFLQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYTNKEDQIAALKRHLEFYNTHPYVSAPVMGVTLALEEGRANGEPIDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTVRPILGALGASLALGGSILGPILFFVLWNVIRLVFLWYTQEFGY
FT                   KAGASISSDLSGGMLGKVTEGASILGMFIIGALVQRWVSISFTPVVSTIPQQAGAYIDW
FT                   TTLPSGVDGIYQALKLYSTLGPNGLDPVKVTTLQQNLDSLIPGLAAVGLTLLCCYLLKK
FT                   KVSPIAIILALFAVGIVGRLLGFM"
FT   gene            536689..537096
FT                   /locus_tag="Apar_0467"
FT   CDS_pept        536689..537096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0467"
FT                   /product="protein of unknown function DUF956"
FT                   /note="PFAM: protein of unknown function DUF956"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50898"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W0"
FT                   /inference="protein motif:PFAM:PF06115"
FT                   /protein_id="ACV50898.1"
FT                   /translation="MAQSQNSTVDLSMKATSFHGLATYGDILIGNKAFEFYNQKNPEDY
FT                   IQIPWDQIDHIAASVIGRNKSISRFAIFTKSNGNYSFSTRDNKATLRAIRVYVGEEKLV
FT                   RSPNFWFVFKHGLMTIPQIPRLIQEAFIKKK"
FT   gene            537233..537796
FT                   /locus_tag="Apar_0468"
FT   CDS_pept        537233..537796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0468"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P ; Elongation factor P/YeiP protein;
FT                   Elongation factor KOW domain protein; KEGG: aeh:Mlg_0684
FT                   translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50899"
FT                   /db_xref="GOA:C8W9W1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W1"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ACV50899.1"
FT                   /translation="MATISTADFKNGLGLKINDKYYTIVEFQHVKPGKGGAFVRYKIRD
FT                   LRSGRVIDQTCNAGTKFENVLLLTKEMQYLYNDGESFYFMDNETYDQVAVPADFIGEKS
FT                   VWFKENDNAQLLYADTELLGVEPPMFIEAEITETDPGFKGDTVQGGTKPATIETGATLQ
FT                   VPMYLNQGERIKVDTRDGKFVSRV"
FT   gene            537878..538243
FT                   /locus_tag="Apar_0469"
FT   CDS_pept        537878..538243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU15830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50900"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50900.1"
FT                   /translation="MAETELRIAGIGISKDVISTVVSGAAGNVEGVASVGGNDTLASNL
FT                   INVFTSRSLAPEKAVEAGVENGQLHLGVHLTVFYGYPFTKLASEVRLAVATAVNEQIGV
FT                   SIASVDVYIDSLVFPKE"
FT   gene            538246..538749
FT                   /locus_tag="Apar_0470"
FT   CDS_pept        538246..538749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0470"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: mgm:Mmc1_0164 NusB
FT                   antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50901"
FT                   /db_xref="GOA:C8W9W3"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W3"
FT                   /inference="protein motif:TFAM:TIGR01951"
FT                   /protein_id="ACV50901.1"
FT                   /translation="MSVKFFGRTRARSQALQLLFQAEATNRSVLEVLGGDYTLSEGPLD
FT                   EYARLLAVGADGIRDDLDDIIAAYSKDWSIDRMPSVDRNLLRISLYEILKVPEVDVAVA
FT                   INEVVDLARAYCGDDSPRFINGVLGRIVDDIDAGEDIYSLCHKQSVEQDSFEEEPMGSV
FT                   EDVG"
FT   gene            538752..539090
FT                   /locus_tag="Apar_0471"
FT   CDS_pept        538752..539090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50902"
FT                   /db_xref="GOA:C8W9W4"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50902.1"
FT                   /translation="MAKIDTSEYQSFDQITARLDSIVDQVRDKNVSLEHSLDLFDEAIA
FT                   LGSKAVNMVDTTEFTPEEEERLVQAQAAGDAPTSEPVVEEQASSEQVEASTLDKTSSDD
FT                   SVSESDGH"
FT   gene            539090..539896
FT                   /locus_tag="Apar_0472"
FT   CDS_pept        539090..539896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0472"
FT                   /product="hemolysin A"
FT                   /note="TIGRFAM: hemolysin A; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; KEGG: pca:Pcar_1058 rRNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50903"
FT                   /db_xref="GOA:C8W9W5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W5"
FT                   /inference="protein motif:TFAM:TIGR00478"
FT                   /protein_id="ACV50903.1"
FT                   /translation="MAQRISRQRLDKELVRQGFFKDTQAALRSILAGDVSTKDRKLTSA
FT                   GELVPEGLFLHVKGAIPYVSRGGLKLERAFEVFDITVQHKKCLDIGCSTGGFTDCLLQN
FT                   GAASVTSVDVGYAQFDWSLRNDSRVELHERTNITSLPEMGYSHVFDVAVCDVSFTSILS
FT                   ILPSVLDVLASKGVFVTLVKPQFEAKREEVGEGGIVTNASVHLQTLQKVADAFKEAHMG
FT                   PLGACESPIHGAKGNVEYLLFGQLGVGPYDLNLASVVSNHSVEIVK"
FT   gene            540015..540872
FT                   /locus_tag="Apar_0473"
FT   CDS_pept        540015..540872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0473"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: nmu:Nmul_A2422
FT                   NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50904"
FT                   /db_xref="GOA:C8W9W6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W6"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ACV50904.1"
FT                   /translation="MKVLLVPNYSREVAVSGARELEEWLFNQGCDVQWAHDKKLFPDKD
FT                   VDCSDCQLVISLGGDGTLLRAARIVEYSEIPILGISYGHLGFLTSATPNQMIEMVADAL
FT                   AGELHVSRRATLAIETEYELPSEETYVKKTFSLNDFAVSRGGAGDMVEFTVSVSGNHID
FT                   KLRGDGFVVSTATGSTGYALAAGGPIVTPEFSGMVCVPIAPHTILARAFLTSPSDVVEI
FT                   TMSKDRPAPCHFFSDGQNIKHPEEGAATKARISRGPGDIILLDRSADSFYRSVSRVFYG
FT                   KTGQ"
FT   gene            540884..542515
FT                   /locus_tag="Apar_0474"
FT   CDS_pept        540884..542515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0474"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: dal:Dalk_3718 DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50905"
FT                   /db_xref="GOA:C8W9W7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W7"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ACV50905.1"
FT                   /translation="MLDELRVQNVALIDDASFAPASGLTVLTGETGAGKTALLSSIKLL
FT                   VGERADASAVREGTDALRVEARFFTSSEDQEGIVVSRKVSADGRGRVEIDGHMASVKEL
FT                   AGGIGTSIDLCGQHEHQRLLDVKNHVSMLDAWIGPDIQSYQAEYKDALHAYYVAIAELQ
FT                   RVIEVSQSSNAKIDEASFLVQKIDEVSPKEGELEDLEEQLPRFEHAEALLQAAGGTHEL
FT                   LSSDEGVIDSLSEAVQILQNASTFDATLGSYAESLSSALIEIEDVSSELRSYVGSLDFD
FT                   EEALEEMQSRMARLQGLMRTYGPGMKDVFKKYQAAQNLLEVTRDTKKLVREAQAEVDRA
FT                   KDTLSVKANALKKVRVAAAPKLCDAVNLQMSHLQMGSAQIELNFEDLPFEQWNKVGSTK
FT                   IELMYKPSAQMTARPLRKIASGGEVSRVMLACKVVLGESDDCDTLVFDEVDAGVGGTTA
FT                   VALAEVLAQLAKTHQVIVVTHLPQVAVLASKHYVVSKTEEHNALPITSLTEVSGTQREE
FT                   EIARMLSGSITEASLAHAHELLTETY"
FT   gene            542650..544299
FT                   /locus_tag="Apar_0475"
FT   CDS_pept        542650..544299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0475"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bha:BH3792 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50906"
FT                   /db_xref="GOA:C8W9W8"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W8"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACV50906.1"
FT                   /translation="MTKHIFVTGGVVSSLGKGITAASLGRLLKARGYKVMMQKADPYLN
FT                   VDPGTMSPFQHGEVFVTEDGKETDLDLGHYERFIDENLTRESNFTTGLIYQSLIQRERA
FT                   GDFLGGTVQVIPHVTDAIKARFARIEEVTNADVVITELGGTIGDIESQPFVEAIRQFRK
FT                   ERGASNVAIIHVSLVPYIAAAHEVKTKPTQHSVKELRSLGIQPDFIVCRSSHSVDESIR
FT                   EKIANFCDVDADCVFENNDLPSIYDVPAHLAAQGFDKKVLERLGLEVRPSDLGGWEAFT
FT                   TAMHKANALEDTTRIYVVGKYTQLPDAYLSVIEALHHSGIFYGRHVDIRLVNGEELTEE
FT                   DVEQELAGADGILVPGGFGLRGVEGKMVAIRRARELKIPYLGVCLGMQMAVTEFARDVC
FT                   GMEGANSAEFGPDTPYPVIDLMPDQEDITDKGGTMRLGSYPCKVVEGTLAHEAYGDNLV
FT                   YERHRHRYEVSNVFRNQLVEAGLVVSGISPDDRLVEMIELPESVHPWFVASQAHPEFKS
FT                   RPTHPAPLFREFARAAIAHHEGVDRHDVNQTL"
FT   gene            544328..545236
FT                   /locus_tag="Apar_0476"
FT   CDS_pept        544328..545236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0476"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: bsu:BSU23510 site-specific tyrosine
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50907"
FT                   /db_xref="GOA:C8W9W9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9W9"
FT                   /inference="protein motif:TFAM:TIGR02225"
FT                   /protein_id="ACV50907.1"
FT                   /translation="MDLAQARTEYIAYVAVERGLSVNTLDAYTRDLEGYLFWLSGKKIT
FT                   SPNQVTRSDVEEYIGSLRDLGMAPASVERHTAAIRNFHKFMAVEQICESSPAEDLPTTA
FT                   RIQRLPDVISQEKAEELLDQPFPNSPLGIRDKAILELLYGCGLRVSELCDLEVRGVLLE
FT                   DELLRVFGKGSKERVVPVLGSAYRALKTYLFEARSLLLKHGQVSEVFVNARGGRISRQS
FT                   VHKLVANYGRVVGIEGLHPHTLRHSFATHLLEGGADLRSVQELLGHVDISTTQLYTHVD
FT                   RSHIRDVYLEAHPRAHVHADK"
FT   gene            545644..546078
FT                   /locus_tag="Apar_0477"
FT   CDS_pept        545644..546078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0477"
FT                   /product="protein of unknown function UPF0040"
FT                   /note="PFAM: protein of unknown function UPF0040; KEGG:
FT                   cvi:CV_4352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50908"
FT                   /db_xref="GOA:C8W9X0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X0"
FT                   /inference="protein motif:PFAM:PF02381"
FT                   /protein_id="ACV50908.1"
FT                   /translation="MLTGQYQRSLDSKIRVTLPAPQRKQLGDVVILLRRQDALYGYSPE
FT                   AYEAWIASLNLNPRNRDDVTALRMLNAAATTVDIDSAGRVALGKIDESDPQAREKLQLD
FT                   RDVTIVGNGDHFEIWNTNKWNSLFSADDRVATLEDLIFGA"
FT   gene            546094..547077
FT                   /locus_tag="Apar_0478"
FT   CDS_pept        546094..547077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0478"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: gsu:GSU3077
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50909"
FT                   /db_xref="GOA:C8W9X1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X1"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ACV50909.1"
FT                   /translation="MKVEEGNLKVEYRHQPVMLAEVLRELDPKPGEVVCDCTLGGAGHT
FT                   VEMAKLIAPDGLSIGIDQDAMAHQAAAARLKQEVPNAEFLPLKGNFGDLDELLVSAEVP
FT                   GVDCFLFDIGVSSPQLDIPERGFSYHEDAPLDMRMDPGKQTPTAQEVINTYNEADLARI
FT                   LRIYGDEKFASRIARRIVQTREKRPIQTTFELVEVIKAAIPAAARRHGGHPARKTFQAL
FT                   RIEVNHELEVLERGLRSAIAWANPGGRICVISYHSLEDRIVKHVFSELSQGCICPPDLP
FT                   VCMCGQVPIVDVITRKPLVATPEEIERNPRARSALMRVAVKRNPEK"
FT   gene            547136..547555
FT                   /locus_tag="Apar_0479"
FT   CDS_pept        547136..547555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50910"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50910.1"
FT                   /translation="MARYGSEAVARTIQFEHEYAPEQSTRSSFEVVPGGGLDADARRGV
FT                   SSQFIQRVKLIAVAAALFLTLGVVRVGISTATVSTLQSNNAIRNEMRATTATNDSLRVS
FT                   RSLLASTTRIERIATQNYGMTLETNRPVVDVSNNA"
FT   gene            547647..549371
FT                   /locus_tag="Apar_0480"
FT   CDS_pept        547647..549371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0480"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   aba:Acid345_3635 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50911"
FT                   /db_xref="GOA:C8W9X3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="PDB:4OVD"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X3"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACV50911.1"
FT                   /translation="MHFRGHRGSSGGSDGVGPEGRLRRVAAAMAIMVAIVVLRLAWLQI
FT                   FTAADLSKGAENNRTNDIVLHARRGTIYDRNGNVLAMSVDCKDIYANPSEIKDASTVAQ
FT                   VIASFLGGSPSDYLGDLQQDTTFVYVRRRVDTDTASKIEKALGEKKLKGIYFVNNTKRV
FT                   YPYGNVGVQILGFVNADNEGASGLEYYYNDILAGTNGHMIVETGAGGTPIAGGTSNITE
FT                   AQNGQDIVLSIDIELQKKAEEQLTAAVKDFEAKQGGSIMAMNPRTGEIYAAASYPLPDF
FT                   ESDNGVDYESLNLKLVSSIYEPGSVFKVITTSIGVDNNLFGPNSTFNIPTELQVGDNKV
FT                   TDDDWRTSAMDMSVREMLRRSSNVGMAFLETQLIGDKRFAEGIDKFGIGHTTGIDFPGE
FT                   ATGIVRSLDQYEGPTGGNMAFGQGLAIPFIQVIRAYTAVANKGTMVTPHFMVSKGGQEV
FT                   SWPTKDVISSSTASAELDMMTTVVKEGTGVRAGIYGYTVAGKTGTGQQVVEETGSYGEN
FT                   SGFVASFCGIVNPSESDLMVYVGLNDTHQLASQSAAVVFSQFAKDAATRLNIQPINP"
FT   gene            549380..550816
FT                   /locus_tag="Apar_0481"
FT   CDS_pept        549380..550816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0481"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamin
FT                   opimelate/D-alanyl-D-alanylligase"
FT                   /note="TIGRFAM:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-di aminopimelate/D-alanyl-D-alanylligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: bsu:BSU04570
FT                   UDP-N-acetylmuramoylalanyl-D-
FT                   glutamyl-2,6-diaminopimelate-D-alanyl-D -alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50912"
FT                   /db_xref="GOA:C8W9X4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X4"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACV50912.1"
FT                   /translation="MVKLSVEQIVAATHAQLLHRGTREVAGCAVIDSREVQQGSLFVAF
FT                   AGEKVNGNSYLLSAAQAGAAVVVASEPVTDNLLDSLAATGASVLEAADDDCEAFLLALA
FT                   AAWREAHPNWLVVGVTGSVGKTTTKEMLRRGIGATRRVHATAGNHNNLIGLPLTVLSTP
FT                   EDTEVLVLELGMNHAGEITRLTSVARPTVAVITNVGTSHIGLLGSRKNIARAKAEIVSG
FT                   MRAFGSIEPTLIQASAGDYTKFIADKFARPARVVCKTVGATEDDVMSAQKVILDEKGLP
FT                   TATISASSGWSRTVTLEVPGRVVVDDLLLALEAVETLGLDLDAAAEAIEQMPATRMRLS
FT                   VLDATCGAKIIDDSYNASPNSTAAALDVLMQMPAEGRRIALIGEIGELGPEEKRLHGYV
FT                   GAYIAAKNPDFVAFVGTGAAREMVEAARVMGFSEDKIEQFNDVNEALAVLGPVLKQGDV
FT                   LLAKASRSAQLDIFVKGVTE"
FT   gene            550816..551847
FT                   /locus_tag="Apar_0482"
FT   CDS_pept        550816..551847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0482"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: bcy:Bcer98_2563 phospho-N-acetylmuramoyl-
FT                   pentapeptide-transferase;
FT                   TIGRFAM:phospho-N-acetylmuramoyl-pentapeptide-transf erase;
FT                   PFAM: glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50913"
FT                   /db_xref="GOA:C8W9X5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X5"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACV50913.1"
FT                   /translation="MFFQTIYPTYQVFVALGVSCIITMVLMPLFIKLMKKEGVGQQVRA
FT                   DGPQQHLIKQGTPTMGGVVMLVSIVLTCIALAQWNTDLILVMAAMLLTGSLGLLDDIES
FT                   VAHGRSLGLTASQKMAGLITISVAFCLAAVNIWGITPIIAFPGGLDINLGILTTTVNLG
FT                   ENSISIPWLYLFFVFLLMAGLSNAVNLTDGLDGLAGGCVMVVMIFMAAVAFRYGESSLA
FT                   VFAASIAGACIGFLWFNSYPASIFMGDTGSLAWGAAFAALAVLTKTEVVSLVMGGLFII
FT                   EALSVIIQVVSYKTTKKRVFLMAPLHHHFEKLGWNETKVVFRFWIISGAFAALGFALYF
FT                   QLH"
FT   gene            551877..553280
FT                   /locus_tag="Apar_0483"
FT   CDS_pept        551877..553280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0483"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   aba:Acid345_3631 UDP-N-acetylmuramoylalanine-- D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50914"
FT                   /db_xref="GOA:C8W9X6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X6"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACV50914.1"
FT                   /translation="MSLLETLGDVCVLGFGKTGVSVCAYLLQQPEGRVSSITLVGGADA
FT                   TVGEKVQGLADSGVQVQCGSDQVEGTFDLTIASPGIPDTSELFLSAKAASKQILGEPEF
FT                   AYQESPTQWIGITGTNGKTTTTSLTTSILQYAGLDACAVGNIGFTITDQLSERKSNSWF
FT                   VAELSSFQLATTQKLHPHVAMLLNITPDHLEWHGSLEAYAAAKEKIFANLDVNDLAIVS
FT                   DLDEFCLAVSSRLEARGISVCHLAQTDPGTQNAAFVRNGALVVRLSGKEMELVATDALH
FT                   IRGMHNALNALAAAACGLFLGIDIVSIRHALLDFMPLEHRIEPVKTINGVLYVNDSKAT
FT                   NTDSVEKSLTSFPDKDIILLLGGHDKGTELDKFAQKVSATCAYAICFGEAGPRFAEALR
FT                   HVSGGRAEVVEEPHLREAFAHAVELARPGFVVLLSPACSSFDEFSGMAQRGHVFKQLVE
FT                   DLAQEESGR"
FT   gene            553280..554809
FT                   /locus_tag="Apar_0484"
FT   CDS_pept        553280..554809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0484"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: bcy:Bcer98_2561
FT                   stage V sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50915"
FT                   /db_xref="GOA:C8W9X7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACV50915.1"
FT                   /translation="MSTSRNRNAERVQQSRISRQRSSERSQAKGRFGAIPERFMQPRLV
FT                   LLVSTAILVCFGLVMIYSASSISAMTSEDMGYNPFYYVQRQLSFAAAGVVLAFIVSRID
FT                   YRAVVRNFQIPIWFVTIGMLAIIFTPIAGADAYGATRWISIGPFSFQPSEFAKITILVS
FT                   VSYLAQQYFIDQTIDKMEFFKKFAIAALVPLVLILAQPDKGSTLIIVGTLLVIGYLADV
FT                   DRRVLATIAVAGFIGFAFLSLKDDYSRARVMTMLNPWADYYGAGYQLAQGFYAFGSGGI
FT                   FGVGLGFSRQKYSYLPMAHNDFIFAVIGEELGFIGVLGLLVVFGALVWAGFKIARYAPD
FT                   LTGRLIAAGCTSMFIIQAFVNIGGVLGLLPLSGKPLPFISYGGSTIMSSILMIGLLMSV
FT                   SRQSRLPETEHDRQRATWSMAEGQDDFDAPGFAGLTMVDGGVGVGMPLPRSSRPKSSAQ
FT                   SSARPSRGVLRSRNDDAPQGRITTDASGRRRIDLGPSASDRLRGNNTRPRR"
FT   gene            554833..555966
FT                   /locus_tag="Apar_0485"
FT   CDS_pept        554833..555966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0485"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: bha:BH2565 N-acetylglucosaminyl transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol N-
FT                   acetylglucosamine transferase; PFAM: glycosyl transferase
FT                   family 28; Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50916"
FT                   /db_xref="GOA:C8W9X8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X8"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACV50916.1"
FT                   /translation="MAEQKKLSVAIAAGGTAGHINPALALAEELRERGHQVTFYGQPNK
FT                   LEGTLVPEAGFELVPIHVNGFDRRRPWTLMSAAYNLERAKLQLHKRFKEQGSPDVAIGF
FT                   GAYVELPLLQLCAKLHIPYLIHEQNSVTGLANRVSAGKAAKVCIAFPEARKAFEGHVKA
FT                   QNTIVVTGNPVRKSVLSADRAASRQCLGIADDQILLLIFGGSLGARSINETFATLKQEL
FT                   LARPNLRIIQSTGQKLYDEVVSLMKLTDKEAARWEVKPYISNMGATLAAADLVVSRSGA
FT                   SSVAEIAALELPSILVPYPLATADHQTTNAHLLSDAGAAILVPDNQVGTTSFSTALFNL
FT                   VDNADQRKKLSEAAATLDQRSAASLVADAVESAVCGV"
FT   sig_peptide     554833..554910
FT                   /locus_tag="Apar_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.531 at
FT                   residue 26"
FT   gene            555994..557463
FT                   /locus_tag="Apar_0486"
FT   CDS_pept        555994..557463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0486"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG:
FT                   UDP-N-acetylmuramate/alanine ligase ; K01924
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50917"
FT                   /db_xref="GOA:C8W9X9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9X9"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACV50917.1"
FT                   /translation="MSWYVQDLNDNNIWKGSLMADSMGEKNISRAHFIGIGGAGMSGIA
FT                   LVLHERGCTVTGSDLKSSHYVRELEDAGIQVSIGHTATTIDTVMPDVIVTSTAIPETNP
FT                   EVIRARELSIPIWPRAKMLSYLSRGRKTIAVAGTHGKTTTSSMIATMLDKLGADPSFLI
FT                   GGVVEGYDTNGKNGNGQYFVCEADESDGSFMFLNPSVVVITNIEADHLDHYGSLENIEN
FT                   TFCEFMSLLDKEETVVINGDNPHYVELAQSTGRHVVTYGFDPSCDFVCKQEERKAGIEN
FT                   PLTIKTPSGQTISVVLPANPGKHNVANATAAIAVADTLNFDLEEAAAALSQFKGARRRF
FT                   THVGDINGITVVDDYGHHPTEIAATMSAALPLGFKRVVVVFQPHRYSRTQDLADSFTHA
FT                   FDGIDVLRVMDVFSAGELPIPGVSGKTVSSRVQAANSVPDVRYIPSRRDLIADLLETVH
FT                   PGDLLITQGAGDVTQIGPMLIRALKERLQNN"
FT   gene            557474..558388
FT                   /locus_tag="Apar_0487"
FT   CDS_pept        557474..558388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0487"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: bha:BH2564 UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50918"
FT                   /db_xref="GOA:C8W9Y0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y0"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACV50918.1"
FT                   /translation="MSLFNAYVSLSGALDATIKQDEPLGHHSSFRIGGKASLFAAVHSH
FT                   VALVRVLEVLAANRVDWVLLGKGSNILVSDKGYNGCVIVLDDELSTISVGENNLITAGA
FT                   GALTARVCNEAMKAGLSGLEMCAGIPGTIGGALSMNAGTRHDWIGKAVRDCVVLKPGKG
FT                   LVRYDASEIEWGYRYTTFAPDEIILETTFALTPSDRSKVALGMDTLLQRRRNTQPTGQL
FT                   CCGSVFKNPGSRSAGALIEECGLKGTTEGGAQISDIHANFIVNTGNATAADVIALMRRA
FT                   HDAVQEKFDIDLQPEVKLLGFGA"
FT   gene            558396..559484
FT                   /locus_tag="Apar_0488"
FT   CDS_pept        558396..559484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0488"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein FtsQ-type; KEGG: ppd:Ppro_3285
FT                   polypeptide-transport- associated domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50919"
FT                   /db_xref="GOA:C8W9Y1"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y1"
FT                   /inference="protein motif:PFAM:PF08478"
FT                   /protein_id="ACV50919.1"
FT                   /translation="MAEDTSKQKTRRKGTKREPLSSGAAQTAGEAKPSFMSKAFKPKPK
FT                   AETTASDAKISTKKTSTKKTSTKKASDKKPNNATKTADQARAERIKHSRKVSFKTVRTV
FT                   FIVLLSLAIFAGIAFLVLRSSSIFAITNIQVEPTEHVTNEQIQKLIAVEEGTTLLNMDE
FT                   SLITEELQKDPWVASATYERQFPNTLRITIIERKVTAIVTLSSGPVAWYLGEDNVWLEA
FT                   DQLTVPEGKTTATVALEKATSEGKLLITDVPATVSPVAGTTATDAEIQAVMQYQSTFSS
FT                   ELTSQIVSYSASSVDAISVTLTNGVQVALGSPTQITDKEKVILAMLKQFPGELTYLNVR
FT                   TPASPTYRRVSTGNVQSGSGVS"
FT   gene            559732..560868
FT                   /locus_tag="Apar_0489"
FT   CDS_pept        559732..560868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0489"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   bcy:Bcer98_2555 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50920"
FT                   /db_xref="GOA:C8W9Y2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y2"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACV50920.1"
FT                   /translation="MIKDTDTLNNYLAVIKVVGVGGGGTNAVNRMIEEGIRGVEFVAVN
FT                   TDAQALAISDADIKVHIGTDITKGLGAGANPEVGKEAAEDSRDEIKAALAGADMVFITA
FT                   GEGGGTGTGAAPVVADIAKNDVGALTVGVVTKPFSFEGRRRYGSAADGIKTLSENVDTL
FT                   IVIPNDRLLDLSEKKTTMLEAFRMADDVLCQGTQGITDLITVPGLINLDFADVCTIMKG
FT                   AGSAMMGIGIAAGDNRAADAATEAISSRLLESSIEGATRVLLSIAGNKDLGIQEINEAA
FT                   DLVAKNVDADANIIFGTVVDESLGDQVRVTVIATGFNDANVQQQLPTLSTQSTSRPSRP
FT                   AQPQPTRPASAQPQPARSNNSSNEKEFDIPDFLKRSRI"
FT   gene            560916..561680
FT                   /locus_tag="Apar_0490"
FT   CDS_pept        560916..561680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0490"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   mxa:MXAN_2999 conserved hypothetical protein TIGR00726"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50921"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y3"
FT                   /inference="protein motif:PFAM:PF02578"
FT                   /protein_id="ACV50921.1"
FT                   /translation="MDPEVPCGVTLAFTERTGGFSKGEFASLNLGGRCGDNLQHVQKNR
FT                   QLVLEALGAGEHFSRLLIPHQVHGSTVVCLSSDTSEAFEQAKTEAEAGADAIVCTVQNT
FT                   PVLLAFADCVPVILVAPGGFAVAHSGWKGTIARISACTTETLCQATGAKPSEVKAYIGP
FT                   HIGSADYEVSSELIQMFSQEFGPNVVDRASGERYLDLGYAVRAALIDAGVRESAIEEVT
FT                   DSTASTTERFFSYRAEHGKCGRHAAVAYMAAK"
FT   gene            561741..562475
FT                   /locus_tag="Apar_0491"
FT   CDS_pept        561741..562475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0491"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bba:Bd0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50922"
FT                   /db_xref="GOA:C8W9Y4"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y4"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACV50922.1"
FT                   /translation="MTYDSDEYLEFIKARKAQIESLVADAAKKSGRSASEIEIVAVSKT
FT                   VPVEAVLAAYKAGYRVFGENRPQELTHKLTCLSETSFGSEITFDMIGNLQKNKINQVVG
FT                   KVRYIHSISSEHLAEAVSKRAEAKGSQESVLLEVNVSAEASKSGFSPEEVSESIQKVVE
FT                   LSHISVVGLMTMAPRDDPERAKRTFAGLRELRDRLSQQVGLKLDVLSCGMSDDFTYAIE
FT                   EGSTTIRLGRILFDPAYTLSER"
FT   gene            562536..563216
FT                   /locus_tag="Apar_0492"
FT   CDS_pept        562536..563216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0492"
FT                   /product="protein of unknown function DUF552"
FT                   /note="PFAM: protein of unknown function DUF552; KEGG:
FT                   bha:BH2549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50923"
FT                   /db_xref="GOA:C8W9Y5"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y5"
FT                   /inference="protein motif:PFAM:PF04472"
FT                   /protein_id="ACV50923.1"
FT                   /translation="MSILDTLRAKLRGGQDDEYYDDEYYGEDGYDELDGTPSRSYDDRA
FT                   QQGSSSRLLGNPSRPEAESVSVYTRSGKPISTNPAASYNPQQDMRPRASAYASRQEPSG
FT                   YTPSYEHTVSPNLPTPGDIGLRPVSRTSYSGQLPPYILRPVSYDDVQSVVRRVRTGQPV
FT                   VLIFKNTNIEVAKRILDFSFGLSYGLDGAVEEVADRVFVVLPHGVSLTQADLDKLADEG
FT                   EITR"
FT   gene            563229..563507
FT                   /locus_tag="Apar_0493"
FT   CDS_pept        563229..563507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0493"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   bcy:Bcer98_2547 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50924"
FT                   /db_xref="GOA:C8W9Y6"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y6"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ACV50924.1"
FT                   /translation="MFSSYILNVLYTLLRIYSFCIVVWCLSSWITVSNDSFNRILEGIG
FT                   KIVEPYLSVFRRVIPPISGIDLSPIVALFVLNLVGRFAISTLGLILI"
FT   gene            563587..564222
FT                   /locus_tag="Apar_0494"
FT   CDS_pept        563587..564222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0494"
FT                   /product="DivIVA family protein"
FT                   /note="PFAM: DivIVA family protein; KEGG: bha:BH2546
FT                   cell-division initiation protein (septum placement)"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50925"
FT                   /db_xref="GOA:C8W9Y7"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y7"
FT                   /inference="protein motif:PFAM:PF05103"
FT                   /protein_id="ACV50925.1"
FT                   /translation="MAITPADIEQQTFSPAETGYNPEEVDAFLEQLSSEVDAMLQKIAD
FT                   LKGRLTSTERQLAAAQAQVASLEENASVPSVEETNAAAVAASEHQISQVLIVAQQSADK
FT                   LVADARANAERIRNEADQKAREVIRQALAEKQTELDEIDRLKQSREDFRAEYRKLLQHF
FT                   LDDADSVFPETVLTNNAPTGSQNAAQSTANQTQISTSAPAAGDFNDLD"
FT   gene            complement(564299..565339)
FT                   /locus_tag="Apar_0495"
FT   CDS_pept        complement(564299..565339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abb:ABBFA_000396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50926"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50926.1"
FT                   /translation="MNPLNSDSSNQSVDLVSLVERLTRLSKSQKVVISCNPSLEGVVGT
FT                   VGLTYLSHANPTHVRLVRESFCQPGLEEYMLCVPDPSDDSVVALARRVLTGLEKKVGTK
FT                   EITRRIVLACASDAHTMPEIVHRYIRLAFLYGIGALEDIADPTVAEFNALARQVETERE
FT                   HTRQFIRFSRMSDGSFMSVFHPNANVVPLTCNYFVKRMSTERFFIVDPAHHIASFYTPE
FT                   MKTFGTIQLDDTSLKELLSRTDLATDEKYVQAMWRRFYDGVSLKGRGPTERGYDLRAHL
FT                   MPKRVWQELPELIASTSAEAARSQGIPTRYQGREDRKDIPHIEQKQHFSKNLSLSSKAI
FT                   TQEPIT"
FT   gene            complement(565311..566720)
FT                   /locus_tag="Apar_0496"
FT   CDS_pept        complement(565311..566720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0496"
FT                   /product="radical SAM family protein"
FT                   /note="KEGG: gme:Gmet_0124 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50927"
FT                   /db_xref="GOA:C8W9Y9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Y9"
FT                   /inference="similar to AA sequence:KEGG:Gmet_0124"
FT                   /protein_id="ACV50927.1"
FT                   /translation="MDTLDKLTILADAAKFDAACTSSGVDRDPQAGKIGMASTAGCCHS
FT                   FTPDGRCITLLKVLLSNACCYDCAYCVNRSSAQTKRATFTPQELAELTVDFYKRNYIEG
FT                   LFLSSGVIGSPDHTTELMIECLSYLRNELLFNGYIHAKVIPGTDSDLIDAIGRLADRLS
FT                   VNLELPSSTSLTKLCPHKNAETVTKPMSFIHHLRVSEERQLLEAKNTSKSIVKSAGKSK
FT                   GIIIPSQKQIIKEGLALRSNCLKNTFMHSSRVSSSKRSFSPAGQSTQIIIGASPESDNQ
FT                   ILHLSQALYQQFELKRVFFSAYIPVMEDDRLPELDTPVPLRREHRLYQADWLMRYYAFS
FT                   PDELVSPEAPWLDLEVDPKLGWALAHLDQFPIEIMDAPLEILLRVPGIGPTGARRIIAA
FT                   RRRSRLTFDDLKRLGIQLKRSHHFLTCCGVRDATAPLDQELIKQRVIADAKASSYNKTR
FT                   RRIESSQLRLF"
FT   gene            566845..568323
FT                   /locus_tag="Apar_0497"
FT   CDS_pept        566845..568323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0497"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: scl:sce1090 hypothetical protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: Polynucleotide
FT                   adenylyltransferase region; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50928"
FT                   /db_xref="GOA:C8W9Z0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z0"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACV50928.1"
FT                   /translation="MTCEGCILFSLVVAEGMVVGIEKNSSSPCLSRPVDLQVPTYALRV
FT                   LEVLENAGFEAWIVGGWVRDALRGSFAHDIDITTLATWQQSKAAFVAAGIPVHETGIAY
FT                   GTVTAVVEQHPIEVTTYRCDGEYLDGRRPDSVQFVSCIEKDLARRDFTINAMAYHPKRG
FT                   LLDLYGGQEDLSAHVIRSVGEPKARFTEDALRMLRALRFACRFSFSVEEKTHQALIECA
FT                   PLLSQVASERIGLEVAQIVEGGHIAHAIKLGFSVLAVAIPELLLLQNFDQRSPYHAYDV
FT                   LKHTARVCSATEAFTVGCATPILRWAALLHDIAKPEMFSVDADGRGHFYGHPEKGADVA
FT                   KVLLKRLALPQRLINEICALVALHDYDVDVTTASLRHMVALLAEVSKSDGITLAYDLLT
FT                   LKQADALAKAVPYRGYAVALERMFSLLKNEAKKGIAQRPQDLCISGADIMQALSITPGP
FT                   IVGAYQHKLFEAYLIGTVENRREELLALLAQLAK"
FT   gene            complement(568367..570547)
FT                   /locus_tag="Apar_0498"
FT   CDS_pept        complement(568367..570547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0498"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="TIGRFAM: YhgE/Pip C-terminal domain protein;
FT                   YhgE/Pip N-terminal domain protein; PFAM: ABC-2 type
FT                   transporter; KEGG: bcy:Bcer98_0357 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50929"
FT                   /db_xref="GOA:C8W9Z1"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z1"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ACV50929.1"
FT                   /translation="MKKIWTIFLADFKAVAHNTIALVVCVGLVILPSLYAWLNIEGSWD
FT                   PYGHTNEIKIAVANNDAGYQSDLIPVRVNIGERMVSKLSESTTIHYVITSKEDAEHGVQ
FT                   SGAYYAALLIPENFSQELLASLSGQENDASITYLSNQKLGAIAPIVTDKAAESARTEIE
FT                   RSFAESVTEVGAGLIGELTNNADDSNLSSVVTKLDETLVHGSNELRIAANHIGVYQGLV
FT                   DSAQQIIESTSDLSSSSSNTLSSAQETLLQAADGTQRMNDAATSATQAVDSALAQTSAS
FT                   FDTLNTSINDALDNASTTAGHAASNIQDAASRIEQVKSGYESLLTSLQSVKAALPTNLQ
FT                   GLLDAPIARLQGSIATLQNLQDELTNAAQSINDGISVSATQRAQINALLSQASSDLSTT
FT                   RSDLQTALKTSLTSISTSLTDVSNTTSTLSESLTQTLQDIQNIANSTANNLSAFSSTLS
FT                   KSKNQLTDLADKLDLIHAQLSEALSSKDIKTVRQILSASSSDLAEFIAAPTTLKRTAVY
FT                   PIENNGSAMAGFYTTLSLWVGGIILVAMLNTGITESLLKKTDAKPRHAYLGRLLTFSVL
FT                   GFLQSTLVGLGDLFYLQIQCVDPVRFMISVWFTSLVFVNIMYAFTYAFGDIGKAICVFL
FT                   LVIQVAGAGGSFPVQMLPESFQVINPLLPFVHAIAAMHENIAGYYSNVWISELGALSIF
FT                   LAASLMLGLVLRKPTAKLNAWIIEKLEDTKIM"
FT   sig_peptide     complement(570437..570547)
FT                   /locus_tag="Apar_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.458 at
FT                   residue 37"
FT   gene            complement(570549..573179)
FT                   /locus_tag="Apar_0499"
FT   CDS_pept        complement(570549..573179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0499"
FT                   /product="YhgE/Pip N-terminal domain protein"
FT                   /note="TIGRFAM: YhgE/Pip N-terminal domain protein;
FT                   YhgE/Pip C-terminal domain protein; PFAM: ABC-2 type
FT                   transporter; KEGG: bcy:Bcer98_0357 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50930"
FT                   /db_xref="GOA:C8W9Z2"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z2"
FT                   /inference="protein motif:TFAM:TIGR03061"
FT                   /protein_id="ACV50930.1"
FT                   /translation="MNVVWNIFLHDIKRILKNPIAVLVTIGVCIIPSLYAWFNIAANWD
FT                   PYKNTQTMPIAVVSEDVGAEVGSQGHINAGDLVVDKLKDNNQLQWTFVSKEEALDGVYS
FT                   GRFYAAVVIPSNFTQSLASVISGNLERPQIEYFVNEKLNPVAPKVTDSGAKTIETQINE
FT                   QFLSKVAEVISEHVVDLAGTISSQVISSETGLAGDLAQTSNNLNEISSNLAQTSTALAD
FT                   AQTTLAHTQSTLDILIKTSDSSHQTLDDITSQLTQARNDTTTLASKLSSALAVGSTQLT
FT                   DASNKANTAVGVITGRVSTALSTAEGSVTSAQSLVQSHQQLLQELLALRPLVPTFQQSQ
FT                   FDSVISTLTTQVSNEQAALVRVQVAVSDLEANNNSLSSVSNSLNNTITTSVSAAADAQN
FT                   TLATTTIPGLNAAYDSFWGAANTLSSTTASIKPTLLQIKAILSQLENALAQAQDASQLT
FT                   QNSLSNSAKTFSNLAADASLIQSSEFMKLLQNTMTLEPSDIAAYMAKPVTLTNQVVYPV
FT                   ANYGSSVAPFYTNLALWVGGFVLIAIYKLEVADKEIGIVTPWQAYFGRWILFMILGISQ
FT                   ALICTIGDLAMGIQCVSPAGFIFAGIIESIVYVNIIYAFSIAFKHIGKGLCVLFVILQI
FT                   PGTSGLYPIEMMPGFFQAIHPWLPFTYGIAAMRESVGGYFETTYATQLALLACFIIPAL
FT                   IIGVVLRRHLLNINALFDKKLSETGFMIHEQKPLTKRHLSLSTITSALAQSDITTVQVQ
FT                   KNGEKFRTKYPALKRAGIVYLLALPLILTVIMFGASQKLSWLIVWVISIVIGLTYLIVI
FT                   EYINESINYKNSMSELSKNEMLVLLQEEYGSENGAQRSFINSSIADDNSSMSSPNTSAT
FT                   SKQGE"
FT   gene            573405..574130
FT                   /locus_tag="Apar_0500"
FT   CDS_pept        573405..574130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0500"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   afw:Anae109_2507 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50931"
FT                   /db_xref="GOA:C8W9Z3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV50931.1"
FT                   /translation="MSEKNTDVVADVMTYLAHAHNHTQEVVGTVAASVSHIRAEARTKK
FT                   SATTRKRIMHETTELMLARGNTNFKMSEISQRAHLSKGALYYYFSDREALLQAIFDESV
FT                   DELAKDIARSIENKPASVETLHAIVTELASHILPDSPLVLALINKLASSEQALITNIEG
FT                   PLSRVVVLLVSQLELGKERGFVRKDINSRLAACSITGALVLSAIGLMGERRGAEDSSQL
FT                   SQDLLSLMLTGIGLDAKTH"
FT   gene            574248..575510
FT                   /locus_tag="Apar_0501"
FT   CDS_pept        574248..575510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0501"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: bcr:BCAH187_A4904 S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50932"
FT                   /db_xref="GOA:C8W9Z4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z4"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACV50932.1"
FT                   /translation="MAHKNYLFTSESVTEGHPDKVCDQISDAILDAILAKEAELEERGY
FT                   VSPSGVPACLDNVRCACETFATTGTIVVAGEIRTQSYVDVQEIVRNTLRNIGYDRAKYG
FT                   FDCETCGVLSLIHEQSPDIAQGVDQSFDTQAGRTTDPLDLIGAGDQGMMFGFASDETDV
FT                   LMPMPAYLAQRLAQRLSEVRKSGEVEYLRPDGKTQVTVRYEDEKPVEVTAIVVSTQHAP
FT                   EIEDMSIIKQDMIDYVIAPVMGEVNIAWDNADIYVNPTGRFVVGGPMGDTGLTGRKIIV
FT                   DTYGGMGRHGGGAFSGKDCTKVDRSAAYAARWVAKNVVAAGLAKKCEVQLAYAIGVSHP
FT                   LSIMVDTFGTGIVDDAVIEQAIEKVFDLRPGAIIRDLKLRRPIFFKTAAYGHFGRKDPD
FT                   FTWEATDRVQELKNAVSALQA"
FT   gene            complement(575516..577702)
FT                   /locus_tag="Apar_0502"
FT   CDS_pept        complement(575516..577702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50933"
FT                   /db_xref="GOA:C8W9Z5"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50933.1"
FT                   /translation="MWLEFFQSAVVIVALLYVPGVILLHASGMSKPWAFVTAPLVSCAL
FT                   YFIEGEIFSALNIPVPLAVMILVPLLIAALVNGYVYYVASKNKEDHRGEKPIKSKASRA
FT                   VKQPTYRMPSFVCEELPFWIPLLYVTIGLLTVGLLFLPTLPSASSFVQGWDIVHHLDVT
FT                   QAMIESQKYSSIHYDFYSTIEASITPWEPGASGFYPSGWNIIVALTTQLVSTTVPIAGN
FT                   ALNFVSAAIIFPLSICSLIAKVLPKHRIALTSGAFVCLAFFVFPWSLLIYGPIFPNTVA
FT                   FCVMPSIWWIFMQMTRSKTPKHDLIWLVIIFILGCITLFVLHPSTIFSSIVVLLPWSFA
FT                   RIGESKRKVVLFGKRVKPVTLAYAFFIFALVIWSVFYYVLIIRGVALNFWWSAYSSLQD
FT                   AILHALGMDFIGQSYAGGEVVSPQPILSICVLVGAVWTFKHKQARWMVSAFLYLSILCI
FT                   FIITFDVPLKGYLSGFWYTDPFRIAASCIIMAIPLAALGLATLVEAALETFSTCREKLS
FT                   QYQSQGQGQAKNQAKTQTCVFYNIWAKPLIAGAVIACVVALNYVIPMPNLKSEEPIPAA
FT                   LAFKQASEKAYGDHYILTSEELEFLRRVELTVPSGAVIANLPQDGSLWAYGTNNIHVLW
FT                   RFPNGYDASERPASAILRKRLNRIASDPEVLQTAHDLNVQYVLILNNVVDYSNAVTSTY
FT                   KPGTFRGITQITNTTPGFEVVLEEGSMRLYKITL"
FT   gene            complement(577858..577934)
FT                   /locus_tag="Apar_R0012"
FT                   /note="tRNA-Glu1"
FT   tRNA            complement(577858..577934)
FT                   /locus_tag="Apar_R0012"
FT                   /product="tRNA-Glu"
FT   gene            complement(577954..578027)
FT                   /locus_tag="Apar_R0013"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(577954..578027)
FT                   /locus_tag="Apar_R0013"
FT                   /product="tRNA-Gln"
FT   gene            complement(578144..579793)
FT                   /locus_tag="Apar_0503"
FT   CDS_pept        complement(578144..579793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0503"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /note="TIGRFAM: L-serine dehydratase, iron-sulfur-
FT                   dependent, alpha subunit; L-serine dehydratase, iron-
FT                   sulfur-dependent, beta subunit; PFAM: serine dehydratase
FT                   alpha chain; serine dehydratase beta chain; amino
FT                   acid-binding ACT domain protein; KEGG: bha:BH2496 L-serine
FT                   dehydratase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50934"
FT                   /db_xref="GOA:C8W9Z6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z6"
FT                   /inference="protein motif:TFAM:TIGR00718"
FT                   /protein_id="ACV50934.1"
FT                   /translation="MISMSAFEVLGPIMVGPSSSHTAGALRIALVARSLAPKQLEHVEF
FT                   WLYNSFSHTHLGHGTDYALIAGILGLAPDDTRVREALALAEEAHLNYSVIEKGDDETLH
FT                   PNTVEIHLYGADNAHVSVMGESVGGGRIRISGVNGARIHMSGDMPTIFVSHRDKPGVLA
FT                   ALTTILATQNINVATMRTFRSERGGFAHTVFEIDEPIEQKVLDLFQLAPHVSYAAQVSI
FT                   PGAAPQVTNDVLSGAFDNGADLLARCSKTGASIGQIMRQREKGLRPNANVDAEMTHVLE
FT                   IMRDEVHDTIKTPRQSIGGLLNGQAKTVANTPPAISNTLMGTTQTRAIAYAMAVLERSA
FT                   TMGVIVAAPTAGASGVVPGSLISVAEEIGATDEQVISALWNASAIGAILTTNASVSGAE
FT                   GGCQAEVGSAAAMSASALTELLGGTPQQCLDAASIAISNLLGLICDPVRGLVEYPCQDR
FT                   NAIGVAAAISSSQLALAGVGNPIPFDEVAHAMAEVGAALPVSLRETAKGGLAATPSAPT
FT                   ACASCTGCVSLDQTLLDAERILNANNKDVPCA"
FT   gene            complement(579927..581441)
FT                   /locus_tag="Apar_0504"
FT   CDS_pept        complement(579927..581441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0504"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: GTS2;
FT                   non-discriminatory gln-glu-trna synthetase; K01885
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50935"
FT                   /db_xref="GOA:C8W9Z7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z7"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ACV50935.1"
FT                   /translation="MSEKQVRVRFAPSPTGKLHIGGARTAIYNWAFARANGGKFILRID
FT                   DTDPTRSTEENTQIILRAMKWLGLDWDEGPDKGGDCGPYSQTERLDLYREAANKLLAEG
FT                   KAYPCFCTPEKLAEDKKAAEERHDPFQGYQRTCRNIDPAEAQRRIDAGEPYTIRIKVPL
FT                   DRGDVIVHDAVHGDVTFNARELDDFIIFRSDGTPTYNFATVVDDADMGITHIIRGDDHL
FT                   SNTPRQIMVYEALGAPVPTFAHISMILGPDGKKLSKRHGATSVEEYRDQGYLADAFVNY
FT                   LALLGWSLDGETTIVPRDVLASQFSLDHVSKNPAKSDPERLNWINATYLANMDNQTFAQ
FT                   TVLIPELVSAGLEPVQGNATDADEIYATRPGWYDLLSEILRPRTTVSPDVIEKSRFLYE
FT                   GANVTFDQKSVEKGLTKDAAQSATVLTAAKTALEGVSEEEWKAAAIDAALEVLPEQLDL
FT                   KKRVVFQSIRVAECGNMVSPPLGESMELLGREVCLARLDRAMELCK"
FT   gene            complement(581534..582502)
FT                   /locus_tag="Apar_0505"
FT   CDS_pept        complement(581534..582502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50936"
FT                   /db_xref="GOA:C8W9Z8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50936.1"
FT                   /translation="MDINQAIEHANAFVIPGLLVDDQSIIGEINKNCDAIKTLFDAWKE
FT                   APLGQEPVEFSVIQQLADRTRSLCDTYGVERLRNHRGVGLSRGLSNDDLAAAVAKMQRR
FT                   RPKAVYKTAGPLLNDLQIAYVEKSVSGTVLGIDIETTSRFPELGYIVNVGFEFWNLGRN
FT                   TVPVEPHTAYFGIPEIYKEKGVPLADIHQITWKDVEGKKSFRDDKKAQEALLTTMKKIP
FT                   FMAHNAAFEDSWFMFNIDGYAEARKAGKIIVIDSRDICRRLDPEIRSLPRESSPAALEN
FT                   WARRRHTLAADEKERHLGLEDVDLMIRTVQAEFADHNMFED"
FT   gene            582659..584017
FT                   /locus_tag="Apar_0506"
FT   CDS_pept        582659..584017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0506"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   mca:MCA0961 putative aminopeptidase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50937"
FT                   /db_xref="GOA:C8W9Z9"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C8W9Z9"
FT                   /inference="protein motif:PRIAM:3.4.11.21"
FT                   /protein_id="ACV50937.1"
FT                   /translation="MSDLHESLALSEELLAFIKQSPSMFHTTQTIKDYLLENGFTYLSE
FT                   GSSWDVQPGGSYFTTRNNSSIIAWKVGEKYREAQTSNADTPYHFQLAVAHGDSPTYKVK
FT                   AQPELTGEGNSLRLNTEAYGGMLDHTWFDRPLGVAGRVLVKVGNKVESRLVNIEDDVVM
FT                   IPSLAIHLEHKNGLSPEFNRAKDLMPLFSVGELNPGAFNALVADAAGASQEDILSRDLF
FT                   LVDHTGGRIWGAKKEFVSAGHLDDLQCAFVALKAFLASSNEQDISVYTCFDNEEVGSNT
FT                   KQGAKSTFLKDTLQRVNATLGFTQEDYYRALSASLLVSCDNAHAVHPNYPEKHDAANKP
FT                   YLNGGMVIKEAARQSYCTDAFSRAIVEAIWKQQNVPYQIFANRSDMPGGSTLGNLSNIQ
FT                   ASMHAVDVGLPQLAMHSVYETAGTKDTLLGYQALKAFYDTCVCITDADSFELR"
FT   gene            584091..584846
FT                   /locus_tag="Apar_0507"
FT   CDS_pept        584091..584846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0507"
FT                   /product="spermine synthase"
FT                   /note="KEGG: sfu:Sfum_1332 spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50938"
FT                   /db_xref="GOA:C8WA00"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA00"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1332"
FT                   /protein_id="ACV50938.1"
FT                   /translation="MSEKQLTAHDMELLICAGIYVEPQTLSGPALVFPISDGEGGEIRV
FT                   LWQGGAYESATYTDSRKNQLVFPYLELYDLLFEAACPVHSVLMIGAGGCSYPRYLVAHH
FT                   PEVSCDALEIDPKIAALARSHFFVDEAIRESNNRLQLQIADGVEYIKSLSTSNNKHYDA
FT                   ILNDCFIGEAPPAAMMTVEWMSLVAQCLTPGGRYLTNVVSAQVGEDAHQLEALMDAARM
FT                   VFEQVKVVPLDLEVDPTEPDNLMLVCQRA"
FT   gene            585039..586670
FT                   /locus_tag="Apar_0508"
FT   CDS_pept        585039..586670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0508"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hhe:HH0684 multidrug resistance protein MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50939"
FT                   /db_xref="GOA:C8WA01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA01"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50939.1"
FT                   /translation="MKESFLSIKEIFHIGNGKINVLVFLAVLAVISSFLEIYSIQYMQS
FT                   LSKVFSTTVSNDLFQIGFICAKFLMLIVLSTIVRNYFCFRVSVFSNDIIKNVRDKAYSK
FT                   LTDTEYELAIIHDNAFYINLIDNNVNKLSLIFSTSFFTLCSDIFDTVWICFFMIQINIT
FT                   SLLILIVGILPLVLIGNISASEQKKFAENTIKLNEDLIEKINETNDNFSYIKLFKGKER
FT                   EANRFNRINIDILENDNLSSAALSIFFVIEKSIRYLFVAISLFFLCKDVLAQDGNWMIL
FT                   IPFLLYVQRFYNPFSNLNKYSQLIQKSVSSADKLIDFIISKPTEEISTIQFISDSSESE
FT                   IVLSGISKNYESETILEDVTFSFKEGINLIDGKSGVGKSTLLKILLGLIKSSSGKVTIY
FT                   SRADDLNLYAYSGQSNKLFNLSVIENLIYPKTVDHLSSSERMKLESLLDEFGFRKSILN
FT                   KDIAKEGENLSGGERKRLSILRALIRPSKVVILDEPFANLDSNNIEIIARKIQDLSKNR
FT                   IVIIVSHETSFPDSLKFNTHLTISGT"
FT   gene            complement(586737..587999)
FT                   /locus_tag="Apar_0509"
FT   CDS_pept        complement(586737..587999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0509"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   swi:Swit_1701 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50940"
FT                   /db_xref="GOA:C8WA02"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA02"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV50940.1"
FT                   /translation="MLQRLLGTKYAYAIVATCIVIMFLPCAIILTCFGIFITPVSNYFG
FT                   VPRVAFSAVFSVLCIAMTIALPFIGKFYKSHDTRLVLSASVIICAASYGAMSAAQEIWH
FT                   FYLCAVGLGIGVPALMFLCVPALINDWFDQRVGTFMGLCFAFTGIGGTVFNPIGSAIIS
FT                   SSPEGWRACYLIFALVMLVGTLPFTLFVIREKPQDLGLTPLTFSSIGEKNVEVEETTST
FT                   DISADDAMKYPEFYMVAAFYALITLNQQISQYFPSYAATFAETAPAIAAATGLLAGATM
FT                   LGQAIGKVLLGALSDISVKLACFVGIFSGIVSLLMLGIKLPILPLLLAGTFLFGIAYAL
FT                   TTVGSPLLVRTVFGKKDSTLIYSRIAGVSCFVSACALIIWSLIVDGSAHGFLVLFGIGI
FT                   VLMSTCLALALTALKRADKRA"
FT   gene            complement(588153..589751)
FT                   /locus_tag="Apar_0510"
FT   CDS_pept        complement(588153..589751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0510"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: Domain of unknown function DUF1858; PAS fold-
FT                   4 domain protein; Hemerythrin HHE cation binding domain
FT                   protein; KEGG: dvm:DvMF_1059 putative PAS/PAC sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50941"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA03"
FT                   /inference="protein motif:PFAM:PF08984"
FT                   /protein_id="ACV50941.1"
FT                   /translation="MAQVLDLSKSVYEICTKFPVIKGLMAENGFAEITEPGRLQTMGRF
FT                   MTIPKGCDHKGVDLEELKAIFRSHGFTILGDEEPIAADTPSDEKPADTEATDAPIAQTP
FT                   KERKALIAQYLERLNDGEDIEAVREDFARNFKDVSGSEISTAEQELIAGGVPMEKVLKL
FT                   CDVHAALFEGKVSCAPTGAAEETPGHPVWTMRQENDRILAFIHDRVAPDVRRARTLNES
FT                   SSNEECAGVAAILKADMDAFDEVFVHYKRKEELLFPHLERHDITGPSKVMWGKDDEVRN
FT                   AVNGAEALLETAYGQYDAGLMAGVADYLDEAIEGAESMASKEENVLIPLSLEHLTATQW
FT                   TQIAAEENEFGHAFGVNPPSWHADPLELANDKLKEMEAAGAMGENNAEAEEEAISADGK
FT                   VKLSTGEFTIPQLEAVFATIPLDITFVDADDKTRYFSHGDTRAFPRPKSCLGRDVYDCH
FT                   PPKSQEAVRRILTEFKSGKRDCSEFWFEVKDKFLYVRYFAVRDEKGNYLGALETTQDIG
FT                   PIRALEGENRRGSDS"
FT   gene            complement(589911..590189)
FT                   /locus_tag="Apar_0511"
FT   CDS_pept        complement(589911..590189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0511"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: sun:SUN_2119
FT                   DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50942"
FT                   /db_xref="GOA:C8WA04"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA04"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACV50942.1"
FT                   /translation="MAKVSTNINLDPTLKKNAQELLRDLGMDLTTAITIFLRQTVREQG
FT                   IPFEIKREIPNAQTIEALNEYSNMKEHPENYKHYASFSDAMSEVLDA"
FT   gene            complement(590308..591483)
FT                   /locus_tag="Apar_0512"
FT   CDS_pept        complement(590308..591483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0512"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bcz:BCZK4801 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50943"
FT                   /db_xref="GOA:C8WA05"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA05"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACV50943.1"
FT                   /translation="MKRVLSLSLKFITGLLKRVLAPLFKFVGGLFILALLVLGGYVLYL
FT                   QFTYYRIPDNTSISNQGASPEATTVQVGQTYTASTYNIGFGAYTPDYTFFMDEGIMQDG
FT                   TRTVGTHGRAVSRNSVLYTTNGALTTVSSLNGGAAPDFILFQEIDTSSDRSWHVNQVSE
FT                   AENRFSSYASYFAQNFHTAFLAYPLTEFHGTSNSGILTLSNVLASSATRRTYPIDESFP
FT                   TKFFDLDRCFMITRYPTSDGHELVLINSHMSAYDKGGTSRAQQLALLTKVMSEERAKGN
FT                   YVIAGGDWNHAILGSLTLYPSIQQVPDWVAELKKSDLPEGFTVVAPDNLNNVPTCRGDD
FT                   IPYEKDKTYTTTVDGWIVSDNVVATAKNVDTQFAYSDHNPVLLSFTLKSAE"
FT   gene            591561..592712
FT                   /locus_tag="Apar_0513"
FT   CDS_pept        591561..592712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0513"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase;
FT                   aminotransferase class V; KEGG: bsu:BSU31400 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50944"
FT                   /db_xref="GOA:C8WA06"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA06"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV50944.1"
FT                   /translation="MSLLRNTTLELFKLSGIRRFSALAAATPGCISLTIGEPGEDTPSS
FT                   ICNQVDKELAAGNTHYPPNIGTPELRSAIAAWESARGMKVSPDGIVVTVGATEAISAAM
FT                   LTLMNPDDEVIIPEPAYLVYRTLCQLNRGVVVPLDTSGNHFQIDSEQLKSKISEKTKLM
FT                   VLTSPNNPTGCVYTKESLDAVAELARKHGFYVLCDDVYRELTYVQNVPRFAELYPDLAD
FT                   RCIVTNSFSKPWAMTGWRLGWVATSDELAADIGKVHAQLVSSVPSFLQPAALYALSYDV
FT                   TPMRTNYQKRRKIVLSALEDMKLPVEEPEGAFYAFPSIKEFAIDSEAFCERAIKEFGVA
FT                   LVPGVFFGAEGYVRISYAASDKNLTEGLSRLKIFVNTLREEQN"
FT   gene            592941..594245
FT                   /locus_tag="Apar_0514"
FT   CDS_pept        592941..594245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0514"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG: ddcA;
FT                   Orn/DAP/Arg decarboxylase 2 domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50945"
FT                   /db_xref="GOA:C8WA07"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA07"
FT                   /inference="protein motif:PRIAM:4.1.1.20"
FT                   /protein_id="ACV50945.1"
FT                   /translation="MSKKPFVSADALEVITKTYPTPFHLYNKAEIVRRAKLLQEAFSWN
FT                   TGFKEYFAVKATPNPYIVKLLAELGCGCDCANATELTLAKACGVTGQNIMLSSNDTTVL
FT                   DFARAHELGAIINLDAGGDMLTTLEDAVGSTMPQVMCARLNPGGVFESQNGIIGNPDDA
FT                   KFGMTEEQLFQTFAYLKTKGVTEFGLHAFLASNAQEEDYYPNLARVLFELAVKLHRELD
FT                   IHIGFIDLSGGIGVAYEPNQVEPDVLAIGQGVKCAFEEVLVPAGMGDVSIYTELGRWLL
FT                   GPAGALVTRVLHQKETYRHYLGVDACAANLMRPAIYDAYHHITVMGKEDAPATHTYNVV
FT                   GGLCENNDQFAKNRQLPKVAVGDLLFIHDTGAHGFSMGYNYNGRLRSAELLLLEDGSVQ
FT                   LIRRAETEADYFATLAFDGSDFSDLAQQTSINTTR"
FT   gene            594261..595154
FT                   /locus_tag="Apar_0515"
FT   CDS_pept        594261..595154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0515"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: pap:PSPA7_4387 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50946"
FT                   /db_xref="GOA:C8WA08"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA08"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ACV50946.1"
FT                   /translation="MDMKNITGAITALVTPFDAQGNVDFEALEHFVDFQIEQGIDGILA
FT                   LGTTGESSTMTDEEDIEVVKTILARAQGRVPVIGGAGSNSSAESLRKAEALEKAGVDGL
FT                   LLITPYYNKSNEEGIYQHFSYVLDRVDVPCILYNIPGRTGCSISERNVQRLAAHPNAWG
FT                   IKEASGDIAYATRVARYLSDDFTMWSGNDDMIVPLLSLGASGVISVWSNLDPKMVHDLV
FT                   AAWHRGEISLARELQLQYLDLVHALFCEVNPIPVKAALARMGLMEENYRLPLWKMTEEH
FT                   AEVLENAMRKAGLLDA"
FT   gene            595147..595863
FT                   /locus_tag="Apar_0516"
FT   CDS_pept        595147..595863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0516"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="KEGG: nis:NIS_1548 dihydrodipicolinate reductase;
FT                   TIGRFAM: dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50947"
FT                   /db_xref="GOA:C8WA09"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA09"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ACV50947.1"
FT                   /translation="MPSAVVIGTGKMGKLIEQTLIDHGFEVLGAFGHENINQLNTVVQT
FT                   PDVVVDFSGVAAFDAVVGFVRERGCALVSGTTGFSPEQLSELKQLGESAPVIHAANYSV
FT                   GVAVLRRAVTMAAEALNGWDTEIVETHHNQKVDAPSGTAKLLLAAIDPEGTRPVVSGRE
FT                   GFCGARTKDEIGVFALRGGTVAGTHEVHFFGQDEEVCLMHRATSRQIFVNGAVACAEKL
FT                   LTKAPGFYTFEDLIFG"
FT   gene            595918..596619
FT                   /locus_tag="Apar_0517"
FT   CDS_pept        595918..596619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0517"
FT                   /product="Tetrahydrodipicolinate succinyltransferase domain
FT                   protein"
FT                   /note="PFAM: Tetrahydrodipicolinate succinyltransferase
FT                   domain protein; transferase hexapeptide repeat containing
FT                   protein; KEGG: bha:BH2669 tetrahydrodipicolinate
FT                   succinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50948"
FT                   /db_xref="GOA:C8WA10"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA10"
FT                   /inference="protein motif:PFAM:PF08503"
FT                   /protein_id="ACV50948.1"
FT                   /translation="MDAQEIINYIATSEKKTPVKLYVKEREDASVSYGSSRVYGEGTSK
FT                   VVFGDWSELKSVVEQNADAFEYFDIENDRRNSSVPLLNMKDVNARIEPGALIRERVEIG
FT                   DNAVIMMGAVINIGAVIGEGTMIDMGAVLGGRATVGKNCHIGAGTVLAGVVEPASATPV
FT                   IVEDNVLIGANAVVIEGIRVGEGAVVAAGAVVVEDVPANAVVAGCPARVIKMKDQKTEG
FT                   KTALVDALRTL"
FT   gene            596630..597847
FT                   /locus_tag="Apar_0518"
FT   CDS_pept        596630..597847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0518"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: gur:Gura_1716 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: queuine tRNA-ribosyltransferase; tRNA- guanine
FT                   transglycosylase, various specificities; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50949"
FT                   /db_xref="GOA:C8WA11"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA11"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ACV50949.1"
FT                   /translation="MPDGSKKAQGFTTKISCVYTENWAEKKEDSWFTYELLAEDPKTHA
FT                   RAGVFHTPHGDIPTPIFMPVGTKATVKGLMTDTVRDLGAKIILANTYHLSQRPGDELVA
FT                   QMGGLHDFMQWHGPILTDSGGFQVFSHEEFMKLSDEGVKFRAVDYDGAWSYWTPETNMQ
FT                   IAQNLGADIVMQLDQCVGYPAERKKVERGVELSSAWAERCFKAHTRPDQALFGIVQGGM
FT                   HLDLRKRSIEHLESIGDFPGYGIGGYSVGEPHELMFETLAPLCADYMPRNKPRYLMGVG
FT                   NPSTLIRGVACGIDMFDCVLPTRTARMGTAFSHEGRMNLKNAKYFADAGPIDVKCTCPV
FT                   CTGGYSRAYINHLVKQHEMLGGQLLSMHNIYFLLELMRQAREAILAGTYSDFVEEWENS
FT                   EGVVDF"
FT   gene            598042..601404
FT                   /locus_tag="Apar_0519"
FT   CDS_pept        598042..601404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0519"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="KEGG: bsu:BSU27620 hypothetical protein; TIGRFAM:
FT                   single-stranded-DNA-specific exonuclease RecJ; PFAM:
FT                   phosphoesterase RecJ domain protein; DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; phosphoesterase
FT                   DHHA1; SMART: helicase domain protein; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50950"
FT                   /db_xref="GOA:C8WA12"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA12"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACV50950.1"
FT                   /translation="MPGIEKSTRWSVLTQDVYLESLFEKELHVTPLVARVLVARGFTDV
FT                   AEAQEFLSPSLQRDWLDPQCIPGMAEVANRVQKAIVEQQKIAVFGDFDVDGMSSTCLLT
FT                   LALRRLGADVLPYIPHRFGEGYGLSKEALARVLLDRKPDLIITVDNGIAAAQEVAWLLE
FT                   QGIDVVITDHHEPADLVPQGVPVTDPKLIEDCPSRELAGAGVALKLVQVLGQLQNQPQL
FT                   WLDYIDVAMLGTLSDMMMLNKENRALVSEGVKRLQKGLRPGLVALAAVAGQDIAQISAD
FT                   NLPFSIIPRLNAAGRMGTTDIALDLLLTEDAEEATILAGKLEEINAERRAIEAKLTDEA
FT                   LEQAKEIYDGGHAIVLAKEGWHEGVKGIVASRIVNRYHVPCILFTIQDGVARGSGRSVG
FT                   SVDLFHAVEQCADLTVRFGGHQGAVGVTVETSKIDAFRKRLSEVMAELPEEEFESSGEV
FT                   TALVNLDEITINSIDALEALQPFGQGNKKPLFGVKGVVMKNRSRVGAGGAHLCFMASNG
FT                   ISSISSIMFRTPHVEAAAEYDGAVDLIFEAVNETWQGRTKPKLMVRDILYRDFTDEDDG
FT                   PIEADLLGSAVDLPLVVTKEATETEEASQEQSQQKRHELESLPYEELTQTLVTSMIGSR
FT                   ELLPLQKKTLEVLSQGESCLSVMATGRGKSLIFQVYAACVALLQHKMSVFVYPLRALIN
FT                   DQVQSMKNTFEPLGISVEVLNGETDLTSREDLFARMANNELDIVLTTPEFFSLHADQFA
FT                   AAHNISFVVFDEAHHVGMNASEGRLAYAQMPQVLKMLGNPQVLATTATATTQVAQRICE
FT                   LLSIDADHVYKDKTARTNLELKDLRSAKDRECALLSLVSDGTKTVVYVNSREQAQALTR
FT                   MLRHRIPEIGHKVAFYHAGLTPQIRKNVERAFRRGDVCCIIATSAFGEGVNISDIRQVI
FT                   LYHLPFGRVAFNQMSGRAGRDGKPSKIYMLFDAHDMRVNERILSSRAPQREALVAVYRA
FT                   LTALQPKLVAQPTNPALTDEDIAQMALEIDPRSKADEQIVRVALDVFVELGFISIEGFD
FT                   QTRVISVNSQASHMDLLESARYAEGLKAHTEFESFAQWVFSASLDELADAITKPIVPEI
FT                   GPIFDGGRESSNE"
FT   gene            601397..603742
FT                   /locus_tag="Apar_0520"
FT   CDS_pept        601397..603742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0520"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: bha:BH1242 GTP pyrophosphokinase (stringent
FT                   response); TIGRFAM: RelA/SpoT family protein; PFAM:
FT                   RelA/SpoT domain protein; TGS domain protein; amino
FT                   acid-binding ACT domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50951"
FT                   /db_xref="GOA:C8WA13"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA13"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACV50951.1"
FT                   /translation="MSDERTKKEVKAPGADNYRLLEGAVRSYLPEEAQTKIAAAYTFAA
FT                   DYHKDQRRRSGEPYINHPVEVALILAHDLHMDEDTICAALMHDTVEDTSASLDEISSRF
FT                   GKSVAELVDGVTKLTSIEVSSMDEKQALNLRKMFLAMSKDIRVVIIKLADRLHNMRTLA
FT                   ALPPDRRLFKARETMDVYAPLADRLGISSVKWELEDLSFFWLEPEEYQRVARMVSDSRA
FT                   QRENDLNNAKKTLTDELNAAGITDFQITGRPKHLWSIYQKMVRKGREFSNIYDLIALRV
FT                   ITKNVGDCYSALGAIHALWHPMPGRFKDYIATPKANLYQSLHTTVIGPDGRPIEIQIRT
FT                   AEMHEASEYGIAAHWLYKEEGNSKGKMSSEDKLIDSTINWIRRSLDWAVEDDIDDPHEF
FT                   LDNLRVDLFEHEIFVFTPKGEVMSLRVNSTPLDFAYAVHTEVGNHCVGARVNGSVVPLT
FT                   HTLQMGDRIEILTNKNARPSRDWMTLVKTPSARAKIRKYFSQENKSDDAERGRSELAKE
FT                   LRKHGYGISATRTIKALDQLIEQFDYRSVDDLFAGIGAGNQSVKQVVNRVSEILEEKNP
FT                   EIVTEQERNAARLQEKNKAIANDQPLVRSYVISRTAKGSRPKKSNCGVVVNGDPDLLVH
FT                   LAHCCNPVAGDDIVGFITRGRGVSVHRANCPNVKDLSNDPKRIIPVSWDASGATEFRVE
FT                   IVVEATDRMGLLKDVTVALSDAGANILSAATQVGEQGVVRMRFLVSISDTSLLDTLFAF
FT                   VTRVPSVYDARRIMPGEGANQMRRRLYG"
FT   gene            603735..604511
FT                   /locus_tag="Apar_0521"
FT   CDS_pept        603735..604511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0521"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dol:Dole_2072 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50952"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA14"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV50952.1"
FT                   /translation="MANQNEGCSCGHNHEEEHGRHGGCCGHHGEHGHGEHGHEGCCGHH
FT                   GHGGCHHAKDQIGIFKVGPLETNCYIYVSGNECMIIDPGASGAEIAAQLLNLELKYIVA
FT                   THGHADHVGGVKALKLAVSSAQYLINEADNELAQRAHNSNDIYDDAPEPDGILHEGDVL
FT                   SVGTAQFKIMETPGHTPGGIILVGEGTASGAVFVGDTLFQGSAGRTDLPGGDFDTLKVS
FT                   LNRIKTELDPTSIILSGHGNQTSLEAELATNPFLQD"
FT   gene            604585..604668
FT                   /locus_tag="Apar_R0014"
FT                   /note="tRNA-Leu2"
FT   tRNA            604585..604668
FT                   /locus_tag="Apar_R0014"
FT                   /product="tRNA-Leu"
FT   gene            604917..605498
FT                   /locus_tag="Apar_0522"
FT   CDS_pept        604917..605498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0522"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: dde:Dde_2638 translation
FT                   initiation factor IF- 3"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50953"
FT                   /db_xref="GOA:C8WA15"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA15"
FT                   /inference="protein motif:TFAM:TIGR00168"
FT                   /protein_id="ACV50953.1"
FT                   /translation="MYKIAKNDGPRINEEITARTCRLIDADGSQLGLFGVNDAMKRARE
FT                   HGLDLVEIAPNAEPPVCKILDYSKFKYEQARKAKAARKNQVKIEVKEMKFRPKIDVGDY
FT                   ETKKGHVLRFLKKGARVKITIMFRGREMAHPEQGRIVLDRLAEDLKPYATIEQKPLIEG
FT                   RNMHMLVAPIKGAFDEKPEGAEDSTTQEEK"
FT   gene            605500..605700
FT                   /locus_tag="Apar_0523"
FT   CDS_pept        605500..605700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0523"
FT                   /product="ribosomal protein L35"
FT                   /note="TIGRFAM: ribosomal protein L35; PFAM: ribosomal
FT                   protein L35; KEGG: bsu:BSU28860 50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50954"
FT                   /db_xref="GOA:C8WA16"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA16"
FT                   /inference="protein motif:TFAM:TIGR00001"
FT                   /protein_id="ACV50954.1"
FT                   /translation="MPKMKTHKGSAKRFRRTGTGKIMRAKAFKSHILTKKSQKRIRGFR
FT                   KEAVLSAGDAAVVSQRMGAKN"
FT   gene            605742..606101
FT                   /locus_tag="Apar_0524"
FT   CDS_pept        605742..606101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0524"
FT                   /product="ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20; PFAM: ribosomal
FT                   protein L20; KEGG: ilo:IL1396 50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50955"
FT                   /db_xref="GOA:C8WA17"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA17"
FT                   /inference="protein motif:TFAM:TIGR01032"
FT                   /protein_id="ACV50955.1"
FT                   /translation="MARVKRAVAGRKKRQTLVERTKGYYGTSSRTFRGMKEQSQHSGQY
FT                   AYRDRRNKKRDFRALWIQRINAAARINDLSYSKFMHGLKLAGVELDRKVLAEIAYSDEQ
FT                   GFADLAEIAKKALAE"
FT   gene            complement(606675..607895)
FT                   /locus_tag="Apar_0525"
FT   CDS_pept        complement(606675..607895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0525"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   bcb:BCB4264_A5322 glycosyl transferase, group 4 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50956"
FT                   /db_xref="GOA:C8WA18"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA18"
FT                   /inference="protein motif:PRIAM:2.7.8.13"
FT                   /protein_id="ACV50956.1"
FT                   /translation="MNLWVTMFCVFLSAGLGSALITPAVRQLAWKLGVVDKPSARRVNK
FT                   KPVPRMGGVAIFFGLAVAMLVRYGVEAILGHAEITFSSHYYLNVNFWIVGAAFVVIFLT
FT                   GLLDDIFSLKPIQKLAGQFIAASIAAADGLIIGNVVDPFTAYGFVDLGWLAYPATVIYL
FT                   VAYANIINLIDGLDGLSSGITCIASTTMFVLSIWAGRFDAALLSAAIAGTTLGFLVHNS
FT                   YPATIFMGDSGSLTLGFALGTISLLSVTRWAGLTTIIVPLVVAGIPIIDTFSAIVRRTR
FT                   AHVSFATADRGHIHHRLMAHGYNQRQAVLLMYGWTSLLCVGSLIMTQVNTIPRIAIFVL
FT                   LLTMSALFAKYLHLFEPVLLHHTDPKTGEDELIDPKDPDFDKEIKQFHEEEHEHFEELI
FT                   HGDYKNE"
FT   sig_peptide     complement(607836..607895)
FT                   /locus_tag="Apar_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.542 at
FT                   residue 20"
FT   gene            608014..608177
FT                   /locus_tag="Apar_R0015"
FT   ncRNA           608014..608177
FT                   /locus_tag="Apar_R0015"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score4
FT                   4.41"
FT                   /ncRNA_class="other"
FT   gene            608309..608384
FT                   /locus_tag="Apar_R0016"
FT                   /note="tRNA-Ala2"
FT   tRNA            608309..608384
FT                   /locus_tag="Apar_R0016"
FT                   /product="tRNA-Ala"
FT   gene            608466..609500
FT                   /locus_tag="Apar_0526"
FT   CDS_pept        608466..609500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0526"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sfu:Sfum_0616 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50957"
FT                   /db_xref="GOA:C8WA19"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA19"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV50957.1"
FT                   /translation="MGSAPSPNALTFSAYDVCELCPRRCRAQRNAGKAGLCGASNTIRV
FT                   ARSALHFWEEPPISGEAGSGAIFFTGCPLRCVFCQNHQISQEGFGKPVTTERLAQMMLE
FT                   LQAQGALNINLVTPLHFSPHIIEAVTLAKEAGLTLPVVCNTSGYELPEVVQKVSSVIDI
FT                   WLTDVKYADPKLAKELSYAADYPEMSMAALEVMYNSVMSRGGRKFDDDGRMLQGIIVRH
FT                   LVMPTHADDSCEVLNRVWNLCHNDVDVSIMNQYTPNERMRATGGPLSKTLSDEEYELVL
FT                   CHADDLGFENLWWQEGGTVSESFVPAFDATGVEGPALKPRAAYGSNADDGYIATSISNT
FT                   QTEE"
FT   gene            609503..609922
FT                   /locus_tag="Apar_0527"
FT   CDS_pept        609503..609922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_3509 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50958"
FT                   /db_xref="GOA:C8WA20"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50958.1"
FT                   /translation="MSVEKPEELKTTPVLQTAALTDAERAELEALRAEKERRELEALRA
FT                   EKTRTTQVKTAAQVEAPAVAEDAQLRAAQQRAAHQAAQQEAEQIRRIQEQRAKGRALME
FT                   PDEDDEDIKMPLGQKIVIGTVVILAVIFVVSQFIL"
FT   gene            609983..611479
FT                   /locus_tag="Apar_0528"
FT   CDS_pept        609983..611479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0528"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: nicotinate phosphoribosyltransferase; PFAM:
FT                   Nicotinate phosphoribosyltransferase-like; KEGG:
FT                   acp:A2cp1_3805 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50959"
FT                   /db_xref="GOA:C8WA21"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA21"
FT                   /inference="protein motif:TFAM:TIGR01513"
FT                   /protein_id="ACV50959.1"
FT                   /translation="MSLTDRTKPSDVSLNTDLYELTMAQGYWEAGLVDTEACFTAFFRE
FT                   NPFNGGFAISCGTGQIADLVENFIFEDDDIDYLASINSPGGGRLFKPAFLEFLRNHKLN
FT                   VTIDAIPEGELVFPREPMVRVEGSIVDCQLIETALLNLVNFQTLAATKCARVIKAAQGN
FT                   PVSDFGLRRAQGPDGGLAVARASYIAGASSTSNVLAGKIYSIPVFGTHAHSWVMSFDTE
FT                   LDAFRAFAKSSPTNCSLLLDTYDVHEGIKNAIIVAKEMEERGERLSAIRIDSGDLARLS
FT                   KEARKAFDEAGLPYIKISVSNDLDEYTIQSLFAQGAPIDAFGVGTKLATCDPQPSLGGV
FT                   YKLTARRQSANEPWTPVIKLSEMAYKRTVPGIQHIRRFYDANGCPAGDMIFDPDYLVTK
FT                   NPESKATVVDIIDPYSTHKLEGTSRELMIRLVEDGKRVGESESIEVARDRCHAALMRLD
FT                   AAYTRFLNPQIYPVGLERGLAHLRHELAAQHQVKSSEETE"
FT   gene            611551..613395
FT                   /locus_tag="Apar_0529"
FT   CDS_pept        611551..613395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0529"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bha:BH3808 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50960"
FT                   /db_xref="GOA:C8WA22"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA22"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACV50960.1"
FT                   /translation="MREKIEELVRQALAEAQAAGELPEFQIDDVGLERPQDSSNGDWSS
FT                   TVAMRSAKLAHKAPRDIAAALVAHIVKDAQIERVEVAGPGFVNFYLSTAAGNEIFNTVR
FT                   KQGADFGRSSFGSGQKVQVEYVSANPVGPLHIGHGRWAALGDSLSRILAFAGYEVEREY
FT                   YVNDHGSQMDVFGHSISKRYLQLIDIMQKRGIDADTAAQVLAEDRNAYVADEDDAHPEE
FT                   HPFTDEFINSLGGNAYAGDYIVDLGLFFLKNDGELWANKSEDERMVEFRERGYKMMLES
FT                   IKKTCHNARADFDVWFSERSLYVKDSQGKDAVDRALDALDKLGYLYRSDEGALFFRSTD
FT                   FGDDKDRVLIKTNGEYTYFASDVAYHWNKFQRVDHVIDIWGADHHGYIQRVRSAATALG
FT                   YPTQFEVLLGQLVNLLRNGVAVRMSKRKGTGIHFDELLAEVGVDATRYTLVSKSSNQMI
FT                   DFDIEQVKRQDSSNPVYYVQYAHARICSILRRAAGIDLEEAKTLGMDAVASKAIGSVVD
FT                   LGLLSDAAEQALARKLFEFPGLIESCARDRAPFRITHYIEELAGQFHAFYTVCQVLPSE
FT                   GRPLDTELSKARLAACDATRRVLAIALNLIGVSAPEVM"
FT   gene            613726..614406
FT                   /locus_tag="Apar_0530"
FT   CDS_pept        613726..614406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0530"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: mxa:MXAN_1760 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50961"
FT                   /db_xref="GOA:C8WA23"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA23"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV50961.1"
FT                   /translation="MELREYMSIRRSYNLVRRVVPANRRLTFEEFAILCRLNVKGASVK
FT                   TSEIAEYQSALRPTITHRTSHLARLGFIKRDEGTIDRRNVVCIITEKGVEAVEELSKLT
FT                   CARIAPGQALSRTSFERIVMYVNAMGALYCRAADMVLLAILDSPKDALSITEIVDALGL
FT                   LQPTVSMSLTALAESGLVQRKHDDVLSRRVTMVELTPAGKTYTKEIVQQIEDIIVKRKS
FT                   RTAV"
FT   gene            614647..616752
FT                   /locus_tag="Apar_0531"
FT   CDS_pept        614647..616752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0531"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: nis:NIS_1455 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; HMG-I and HMG-Y DNA-binding domain protein; Rho
FT                   termination factor RNA-binding; SMART: AAA ATPase; Cold
FT                   shock protein; HMG-I and HMG-Y DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50962"
FT                   /db_xref="GOA:C8WA24"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA24"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ACV50962.1"
FT                   /translation="MSDETSSVQNDSLNDVEITPAPRRRGRPRKSKNINSENTTSENNN
FT                   SDTTEEKTSNSSAVKRRRGRPTKKETEARRAVEAVMVEALNAAGVAEPPKRRRGRPSKE
FT                   EMEERALREQTLEALQAEVLAQVQAGGKVSSDVVDTDRLTKIVQDATQPSVEVTPVPAF
FT                   TKAEAESTADQNDNAFQKSIVEHQDSAEQQESPVQEQTSGAEADAEVAPTGRLGRSRTG
FT                   VARRRHRNAEPKEAAQEGEKTQENAHASNQEHSSRDRRQNNQRNKNRKQGQASKPSLSK
FT                   EMLQEMKLSELRAKATELGIEYAGVHKSDLIELVYAASAAAEGFKTVEGILQISNEGYG
FT                   WIRTGNYMEGDNDAFVHQQIIRNLGLRPGDSVLGMVGPARVNSKYPPLLQVTQVNGGEV
FT                   EGLKDRPRFKDLTPIFPNQPLTMEHGKDSITGRAIDLVAPIGKGQRGLIVSPPKAGKTT
FT                   ILKRICQSITINNPEVHLFCLLVDERPEEVTDMERSIKGTVVASTFDMPAENHTVVSEL
FT                   VIERAKRLVEMGQDVVVILDSITRLARAYNLAIPASGRILSGGVDSAALYPPKKFLGAA
FT                   RNIESGGSLTIIASALVDTGSKMDEVIFEEFKGTGNMELKLDRDLADRRIFPAIDPVSS
FT                   GTRNEDLLIKPELQPMVWGVRRILAGFNNTERATTALISGLKQTDNNQDFLIRSAKKAA
FT                   QSDYLQN"
FT   gene            617114..618496
FT                   /locus_tag="Apar_0532"
FT   CDS_pept        617114..618496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50963"
FT                   /db_xref="GOA:C8WA25"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50963.1"
FT                   /translation="MTEGRNPAVVAGLLSGLVLVAEPASAHALTTNVIRQTPLGAIFTG
FT                   IGIVLAAVAVISGTAFVVSRVVNRGEKTDGTGEEVQSGTSFQSTDEVTSSKQIPAASDF
FT                   SPEQSVVIPLDSSRRSIAAYKPKHMRVSQWDMTGSIRVQSAKPVVRKPQVVSADAEGVL
FT                   PVRAKKAPAHSTNDYAQIAENYTKLISWRERTVARAKGAAAVLLERLGQDPMDGLPIIE
FT                   RADGTVGDVGTAWWTKAVGEESITRDFGIAEIGAEAIPEDFTNHAADISSRISYVDQGV
FT                   FPEKRTIDELEHTDDWALALAAMDEHLARHDNLQMRKYHPVQLPIIGQAAAEAEVTSPA
FT                   ESSGAKLAASHKVSTAQVRSSREPNYAGVVAQSTAMPLVKATNDTSSHVQDIFDAVERE
FT                   MAAELQAADERPTRELLRLIEGGTSKMKKISSLDLGEKTASDKASYKPRHFAGELPLVR
FT                   EA"
FT   sig_peptide     617114..617194
FT                   /locus_tag="Apar_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.686 at
FT                   residue 27"
FT   gene            618688..619869
FT                   /locus_tag="Apar_0533"
FT   CDS_pept        618688..619869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0533"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   mxa:MXAN_6665 putative branched chain amino acid ABC
FT                   transporter, periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50964"
FT                   /db_xref="GOA:C8WA26"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA26"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACV50964.1"
FT                   /translation="MAHKLTRRRFLEVAGTIAGSFALAGCSPKNQDPNSIYVGVMGPFT
FT                   GDVAQYGLAVRSGVLLYLKEFNKKGGVNGRQIVPVVEDEKGDSTEAILVYNKLLDENVC
FT                   AILGDVTSTPTIALAQKSVLDNIPCVTASATAEDVVTHGNNMFRATVTDPFQGVVLAEF
FT                   AKKQGYQRVGTIFNSGGDYEIGVNNAFVQKARELGIEVVSQQGYPTGAVDFNAQLTSII
FT                   GLDPDVILAPNYYQDNGKIVTQARQLGCKKPFMGADGWAGIIGGEQDYASATDLEGCFY
FT                   CSAFVASNPDEKVQHFVTAYTEEYGEAPTNFCSLGYDAAMILCSALEVVEKHGYTYNSD
FT                   AYRQAIIDAIASGVVEGVTGALSYQGTGDPVKSTLIITFKDGKESIYDTINPS"
FT   gene            619885..620757
FT                   /locus_tag="Apar_0534"
FT   CDS_pept        619885..620757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0534"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gbm:Gbem_1943 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50965"
FT                   /db_xref="GOA:C8WA27"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA27"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV50965.1"
FT                   /translation="MFLTQVLNGLQLGSIYALVALGYTMVYGIILLLNFAHGDIIMFGS
FT                   YVAWIALVQLGLNPAIAVLLAIFGCVVLGVLIDKVAYAPLREAPRLSILITAIGVSYLL
FT                   ENGVQLLLGADAKVIPNIIDLGTVQVFGSTLSGTALLTVAVTTLATVALTVLVQKTRLG
FT                   KAMRAVSEDMGAARLMGVNVNSTISFTFAVGSALAGIAAILYSMAYQQVSPTMGVMLGT
FT                   KAFVAAVLGGIGSIPGAVIGGLIVGFSEVFVAAFGLSVWQDAVVFLLLILVLVVKPTGL
FT                   LGRPVTEKV"
FT   gene            620768..621973
FT                   /locus_tag="Apar_0535"
FT   CDS_pept        620768..621973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0535"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bba:Bd3387
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50966"
FT                   /db_xref="GOA:C8WA28"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA28"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV50966.1"
FT                   /translation="MTKMYPRDNNHNPVIVTGFGGKDGQRRELTMPARYAINAILVALF
FT                   VFGGNFLVGEGLISRYQTVVFEQIGVYVLMTVSLNIVTGYLGQLPLGHAGFMSIGGYAC
FT                   AIFIIRMMPLFGLDAQSMASGSTPAVILFVVGLLFGGICAALMGMVIGIPALRLRGDYL
FT                   AIITLGFAEIIRVVLVNIDSALGFKLTGGASGLTGIPAYTGYLNTAIVVSLAIFAIHTL
FT                   MKSRHGRAILAIRDNEIAAEASGVNTTYYKTLAFVFSAFIAGIAGGLYAGCIGVMAPAK
FT                   FGFMKSVEILVMVVLGGMGSMFGSVVSATVLTVLPEALRAFADYRMVAYAIVLILVMIF
FT                   RPEGLFGSYDFSLSRIIERIMNRDFPWNKDDSDEQAGVQVNAQAGVQADTQAEVSTDSK
FT                   EV"
FT   gene            621979..622824
FT                   /locus_tag="Apar_0536"
FT   CDS_pept        621979..622824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0536"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bba:Bd3388 branched-chain amino acid transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50967"
FT                   /db_xref="GOA:C8WA29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA29"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50967.1"
FT                   /translation="MATKNPTKLIRQESPNLIPERDLGAIPVLQAEHLGIDFGGLTAVN
FT                   DFNIALGPTEISGIIGPNGAGKTTVFNLLTSVYKPTRGSVMIDGYDLAGKSVVETNHMG
FT                   IARTFQNIRLFNNMTVMENIQVGQGSHMTSHFFEDVFRLPAHWKQEKESADNACELLRI
FT                   FGMENLANTLAGNLPYGAQRKLEILRALATQPKILLLDEPAAGMNPAETDELMENVLKI
FT                   RDDFKIAVLLIEHDMKFVMGICEGLAVLDHGNIIAKGTPEEVQNNPRVIEAYLGKQEVR
FT                   "
FT   gene            622824..623573
FT                   /locus_tag="Apar_0537"
FT   CDS_pept        622824..623573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0537"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gbm:Gbem_1946 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50968"
FT                   /db_xref="GOA:C8WA30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA30"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV50968.1"
FT                   /translation="MATENINTQAAGVEKALLSVKDLNVSYGAIHAVQGISFDIHEGEI
FT                   VTLIGANGAGKSTTLNTIAGLVKPDSGTITLDEKNLVGQRAHKIVEAGLALCPEGRRVF
FT                   SRMSVAENLEMGGYTQPDSKNAKTVKMVYEHFPRLRERKNQLAGTLSGGEQQMLAMGRA
FT                   LMSRPKLLMLDEPSMGLAPILIEEIFQIIRQLGDAGTTILLVEQNANMALKVADRAYVL
FT                   ELGKVAKHGTGQELLHDDDVRKAYLGA"
FT   gene            complement(623685..624614)
FT                   /locus_tag="Apar_0538"
FT   CDS_pept        complement(623685..624614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0538"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="KEGG: sus:Acid_0902 homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinase; GHMP kinase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50969"
FT                   /db_xref="GOA:C8WA31"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA31"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ACV50969.1"
FT                   /translation="MLDNTILTISVPATSANIGVGYDTLGLAFNLRAKIAFRESPALII
FT                   DGCPEQFRNENNLVWTSYVRACEKLGEEPTPKHITINSPIPLSGGLGSSSTCVVAGIAA
FT                   AMTESHGGWDPERALDFACNFEGHPDNVAPAIYGGLTSSFVDGGHTVCTRRLVARGLSF
FT                   VAIAPPYTVNTEDARKVVPQEVSLETAVYQMGRTVAVTHALETGNGGLLMAACNDKLHE
FT                   PYRKELIPDYEELKQVSKLARACAFVISGSGATMIAICDSPVTARAVAENAKQVRGDLW
FT                   IQILEPALLGTVLTLDDGQQHHSTFDEI"
FT   gene            complement(624637..626145)
FT                   /locus_tag="Apar_0539"
FT   CDS_pept        complement(624637..626145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0539"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: nis:NIS_1040 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50970"
FT                   /db_xref="GOA:C8WA32"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA32"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACV50970.1"
FT                   /translation="MAVAYHSTRSFDHTVSAKQAILQGIAPDSGLYIQDSIGEKPLDLV
FT                   KVCSQDFKSTAYDVLSTLLDDYLPEELNRCIEGAYGTQWDTKTITPVSAIGDDWLLELF
FT                   HGPTSAFKDVALQMLPRLMSVAREDTNAASTSGQNIMIVTATSGDTGKAALEGFKDVPG
FT                   MGITVFYPEGKVSDIQRLQMVTQKGSNIAVCAVNGNFDDAQNAAKAIFANKKLAQELAG
FT                   KNTVLSSANSINIGRLAPQVTYYFDAYAQLVAKGTITLGQKITFCVPTGNFGDVLAGYF
FT                   AKEMGLPVDRLIVASNSNKVLTDFLTTGTYDRRRAFEKTISPSMDILVSSNLERLLYLA
FT                   SGKDTELVSYLMNQLVTKGIYTVPAQVMDTIRETFDAGFATDDQTRETIRSTWENCRML
FT                   IDPHTAVAKHVLDRVSRQTNDVRICLSTASPYKFSSDVLAALGHSTADLNDFACMHTLA
FT                   EITGTNPPIQLSSLNDNVIIHTDVREKEELASYVFEACERIFAC"
FT   gene            626380..627519
FT                   /locus_tag="Apar_0540"
FT   CDS_pept        626380..627519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0540"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: abu:Abu_0158 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50971"
FT                   /db_xref="GOA:C8WA33"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA33"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ACV50971.1"
FT                   /translation="MQNVALLGFGTVGASVARILDERISDVNLTSILVRAGKEHVDPRA
FT                   TSNFDAILSDSALDTVVECMGGLSPAYEYIKAALIAKKNVVTSNKAVVSAHFEEFMTLA
FT                   AEAGVNLKIEACVCGGIPWIAGIQKVRRIDEISAFWGIMNGTTNYIVYSMLKDGTDFAE
FT                   VLSKAQELGYAERDPSSDIDGIDVRSKTMISASIAFDVICTNQIPMSGIRNLTKRDLAM
FT                   FGSHDMTIKLFGRGVSNGSSYAVVVEPVAVPLSAIEAHVPTNFNVATVVGDTIGELKFY
FT                   GQGAGGNPTANAVVQDIIDCADAPIEGQQNFSANLLYNPELFVSDYVFRTQADIPGGSF
FT                   WEPGAQLVKNLSAEKARELLTSALTQDPTTFMAALEKRN"
FT   gene            627522..628850
FT                   /locus_tag="Apar_0541"
FT   CDS_pept        627522..628850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0541"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: bha:BH1500 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50972"
FT                   /db_xref="GOA:C8WA34"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA34"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACV50972.1"
FT                   /translation="MIKIAKFGGSSVASAEQFKKVKAIVEADPDRCFIVSSAAGKRHST
FT                   DNKITDLLLLVNAHIEYHVDCTSLLADIEARFVEIADELGVTWPVAKEFKKFATNIKSF
FT                   SPEYVVSRGEWFTCQILAEYLGLPFVDAADVMLFHHDGTIDMERTASRIKGVVARSGSF
FT                   VLPGFYGATVDGAIKLFQRGGGDITGAIVARCLDADLYENWTDVSGFLSADPRIVQNPR
FT                   AIGRITFDEMRELSYMGASVLQEEAIFPVREANIPIQIKNTNRPEDTGTVIRETADGDV
FT                   SEHLITGIAGKKDFLAIHVKKAHMSNEVGVISRALNIVERYGVSVEHIPTGVDSFGIVV
FT                   NASDVKDTVYSIISDIRREIEPDDITMVDRLALVSVVGRNMSRRSGTSGKIFGALGNAG
FT                   VNIRMITQSSEEISIIVGVDNTDFDRTIGVIYNGFVRDEMVSR"
FT   gene            628853..629875
FT                   /locus_tag="Apar_0542"
FT   CDS_pept        628853..629875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0542"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding; KEGG: bha:BH2401
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50973"
FT                   /db_xref="GOA:C8WA35"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA35"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACV50973.1"
FT                   /translation="MAFDPNGKVVAILGATGVVGAQMMQCLEERNFPIKELVLLASARS
FT                   AGKTINFIGQQIVIREATPEAFEGVDIVLGAAGDEQAKELLPEAVKRGCVCVDNSHAFR
FT                   MDPDVPLVIPEINAEDIKGHNGIISNPNCATIIGLVPLYPLHKVAGAKRIIASTYQAAS
FT                   GAGLPGLTSLKNQMADVVAGRKVTETTPFAYQLAVNLIPQIGGFDEVGYTSEEMKMQNE
FT                   GRKIMHLPELRVNCTCVRVPIMRSHSESITVEFERPLSPNEARAILEDAPGIKVVDNPA
FT                   ELQYPMPLDTSDQDLIYVGRIREDLSADKNTNALTFFCCGDQIRKGAATNAVQIAEYLL
FT                   "
FT   gene            630294..630713
FT                   /locus_tag="Apar_0543"
FT   CDS_pept        630294..630713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmu:PM1699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50974"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA36"
FT                   /inference="similar to AA sequence:KEGG:PM1699"
FT                   /protein_id="ACV50974.1"
FT                   /translation="MNEREKIIRLWFDMWLTQQDLGIDEIFSDDVIYIESWCPKYENRQ
FT                   TVKHWFNEWNTRGIVLAWDIKQFFHKDNQTIVEWHFKNKMNEGEVEEFDGISLIVWTAD
FT                   NKIKALKEFGCNCNNYNPYKESETPLFRDEKANWF"
FT   gene            630726..631343
FT                   /locus_tag="Apar_0544"
FT   CDS_pept        630726..631343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_2445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50975"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50975.1"
FT                   /translation="MIESRPEFDKITSFDEFSKYYWYREELSQICKSLGLEYRGIKQEL
FT                   NYIIEQYFKGNLIKKSSIKNEKKKVETITLDMPLLECGFSFNTQFREYFSILTDVSPFK
FT                   FTADMATAWRKVKSENDLSFTIQDMLKVYYGKSDYAKYDNSVCQWNQFLKDFCADENSC
FT                   NYSNKLKVASILWKEVRNSRNEKIYSKNLLTEYAYKIKEYCK"
FT   gene            631452..631616
FT                   /locus_tag="Apar_0545"
FT   CDS_pept        631452..631616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50976"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50976.1"
FT                   /translation="MEEEKREIKAPPNKQLIMDIGKTKYTVNLHFKQGTVETYKDKILK
FT                   LIKRETEKI"
FT   gene            632060..633271
FT                   /locus_tag="Apar_0546"
FT   CDS_pept        632060..633271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0546"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bce:BC1272 DNA
FT                   integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50977"
FT                   /db_xref="GOA:C8WA39"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA39"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV50977.1"
FT                   /translation="MNIAVKRHGTFWQARVRFRGADGTIQEKSKSLGIPCAAGRGKKVA
FT                   RAAAEKWVQDAGFVEVVEQNQATRLDCSAYTYCLNYFKSLVATQQIERRTYTSYKNNVR
FT                   YIDLFFGEKRLQEITVTDVELYVSWLYDSGYAANTVKKAFNSFRACTRHAVAIRDLQYD
FT                   PCAAIKAPKGYLAPPNPLNEPSRKKLQVMLSALELSPMVLATYLAYYTGMRREECCGLQ
FT                   WKDVKFKAEDVTAHLCRAISYDGGKTYIKGLKNGKDRTVPIPAPLVDILKQWRSKYIED
FT                   CMLMGIAFSEEMYVLGDFSGEYLRPERATAWWKSHSEEWGLLGTQGRRPVFHDLRHTYA
FT                   TIAVRTMDIKSAQDILGHSDINMTMRYADTDLEQIQKAGKIIGEALNDAHKDGAEVLQL
FT                   RRAI"
FT   gene            complement(633282..633824)
FT                   /locus_tag="Apar_0547"
FT   CDS_pept        complement(633282..633824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50978"
FT                   /db_xref="GOA:C8WA40"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50978.1"
FT                   /translation="MSKISLCYVVKNYIASLHQGYEKKISKFDVFCQIITPLIIAVVII
FT                   INADKFHDSLDEALQGLLTWVAITSSLIFAVVVMIYQLRMQLISQKDIKHEGNELRVID
FT                   EIFYCTLWAVVAGFTSAAFIVVKPLVATYSTLIGNLFAGLAIAFSLNLVLVTCMTIKRI
FT                   GITYEVISKRWSKKEEQ"
FT   gene            complement(633868..634785)
FT                   /locus_tag="Apar_0548"
FT   CDS_pept        complement(633868..634785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50979"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50979.1"
FT                   /translation="MVVYAERTLVVYKFMFNKRRHPDEVCSIYDLDGESILTHFSKFLN
FT                   SRVIPKLENENVKILRFHKIDTISEKSILASIESGLAGEDRVIYEPSTNKNVGNINAEQ
FT                   AALVGTRVYLSVENTGDTYAILCVEHALSFAGDTIVPKEFANYLRQAAPHVTMKYEAVT
FT                   EKEAEDTFKSVEQISIKHYIKQNDISESLIKESDYVMLTYGHKKNRPFPTKILDAIRSK
FT                   DARRKTLVGYEKSIFDGDDAVVEVQMKNNVGRTKKFKLNDDFDMRIVELLNCNGDKPLS
FT                   DNEFVKRCAEKVEDISNRLGRSIL"
FT   gene            complement(634907..635935)
FT                   /locus_tag="Apar_0549"
FT   CDS_pept        complement(634907..635935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0549"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="KEGG: vvu:VV2_1003 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; BRCT
FT                   domain protein; SMART: Exonuclease; BRCT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50980"
FT                   /db_xref="GOA:C8WA42"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA42"
FT                   /inference="protein motif:TFAM:TIGR00573"
FT                   /protein_id="ACV50980.1"
FT                   /translation="MAFWYLVFLVVVFLLFKKRRNKKQNSTNGFYPTPPAGAQNIPLPV
FT                   SPQAPKVKTKPSNVPLKRTRWADFDVSKYPESYVVVDLETTGLDVHYCEIIEIAALKVV
FT                   DGKITEEFSSLIHPPREIPSGATAINHITNHMVKNAPTLDKVIPQFDTFVKGFPLIGHN
FT                   SLRYDAIVLEENFFRRDFLCDYVWYDTYKLARQILEPPYKLINIAKRLNVKQHGKAHRA
FT                   LADCYMTYGIYEKMREISIATTENVKCIEKYTDKNTESTKLSGTVFCLTGVPCCMPKSD
FT                   FLKMLITNGATLSERVTLKTNYLIDCSGDETTKIKTARKYADRTGIKIISEQQMLEMLK
FT                   QS"
FT   gene            complement(635981..636181)
FT                   /locus_tag="Apar_0550"
FT   CDS_pept        complement(635981..636181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: zmo:ZMO0901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50981"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA43"
FT                   /inference="similar to AA sequence:KEGG:ZMO0901"
FT                   /protein_id="ACV50981.1"
FT                   /translation="MKFGMRKPSLKRSISARTTGKLKRSIKKAIIPGYEKKGTGIFKDP
FT                   KKALYNKAYNKLTFSIFDLFK"
FT   gene            complement(636290..636922)
FT                   /locus_tag="Apar_0551"
FT   CDS_pept        complement(636290..636922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0551"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase S24
FT                   and S26 domain protein; SMART: helix-turn-helix domain
FT                   protein; KEGG: btr:Btr_0553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50982"
FT                   /db_xref="GOA:C8WA44"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA44"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV50982.1"
FT                   /translation="MKYQIAEARKLRNITQAELAEKMGTTQQTVQRYETNQVNIRMDKM
FT                   IEMSEILNVSLAYLLGMSSSPEISEVSDMAPVPLLGSIAAGTPIEMISVDETYDIPADI
FT                   HERYPQAFLLKVVGESMNRVLPNGCYALINPCKEEIKPMKAYAVCVNGFDATIKRVKPL
FT                   SNGYELIPDSIDPTFRPQIFDFNEIDTQPISIIGEVIWYLVPFGFEI"
FT   gene            637062..637277
FT                   /locus_tag="Apar_0552"
FT   CDS_pept        637062..637277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0552"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sbn:Sbal195_3495
FT                   putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50983"
FT                   /db_xref="GOA:C8WA45"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA45"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV50983.1"
FT                   /translation="MRMNMKAERARCGLSASEAAKRIGVSTNTLLRWESGKNTPLSENL
FT                   MKLARLYNCTPDYLLGIGNYRTRITC"
FT   gene            637841..638044
FT                   /locus_tag="Apar_0553"
FT   CDS_pept        637841..638044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50984"
FT                   /db_xref="GOA:C8WA46"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50984.1"
FT                   /translation="MSLEKVAAFCIELKLSIRKHPIRMLSCLVSVLSLMFSVYCIFACS
FT                   KMTSVVGLCIAVFALCFAGLIY"
FT   gene            638113..638922
FT                   /locus_tag="Apar_0554"
FT   CDS_pept        638113..638922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0554"
FT                   /product="prophage antirepressor"
FT                   /note="PFAM: BRO domain protein; phage antirepressor
FT                   protein; KEGG: bpm:BURPS1710b_1644 BRO domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50985"
FT                   /db_xref="GOA:C8WA47"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA47"
FT                   /inference="protein motif:PFAM:PF02498"
FT                   /protein_id="ACV50985.1"
FT                   /translation="MDDTSIQVFSSQQFGELRALKDLDGEPWFIAQDVCRALGTDVKDV
FT                   RSVLECDEVSNLDTIEVYKKPGRSPLIVSEAGLYNLVLRSRKPEAKPFRRWVTHEVLPS
FT                   IRRSGGYIATDGSESNEDLLARAVLVANEAIQRKDAQLKEQQRQLYEKDTTIIEQGAKI
FT                   DELAPKAGMYDTVINVKGTMTITDAARYLSQYDPQITRKRLFALLRADGLICRVGKAPT
FT                   KKGIETGRFVQIMSTRRDGKSNEPYARMTQKGFDWCVTAYCTAPLIN"
FT   gene            638949..639113
FT                   /pseudo
FT                   /locus_tag="Apar_0555"
FT   gene            639117..639311
FT                   /locus_tag="Apar_0556"
FT   CDS_pept        639117..639311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50986"
FT                   /db_xref="GOA:C8WA48"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50986.1"
FT                   /translation="MDKRIFFVALLPLLVYFTADCLGIFEPHNVAYLMAFRYAIAAYGL
FT                   VGALVAWLKDKEKEVCDAN"
FT   gene            639301..639669
FT                   /locus_tag="Apar_0557"
FT   CDS_pept        639301..639669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50987"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50987.1"
FT                   /translation="MLTKQERREIAERAKEYKKEEEQLSWDQFSYVLLGIQSWRSDDEL
FT                   LDRIVELCEAVNVDELAFRPSADEMYLQALNVKHERIAAYVEADSYVNIKHIISCIEDF
FT                   DAAISHYKRLVERSNNAN"
FT   gene            639659..640159
FT                   /locus_tag="Apar_0558"
FT   CDS_pept        639659..640159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50988"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50988.1"
FT                   /translation="MLTKEEREKIAERFKNHDEKYIVDFYRCLFGTNPPNGVPLEKSRR
FT                   NTISRLIDLCDTSNMIELPLDKDGEVTHIGDIVYDENNKRYEVRQLTLDGNKWFVLAFS
FT                   GDSCGDGYSFPVKFTHKKPATVALLARQIKDVLYADDDISYCTSSELLDIADQLESLGD
FT                   SDD"
FT   gene            640152..640481
FT                   /locus_tag="Apar_0559"
FT   CDS_pept        640152..640481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50989"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50989.1"
FT                   /translation="MTNREEVAKKWRKVGERLDKEPPISLTGTACITLFELLESAGIRD
FT                   NNSYSDVFNRLANLIDPTCHDFGSEEGTNGESYDFACSACGWCGDVTKPNYCPHCGARV
FT                   VSENA"
FT   gene            640474..640803
FT                   /locus_tag="Apar_0560"
FT   CDS_pept        640474..640803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50990"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50990.1"
FT                   /translation="MPSLSDRKETAARLRSKFACGLGITPGSIAYVLGYTAPKGATYDD
FT                   AVRELFELLADLVNPTCELKIQDGHACCGNCGHILAGEYEAEEDYWYFRPYCPDCGAKV
FT                   VGEDD"
FT   gene            640796..641338
FT                   /locus_tag="Apar_0561"
FT   CDS_pept        640796..641338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0561"
FT                   /product="putative methyltransferase"
FT                   /note="KEGG: ent:Ent638_1018 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50991"
FT                   /db_xref="GOA:C8WA53"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA53"
FT                   /inference="similar to AA sequence:KEGG:Ent638_1018"
FT                   /protein_id="ACV50991.1"
FT                   /translation="MTSLPPALDVACGARSFYFDKQDERVLKCDANPRHLTLCDGRTLD
FT                   VSPDKVADFRKLPFSDKSFNLVIFDPPHLDVGAGWQVDKYGKLDSDSWHEDLAKGFSEC
FT                   LRVLKPYGVLVFKWYEYHIPLKDVLALCPAKPIIGNRRPKASKTHWVLFMREPETQKQA
FT                   ALPADDYIDNQTLALAT"
FT   gene            641349..641540
FT                   /locus_tag="Apar_0562"
FT   CDS_pept        641349..641540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50992"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50992.1"
FT                   /translation="MKENEYVGGTNGISKFWLTNKPIVRCRDCKFWATEHHFFGGCVGK
FT                   EFNPDGFCSWGERKKDDA"
FT   gene            641709..642149
FT                   /locus_tag="Apar_0563"
FT   CDS_pept        641709..642149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pag:PLES_25081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50993"
FT                   /db_xref="InterPro:IPR025518"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50993.1"
FT                   /translation="MDSVDTALNLIERYAKLAYLSNGEFLGTDIRDKQVYLSGPITGEK
FT                   NYKGLFSFARDLVEFGGAAKIYSPAVRIPARFSWEQAMKHCLSEITGYDTVVMLPEWEA
FT                   SDGARLEHDVALACGIHVVDFTNNKIIYGLYYALKETLEKCL"
FT   gene            642308..642499
FT                   /locus_tag="Apar_0564"
FT   CDS_pept        642308..642499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50994"
FT                   /db_xref="GOA:C8WA56"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50994.1"
FT                   /translation="MKKILQWLGVAVFAVLVFVPGIAQAQPTSTPATDYYGALDRFLGV
FT                   LIGGFLAFSGMYLNRKRD"
FT   sig_peptide     642308..642385
FT                   /locus_tag="Apar_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            642499..642675
FT                   /locus_tag="Apar_0565"
FT   CDS_pept        642499..642675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50995"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50995.1"
FT                   /translation="MTTEAEDRKRLEKMTMKEIKAVAKDEGITLGYDGSRKANAIGLIL
FT                   EWRRFKGVYMKRY"
FT   gene            642675..642902
FT                   /locus_tag="Apar_0566"
FT   CDS_pept        642675..642902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50996"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50996.1"
FT                   /translation="MKNRLRIADIKFIRGLVCEVWHSQSDMQRALMNNDLAAVLKEISF
FT                   SDKQLITLVCTLNKLVEDFKNDEELQGGKQ"
FT   gene            642899..644074
FT                   /locus_tag="Apar_0567"
FT   CDS_pept        642899..644074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0567"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bcb:BCB4264_A2589 DNA integration/recombination/invertion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50997"
FT                   /db_xref="GOA:C8WA59"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA59"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV50997.1"
FT                   /translation="MNRSIKVRLNSNGIWCCRLYLGRNLNGKIIQPYASFPTAKTQKEA
FT                   EELATMWASHITSDGKVKSTQLTDLLLEYVSIKRRNGASPNTTRQHEGFIRNHINGRLG
FT                   KEDVRSITSSLFTSFEQDLLKKGLSRNSVINLHQFLRGAYNYFVSAGICDYNPLINVAK
FT                   PSREVHEAVSIEEWGFAGISTLINSRITTAIQEDEFNSRVVCAFAAWLSLVTGMRCGEV
FT                   CAIRYSDVNMLYKHIHVSGTVIEESYRKPYRRESTKGKRSRNIAITDSDISFISDYMKL
FT                   QQAHIAFVESSTPLISLDGSYMRPTSVSRSFTRMRRTLQLPQGITFHSLRHTHASWCLA
FT                   SGVDLKTLSERLGHADPATTLRIYSHLLPGRDRGAAEAFGDALRTIEQGAF"
FT   gene            644240..644545
FT                   /locus_tag="Apar_0568"
FT   CDS_pept        644240..644545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50998"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50998.1"
FT                   /translation="MAISKVTKDLRRLLDAQNISWEDHSGFSTERTWIPLDNGLVLCCM
FT                   CSYYITSDGVEHGVTSGFPLKLEVSIIYSIDDYAFGPGAAKTPEEILEVLGRYGEK"
FT   gene            644532..644777
FT                   /locus_tag="Apar_0569"
FT   CDS_pept        644532..644777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV50999"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV50999.1"
FT                   /translation="MERSKYCQELCDALERYGKTWTDRSNACVEHIYFKSRGNWVSVLY
FT                   GDDIRGFPQKFLVWEMSNYSYSPRVMDVEKIIDKYF"
FT   gene            644787..645209
FT                   /locus_tag="Apar_0570"
FT   CDS_pept        644787..645209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0570"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: nis:NIS_1165 single-strand DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51000"
FT                   /db_xref="GOA:C8WA62"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA62"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACV51000.1"
FT                   /translation="MSINHVNISGNLTRDPELRSTAGGTNILSFGVAVNDRRKNPQTGK
FT                   WQDVPNFIDCIVFGQRAEALSRFISKGAKVSIDGKLHYSSWETKDGQHRSKLEVVVGEI
FT                   EFLSKTQTTAATAQGQPSFTAPQAPEEEFYDADIPF"
FT   gene            645661..646140
FT                   /locus_tag="Apar_0571"
FT   CDS_pept        645661..646140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51001"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51001.1"
FT                   /translation="MDYSGLTASEFFHGVAEASRENTRALQQIMSLQETEGAKAQSYSA
FT                   GGSKGSNQDTMAKVDKRIDLEALLSKRMNDNYDYINDAYTLLYGASQLGDGGICQLMSS
FT                   SIYADLLQWRYLQCLTWSDVSERLLTPVRTLQQLEREVFETIDEENYIEKFLKNK"
FT   gene            646404..646511
FT                   /locus_tag="Apar_0572"
FT   CDS_pept        646404..646511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51002"
FT                   /db_xref="GOA:C8WA64"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51002.1"
FT                   /translation="MITISFVGLLVAIVAGTIVGQLIISLIEKRQHGSK"
FT   gene            646498..646680
FT                   /locus_tag="Apar_0573"
FT   CDS_pept        646498..646680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51003"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51003.1"
FT                   /translation="MAVSKAQKKATAAYIKRSVKIKQLRFYPGEYELYEWVNKQEKQNA
FT                   YIKELIRKDMENSRK"
FT   gene            646812..647120
FT                   /locus_tag="Apar_0574"
FT   CDS_pept        646812..647120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0574"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51004"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA66"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ACV51004.1"
FT                   /translation="MSYNIRRSYARDQLRKQMIAREEPCHICGMPIDYSLPAGDPMSFE
FT                   MDEVVPVSRLPLEQRRAAACDPENVKAAHRICNQKRGNRMMDELKGNALPIVRTRLW"
FT   gene            647226..647471
FT                   /locus_tag="Apar_0575"
FT   CDS_pept        647226..647471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51005"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51005.1"
FT                   /translation="MAKKLVTVCRKGSRYDIYKALQISMAKKLDDCESGRDFAAIVKTF
FT                   VQVVDEVDAMEKEKLFAVKKPSPVKRARKTYLKEVS"
FT   gene            647471..648961
FT                   /locus_tag="Apar_0576"
FT   CDS_pept        647471..648961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51006.1"
FT                   /translation="MPRRKKRVGNQKPTFERIGKYHHSDAKACINMFSHYGFKLDEAQK
FT                   HELELYMAKDAKGSPAAETIGAAKPRQNGKSFAARLYGIWCAAICGMDVVYSAHNADTV
FT                   DEFFDMIVNLFTDDETYPDLAELLLKAYRQPGKQYLLFDCGCYKSGKRAIGRLKFSTRT
FT                   TSKARGGTRSLIIIDEAQELTDAQLNAILPTVSASKDGSPQVIYIGTPPDPTCRGTVFK
FT                   RMHDTAHSDDPGEAWWLEWAAKSVPKEDTSDEEALDFAYETNPALGSRITERAVLNEWH
FT                   QMTRDGFARERLGWWSTLDTSVEYIVNANDWNECITEEPYDDGLLAFGIKYSLDGKKVA
FT                   VSAALKQQDIPTAYVELVDIADAYGAGQNLAQWIKERESRIACVVIDGRSGATQLAERL
FT                   QELHFPKRGIVLCDTKQAVAAASRFVDEVGAHSICHVSSPALDESVTGSSRRAIGNNGG
FT                   FGFGDSPKATCTAAESAALALYGVRTTKRNPARKQVVW"
FT   gene            648958..650424
FT                   /locus_tag="Apar_0577"
FT   CDS_pept        648958..650424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0577"
FT                   /product="protein of unknown function DUF1483"
FT                   /note="PFAM: protein of unknown function DUF1483"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51007"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA69"
FT                   /inference="protein motif:PFAM:PF07360"
FT                   /protein_id="ACV51007.1"
FT                   /translation="MTIGIIPVSTATAVGLRKEDRQIILDLCTVYSNTLARNRLRDGYY
FT                   KMHTKLKQLGISVPDSLRNLKQAISWPAKAVDTLANRSQFDGFTCTDEEVSKELQTIVR
FT                   QNSLKRCYRKAVKEQLKSSCAFLTVTAGDVDAGEPAVIISAYSAVSAAALWDERLHRIQ
FT                   AGIVVVDRDNRPNHRNAPTWINVFTDTDIIRIRRPLDSTRWVAEYIPHGMGRCLMEPLV
FT                   YEATLDRPFGKSRITQAVMDLTDDAMRSSVRAEVAAEFMTAPQKYLVGADPDALNKLSK
FT                   WDAYIGSIFAVSKDADGDTPTFGQLQQGSMQPHIDYMRSLAARFSAETNVPISELGIIS
FT                   DNPSSAEAIYVAKEPLVIDAQNLNADNGDALCNVALMSLAVKRNVSFAEVLTIESAVTA
FT                   KWHNPAMPSIVSQADSMLKIVQAAPWIANSDILLEELGFTDDQIQRLESDRDRATAQEL
FT                   LKARFAAKATKTPVDNQDLLDGVIDEGKQG"
FT   gene            650405..651589
FT                   /locus_tag="Apar_0578"
FT   CDS_pept        650405..651589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51008"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51008.1"
FT                   /translation="MRVNKDRLTRYRKELDSAADDAAEFMYDYYDALRAANPNSSVAEL
FT                   RNMAIKSIKQALNAFSPQAGELAGELFDEIVRAEGVKAKFRYQQTIECGLVEKKVHYLA
FT                   KDLVDGNNQKFIDACTALTRFYVKREANINMHRSALRSKIWWARVPSGAETCGFCFMLS
FT                   TRGFDYESEFSAGGAGHKFHLHCDCIIVPGTKKTTIEGYDPDEMYARWVECANTVGLEP
FT                   IWKNRSAIIAECETRDFRWLNSGTKPDIHYIENYGEKNEVVRDYKFARNKVASHEYVTA
FT                   QRMRQLGLTVDFIKDHYSVDLPDGSRVIVGRCDMTNGYELKAPRESISAKNLVSNSIEN
FT                   SRNKEGIKRLIIDVTDNPHVSINEVIPIAVDYCNKHKVKFTVSVLEGSTLKNAN"
FT   gene            651785..652237
FT                   /locus_tag="Apar_0579"
FT   CDS_pept        651785..652237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC1893 scaffold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51009"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51009.1"
FT                   /translation="MDLKEPVTTQEQLDKIVKDRLEREREKVRSEFSDYEDLKARSLKL
FT                   DELEKNGSEELKKALAEVDNLKGELQTRDKDAELQKMRKQVAKDTGVPEDLIQGADEES
FT                   MKTFAEAVAAFAKKPSAPIIPESGKHTQAGETSAQKFGQFMSETFN"
FT   gene            652253..653137
FT                   /locus_tag="Apar_0580"
FT   CDS_pept        652253..653137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0580"
FT                   /product="major capsid protein HK97"
FT                   /note="PFAM: major capsid protein HK97; KEGG: mes:Meso_1895
FT                   phage major capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51010"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA72"
FT                   /inference="protein motif:PFAM:PF05065"
FT                   /protein_id="ACV51010.1"
FT                   /translation="MANGILTTSATLPGDLSSEIFANVQEQSAVMQLATPIELPGRGMT
FT                   VPVVTGDPEASFVNEGEEIKVSNSTLAVKEMKPYKLSVIELFSNEFKDNYEAIFAELQN
FT                   RLPGAIGRKVDSTILYGTTPGTGFDTLADTDSVDLSAKAYDGFVDALEKVATANGDLNG
FT                   WILSPKARTLLLKAKDNQQRPLFITNPAVEGKDGGSSVLAIPSLFSRAAYQAKNQGKTP
FT                   ELVGAGGDWTGARFGLVKDITVSLADQATINAGGTQMNLYQRDMFALKCTFMFGFVVRD
FT                   KKQFVRLANGTAA"
FT   gene            653153..653572
FT                   /locus_tag="Apar_0581"
FT   CDS_pept        653153..653572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51011"
FT                   /db_xref="InterPro:IPR018963"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51011.1"
FT                   /translation="MAETQTFATKADYEDRYGSGAPERVEVLLQDASALLRSNFIAYHQ
FT                   TAYKAGLNPRFDENVCAVTCAIVARAINVPSGFEGASQYSQQAGVYQSTLTFANPTADL
FT                   YITRSERARLGLSGIRIGSIQPMGKQEHEVADGSY"
FT   gene            653559..653897
FT                   /locus_tag="Apar_0582"
FT   CDS_pept        653559..653897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51012"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51012.1"
FT                   /translation="MALIKGIQVKVIRTSVITDDHGNEIPGVETYEQVDNVLPAPVSTA
FT                   DLSESRPNGDKVDMMFHFPKTYKRSLRGAFIEHSGVRFSVIGDPQPYLDSLTPLDWDRP
FT                   VEAVVVDG"
FT   gene            653890..654186
FT                   /locus_tag="Apar_0583"
FT   CDS_pept        653890..654186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51013"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51013.1"
FT                   /translation="MANDFVVTDLKPDLVGIREVLHTAPVAEMCREAAHICAAKCNALL
FT                   PEKYLKHGARFDAKWVNREYTAAGLVYCSGSENGKWAGRANAKLNILKKGCNG"
FT   gene            654183..654533
FT                   /locus_tag="Apar_0584"
FT   CDS_pept        654183..654533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51014"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51014.1"
FT                   /translation="MNYDVLSELTKYISQKLNVPASTRVPAREPKEFVTVTRTGGSATI
FT                   GWDTANLAVQAWSTTDAAAYKLALAVRLLLFECWQELDKVIKVEIQSIYDFPDPDSKKY
FT                   RYQLDVYVTTRL"
FT   gene            654542..655183
FT                   /locus_tag="Apar_0585"
FT   CDS_pept        654542..655183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Apar_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Apar_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV51015"
FT                   /db_xref="UniProtKB/TrEMBL:C8WA77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV51015.1"
FT                   /translation="MADTNAIYNSNYVGAAKGRPGGYAAVVDASVDIKSLLDVKKTIKD
FT                   LIAANPGKIKSLGYISEDGVEFSLDLSSEDKNDWGGNAISSSISKYSEAAKVTFLESAE
FT                   TVLRVIYGDDNVKVETDGSITVRHNPRFTAPRIYIFDAVINETTVKRSIIPIGRIFERD
FT                   TVKQNSSDFLGYTPTIKCMPAEVFDGDTYRDVFYDTTKAAVTPAAPSQQH"
FT   gene            655206..655607
FT                   /locus_tag="Apar_0586"
FT   CDS_