(data stored in SCRATCH9089 zone)

EMBL: CP001733

ID   CP001733; SV 2; circular; genomic DNA; STD; PRO; 2105791 BP.
XX
AC   CP001733;
XX
PR   Project:PRJNA40107;
XX
DT   19-OCT-2009 (Rel. 102, Created)
DT   30-JUN-2016 (Rel. 129, Last updated, Version 8)
XX
DE   Aggregatibacter actinomycetemcomitans D11S-1, complete genome.
XX
KW   .
XX
OS   Aggregatibacter actinomycetemcomitans D11S-1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Aggregatibacter.
XX
RN   [1]
RP   1-2105791
RX   DOI; 10.1128/JB.01203-09.
RX   PUBMED; 19820097.
RA   Chen C., Kittichotirat W., Si Y., Bumgarner R.;
RT   "Genome sequence of Aggregatibacter actinomycetemcomitans serotype c strain
RT   D11S-1";
RL   J. Bacteriol. 191(23):7378-7379(2009).
XX
RN   [2]
RP   1-2105791
RX   DOI; 10.1177/0022034515608163.
RX   PUBMED; 26420795.
RA   Kittichotirat W., Bumgarner R.E., Chen C.;
RT   "Evolutionary Divergence of Aggregatibacter actinomycetemcomitans";
RL   J. Dent. Res. 95(1):94-101(2016).
XX
RN   [3]
RP   1-2105791
RA   Chen C., Kittichotirat W., Si Y., Bumgarner R.;
RT   ;
RL   Submitted (03-SEP-2009) to the INSDC.
RL   Division of Primary Oral Health Care, University of Southern Californic
RL   School of Dentistry, Los Angeles, CA, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-2105791
RA   Kittichotirat W., Bumgarner R.E., Chen C.C.;
RT   ;
RL   Submitted (18-JUL-2014) to the INSDC.
RL   Division of Periodontology, Herman Ostrow School of Dentistry, University
RL   of Southern California, 925 W. 34th Street, Los Angeles, CA 90089, USA
XX
DR   MD5; 2e7e736ecd42301421098d46a0cad0e5.
DR   BioSample; SAMN02604243.
DR   EnsemblGenomes-Gn; D11S_0108.
DR   EnsemblGenomes-Gn; D11S_0109.
DR   EnsemblGenomes-Gn; D11S_0110.
DR   EnsemblGenomes-Gn; D11S_0189.
DR   EnsemblGenomes-Gn; D11S_0190.
DR   EnsemblGenomes-Gn; D11S_0191.
DR   EnsemblGenomes-Gn; D11S_02235.
DR   EnsemblGenomes-Gn; D11S_02240.
DR   EnsemblGenomes-Gn; D11S_02290.
DR   EnsemblGenomes-Gn; D11S_02295.
DR   EnsemblGenomes-Gn; D11S_02395.
DR   EnsemblGenomes-Gn; D11S_02400.
DR   EnsemblGenomes-Gn; D11S_02540.
DR   EnsemblGenomes-Gn; D11S_02545.
DR   EnsemblGenomes-Gn; D11S_0264.
DR   EnsemblGenomes-Gn; D11S_0265.
DR   EnsemblGenomes-Gn; D11S_0266.
DR   EnsemblGenomes-Gn; D11S_02770.
DR   EnsemblGenomes-Gn; D11S_02775.
DR   EnsemblGenomes-Gn; D11S_02790.
DR   EnsemblGenomes-Gn; D11S_02795.
DR   EnsemblGenomes-Gn; D11S_02800.
DR   EnsemblGenomes-Gn; D11S_02980.
DR   EnsemblGenomes-Gn; D11S_03020.
DR   EnsemblGenomes-Gn; D11S_0583.
DR   EnsemblGenomes-Gn; D11S_0584.
DR   EnsemblGenomes-Gn; D11S_0602.
DR   EnsemblGenomes-Gn; D11S_0603.
DR   EnsemblGenomes-Gn; D11S_0628.
DR   EnsemblGenomes-Gn; D11S_0629.
DR   EnsemblGenomes-Gn; D11S_0718.
DR   EnsemblGenomes-Gn; D11S_0719.
DR   EnsemblGenomes-Gn; D11S_0720.
DR   EnsemblGenomes-Gn; D11S_0721.
DR   EnsemblGenomes-Gn; D11S_0752.
DR   EnsemblGenomes-Gn; D11S_0825.
DR   EnsemblGenomes-Gn; D11S_0854.
DR   EnsemblGenomes-Gn; D11S_0913.
DR   EnsemblGenomes-Gn; D11S_0914.
DR   EnsemblGenomes-Gn; D11S_0915.
DR   EnsemblGenomes-Gn; D11S_0944.
DR   EnsemblGenomes-Gn; D11S_0945.
DR   EnsemblGenomes-Gn; D11S_0970.
DR   EnsemblGenomes-Gn; D11S_1168.
DR   EnsemblGenomes-Gn; D11S_1169.
DR   EnsemblGenomes-Gn; D11S_1170.
DR   EnsemblGenomes-Gn; D11S_1171.
DR   EnsemblGenomes-Gn; D11S_1198.
DR   EnsemblGenomes-Gn; D11S_1427.
DR   EnsemblGenomes-Gn; D11S_1452.
DR   EnsemblGenomes-Gn; D11S_1453.
DR   EnsemblGenomes-Gn; D11S_1454.
DR   EnsemblGenomes-Gn; D11S_1521.
DR   EnsemblGenomes-Gn; D11S_1539.
DR   EnsemblGenomes-Gn; D11S_1540.
DR   EnsemblGenomes-Gn; D11S_1545.
DR   EnsemblGenomes-Gn; D11S_1546.
DR   EnsemblGenomes-Gn; D11S_1547.
DR   EnsemblGenomes-Gn; D11S_1548.
DR   EnsemblGenomes-Gn; D11S_1549.
DR   EnsemblGenomes-Gn; D11S_1590.
DR   EnsemblGenomes-Gn; D11S_1663.
DR   EnsemblGenomes-Gn; D11S_1796.
DR   EnsemblGenomes-Gn; D11S_1797.
DR   EnsemblGenomes-Gn; D11S_1833.
DR   EnsemblGenomes-Gn; D11S_1834.
DR   EnsemblGenomes-Gn; D11S_1835.
DR   EnsemblGenomes-Gn; D11S_1894.
DR   EnsemblGenomes-Gn; D11S_1901.
DR   EnsemblGenomes-Gn; D11S_1902.
DR   EnsemblGenomes-Gn; D11S_1913.
DR   EnsemblGenomes-Gn; D11S_2115.
DR   EnsemblGenomes-Gn; D11S_2116.
DR   EnsemblGenomes-Gn; D11S_2117.
DR   EnsemblGenomes-Tr; D11S_0105-1.
DR   EnsemblGenomes-Tr; D11S_0107-1.
DR   EnsemblGenomes-Tr; D11S_0108-1.
DR   EnsemblGenomes-Tr; D11S_0109-1.
DR   EnsemblGenomes-Tr; D11S_0110-1.
DR   EnsemblGenomes-Tr; D11S_0189-1.
DR   EnsemblGenomes-Tr; D11S_0190-1.
DR   EnsemblGenomes-Tr; D11S_0191-1.
DR   EnsemblGenomes-Tr; D11S_0261-1.
DR   EnsemblGenomes-Tr; D11S_0263-1.
DR   EnsemblGenomes-Tr; D11S_0264-1.
DR   EnsemblGenomes-Tr; D11S_0265-1.
DR   EnsemblGenomes-Tr; D11S_0266-1.
DR   EnsemblGenomes-Tr; D11S_0348-1.
DR   EnsemblGenomes-Tr; D11S_0583-1.
DR   EnsemblGenomes-Tr; D11S_0584-1.
DR   EnsemblGenomes-Tr; D11S_0585-1.
DR   EnsemblGenomes-Tr; D11S_0587-1.
DR   EnsemblGenomes-Tr; D11S_0602-1.
DR   EnsemblGenomes-Tr; D11S_0603-1.
DR   EnsemblGenomes-Tr; D11S_0628-1.
DR   EnsemblGenomes-Tr; D11S_0629-1.
DR   EnsemblGenomes-Tr; D11S_0718-1.
DR   EnsemblGenomes-Tr; D11S_0719-1.
DR   EnsemblGenomes-Tr; D11S_0720-1.
DR   EnsemblGenomes-Tr; D11S_0721-1.
DR   EnsemblGenomes-Tr; D11S_0752-1.
DR   EnsemblGenomes-Tr; D11S_0825-1.
DR   EnsemblGenomes-Tr; D11S_0854-1.
DR   EnsemblGenomes-Tr; D11S_0913-1.
DR   EnsemblGenomes-Tr; D11S_0914-1.
DR   EnsemblGenomes-Tr; D11S_0915-1.
DR   EnsemblGenomes-Tr; D11S_0944-1.
DR   EnsemblGenomes-Tr; D11S_0945-1.
DR   EnsemblGenomes-Tr; D11S_0946-1.
DR   EnsemblGenomes-Tr; D11S_0948-1.
DR   EnsemblGenomes-Tr; D11S_0970-1.
DR   EnsemblGenomes-Tr; D11S_1168-1.
DR   EnsemblGenomes-Tr; D11S_1169-1.
DR   EnsemblGenomes-Tr; D11S_1170-1.
DR   EnsemblGenomes-Tr; D11S_1171-1.
DR   EnsemblGenomes-Tr; D11S_1198-1.
DR   EnsemblGenomes-Tr; D11S_1427-1.
DR   EnsemblGenomes-Tr; D11S_1449-1.
DR   EnsemblGenomes-Tr; D11S_1451-1.
DR   EnsemblGenomes-Tr; D11S_1452-1.
DR   EnsemblGenomes-Tr; D11S_1453-1.
DR   EnsemblGenomes-Tr; D11S_1454-1.
DR   EnsemblGenomes-Tr; D11S_1521-1.
DR   EnsemblGenomes-Tr; D11S_1539-1.
DR   EnsemblGenomes-Tr; D11S_1540-1.
DR   EnsemblGenomes-Tr; D11S_1541-1.
DR   EnsemblGenomes-Tr; D11S_1542-1.
DR   EnsemblGenomes-Tr; D11S_1544-1.
DR   EnsemblGenomes-Tr; D11S_1545-1.
DR   EnsemblGenomes-Tr; D11S_1546-1.
DR   EnsemblGenomes-Tr; D11S_1547-1.
DR   EnsemblGenomes-Tr; D11S_1548-1.
DR   EnsemblGenomes-Tr; D11S_1549-1.
DR   EnsemblGenomes-Tr; D11S_1590-1.
DR   EnsemblGenomes-Tr; D11S_1663-1.
DR   EnsemblGenomes-Tr; D11S_1796-1.
DR   EnsemblGenomes-Tr; D11S_1797-1.
DR   EnsemblGenomes-Tr; D11S_1833-1.
DR   EnsemblGenomes-Tr; D11S_1834-1.
DR   EnsemblGenomes-Tr; D11S_1835-1.
DR   EnsemblGenomes-Tr; D11S_1894-1.
DR   EnsemblGenomes-Tr; D11S_1901-1.
DR   EnsemblGenomes-Tr; D11S_1902-1.
DR   EnsemblGenomes-Tr; D11S_1913-1.
DR   EnsemblGenomes-Tr; D11S_2115-1.
DR   EnsemblGenomes-Tr; D11S_2116-1.
DR   EnsemblGenomes-Tr; D11S_2117-1.
DR   EnsemblGenomes-Tr; EBT00001761036.
DR   EnsemblGenomes-Tr; EBT00001761037.
DR   EnsemblGenomes-Tr; EBT00001761038.
DR   EnsemblGenomes-Tr; EBT00001761039.
DR   EnsemblGenomes-Tr; EBT00001761040.
DR   EnsemblGenomes-Tr; EBT00001761041.
DR   EnsemblGenomes-Tr; EBT00001761042.
DR   EnsemblGenomes-Tr; EBT00001761043.
DR   EnsemblGenomes-Tr; EBT00001761044.
DR   EnsemblGenomes-Tr; EBT00001761045.
DR   EnsemblGenomes-Tr; EBT00001761046.
DR   EnsemblGenomes-Tr; EBT00001761047.
DR   EnsemblGenomes-Tr; EBT00001761049.
DR   EnsemblGenomes-Tr; EBT00001761050.
DR   EnsemblGenomes-Tr; EBT00001761051.
DR   EnsemblGenomes-Tr; EBT00001761054.
DR   EnsemblGenomes-Tr; EBT00001761055.
DR   EnsemblGenomes-Tr; EBT00001761056.
DR   EnsemblGenomes-Tr; EBT00001761057.
DR   EnsemblGenomes-Tr; EBT00001761058.
DR   EnsemblGenomes-Tr; EBT00001761059.
DR   EnsemblGenomes-Tr; EBT00001761060.
DR   EnsemblGenomes-Tr; EBT00001761061.
DR   EnsemblGenomes-Tr; EBT00001761062.
DR   EnsemblGenomes-Tr; EBT00001761063.
DR   EnsemblGenomes-Tr; EBT00001761064.
DR   EnsemblGenomes-Tr; EBT00001761065.
DR   EnsemblGenomes-Tr; EBT00001761066.
DR   EnsemblGenomes-Tr; EBT00001761067.
DR   EnsemblGenomes-Tr; EBT00001761068.
DR   EnsemblGenomes-Tr; EBT00001761069.
DR   EnsemblGenomes-Tr; EBT00001761070.
DR   EnsemblGenomes-Tr; EBT00001761071.
DR   EnsemblGenomes-Tr; EBT00001761072.
DR   EnsemblGenomes-Tr; EBT00001761073.
DR   EnsemblGenomes-Tr; EBT00001761074.
DR   EnsemblGenomes-Tr; EBT00001761075.
DR   EnsemblGenomes-Tr; EBT00001761076.
DR   EnsemblGenomes-Tr; EBT00001761077.
DR   EnsemblGenomes-Tr; EBT00001761078.
DR   EnsemblGenomes-Tr; EBT00001761079.
DR   EnsemblGenomes-Tr; EBT00001761080.
DR   EnsemblGenomes-Tr; EBT00001761081.
DR   EnsemblGenomes-Tr; EBT00001761082.
DR   EnsemblGenomes-Tr; EBT00001761083.
DR   EnsemblGenomes-Tr; EBT00001761084.
DR   EnsemblGenomes-Tr; EBT00001761085.
DR   EnsemblGenomes-Tr; EBT00001761086.
DR   EnsemblGenomes-Tr; EBT00001761087.
DR   EnsemblGenomes-Tr; EBT00001761088.
DR   EnsemblGenomes-Tr; EBT00001761089.
DR   EnsemblGenomes-Tr; EBT00001761090.
DR   EnsemblGenomes-Tr; EBT00001761091.
DR   EnsemblGenomes-Tr; EBT00001761092.
DR   EnsemblGenomes-Tr; EBT00001761093.
DR   EnsemblGenomes-Tr; EBT00001761094.
DR   EnsemblGenomes-Tr; EBT00001761095.
DR   EnsemblGenomes-Tr; EBT00001761096.
DR   EnsemblGenomes-Tr; EBT00001761097.
DR   EnsemblGenomes-Tr; EBT00001761098.
DR   EnsemblGenomes-Tr; EBT00001761099.
DR   EnsemblGenomes-Tr; EBT00001761100.
DR   EnsemblGenomes-Tr; EBT00001761103.
DR   EnsemblGenomes-Tr; EBT00001761104.
DR   EnsemblGenomes-Tr; EBT00001761105.
DR   EnsemblGenomes-Tr; EBT00001761106.
DR   EnsemblGenomes-Tr; EBT00001761107.
DR   EnsemblGenomes-Tr; EBT00001761108.
DR   EnsemblGenomes-Tr; EBT00001761109.
DR   EnsemblGenomes-Tr; EBT00001761110.
DR   EnsemblGenomes-Tr; EBT00001761111.
DR   EnsemblGenomes-Tr; EBT00001761112.
DR   EnsemblGenomes-Tr; EBT00001761113.
DR   EnsemblGenomes-Tr; EBT00001761114.
DR   EnsemblGenomes-Tr; EBT00001761115.
DR   EnsemblGenomes-Tr; EBT00001761116.
DR   EnsemblGenomes-Tr; EBT00001761117.
DR   EnsemblGenomes-Tr; EBT00001761118.
DR   EnsemblGenomes-Tr; EBT00001761119.
DR   EnsemblGenomes-Tr; EBT00001761120.
DR   EnsemblGenomes-Tr; EBT00001761121.
DR   EnsemblGenomes-Tr; EBT00001761122.
DR   EnsemblGenomes-Tr; EBT00001761123.
DR   EnsemblGenomes-Tr; EBT00001761124.
DR   EnsemblGenomes-Tr; EBT00001761125.
DR   EnsemblGenomes-Tr; EBT00001761127.
DR   EnsemblGenomes-Tr; EBT00001761128.
DR   EnsemblGenomes-Tr; EBT00001761129.
DR   EnsemblGenomes-Tr; EBT00001761130.
DR   EnsemblGenomes-Tr; EBT00001761131.
DR   EnsemblGenomes-Tr; EBT00001761132.
DR   EnsemblGenomes-Tr; EBT00001761133.
DR   EnsemblGenomes-Tr; EBT00001761134.
DR   EnsemblGenomes-Tr; EBT00001761135.
DR   EnsemblGenomes-Tr; EBT00001761136.
DR   EnsemblGenomes-Tr; EBT00001761137.
DR   EnsemblGenomes-Tr; EBT00001761138.
DR   EnsemblGenomes-Tr; EBT00001761139.
DR   EnsemblGenomes-Tr; EBT00001761140.
DR   EnsemblGenomes-Tr; EBT00001761141.
DR   EnsemblGenomes-Tr; EBT00001761142.
DR   EnsemblGenomes-Tr; EBT00001761143.
DR   EnsemblGenomes-Tr; EBT00001761144.
DR   EuropePMC; PMC2786557; 19820097.
DR   EuropePMC; PMC3096633; 21611187.
DR   EuropePMC; PMC4700661; 26420795.
DR   EuropePMC; PMC4945079; 27414641.
DR   EuropePMC; PMC5383217; 27459270.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP001733.
DR   SILVA-SSU; CP001733.
XX
CC   On Jun 27, 2016 this sequence version replaced gi:261412053.
CC   Source DNA is available from Casey Chen, BDS, PhD, DDS, Division of
CC   Primary Oral Health Care, USC School of Dentistry.
CC   Annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (released 2013). Information about the Pipeline can be
CC   found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   ##Genome-Assembly-Data-START##
CC   Assembly Date         :: 24-MAY-2014
CC   Assembly Method       :: Velvet v. 1.2.09
CC   Assembly Name         :: AaD11S-1v2.0
CC   Genome Coverage       :: 40.15x
CC   Sequencing Technology :: 454; Illumina MiSeq
CC   ##Genome-Assembly-Data-END##
CC   ##Genome-Annotation-Data-START##
CC   Annotation Date              :: 07/17/2014 13:41:51
CC   Annotation Method            :: Best-placed reference protein set;
CC                                   GeneMarkS+
CC   Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
CC                                   Pipeline
CC   Annotation Provider          :: NCBI
CC   Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                   repeat_region
CC   Annotation Software revision :: 2.6 (rev. 440435)
CC   Genes                        :: 2,014
CC   CDS                          :: 1,890
CC   Pseudo Genes                 :: 50
CC   rRNAs                        :: 19 (5S, 16S, 23S)
CC   tRNAs                        :: 54
CC   ncRNA                        :: 1
CC   Frameshifted Genes           :: 34
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2105791
FT                   /organism="Aggregatibacter actinomycetemcomitans D11S-1"
FT                   /strain="D11S-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:668336"
FT   gene            complement(351..581)
FT                   /locus_tag="D11S_0002"
FT   CDS_pept        complement(351..581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81426"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005579329.1"
FT                   /protein_id="ACX81426.1"
FT                   /translation="MKSLKMALMLTALLSGTAVAQTPKCPDNDEVCWQQEATAEWRKEY
FT                   GDIPPPLTPEEEKEVRQWLREHYPDTDFYKP"
FT   gene            complement(578..1498)
FT                   /locus_tag="D11S_0003"
FT   CDS_pept        complement(578..1498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0003"
FT                   /product="DNA transposition protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81427"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005579331.1"
FT                   /protein_id="ACX81427.1"
FT                   /translation="MILRQQISALIKSGKLTQARLARETGVNNGALSAWLNDKYTGNAE
FT                   TVETPIENWLALGNRKVQVFVEPPNFIDTPTAKKVFAALDMAKFTGAIVPIYGASGVGK
FT                   TKAAEEYSKCNPNVWMITISPSRAGLTAFLYELALELGIKDAPRTKARLSRAVKDKLIG
FT                   TEGLVIVDESDHLTYDSIEELRYLQEKAEVGFALIGNDRVYNKMQGGINQAHEYARLWT
FT                   RLGHRCPIKASTKGDIKAITEAWGLDSGDKDLMTVLNNIGTKAGGLRALTQYLRLAAIS
FT                   AKAQGAAITLDMILTAQKQMTGGNA"
FT   gene            complement(1534..3552)
FT                   /locus_tag="D11S_0004"
FT   CDS_pept        complement(1534..3552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0004"
FT                   /product="DDE endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81428"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544209.1"
FT                   /protein_id="ACX81428.1"
FT                   /translation="MSVNNLKTHYSAKELVGLSLATLPNSVQGILYQAKKNCWATQKRV
FT                   GKGGGVEYAVKSMPEDVQAEIVVKLGKSAVKNLPVLAEESAPVDAQLLWASYEQGTAKQ
FT                   QQKAQMKLGIMFAVAELVNGGMKILDALALVCHKHNQDGLQPGEKEVTVSALKFWWYQV
FT                   KDADRSLWLPLLMDSYGAHSESREAAFTPEAWAFFRADYFRNERPQFGSCYERLKRAAS
FT                   ANGWVIPSPSSIKRKILREIPKTHQTYLRDGTYALSRMYPSLIRTVAGIEAMEWVNGDG
FT                   YKHNVWVRWHNGHIIRPKTWLWQDVRTRKILAYRCDESENTNMIRLALLDVVNKYGIPK
FT                   HLTIDNTKAAANKKMTGGVKNRYRFKVREDEVQGIIPALGIQLHWTTVRYGRGRGQAKP
FT                   IERAFSHGGLGELVDKHPLLAGYHAGDNALDKPDNYQGNKAGVDYESFILALEEGIQMF
FT                   NDRQDRATEICQGKLSFNQAFERDYAVAEKRWATPEQLRYLLTLHEEVTLKDNGTFTLK
FT                   AGGEVQGLRNRYEAYELIGTSHKKVVVRYDPNNLHDAVWVYSLDGSYLAEAHCTVDAAF
FT                   GDTTAAQDHSRKEREFVRHTQKAAKAAQDMAIQEATAYMPPVEFEENQEAEAQMWQVIK
FT                   EGTALRKVEVVPDDEQEDEAEQWLMKGIAMLKEEKGL"
FT   gene            complement(3567..3818)
FT                   /locus_tag="D11S_0005"
FT   CDS_pept        complement(3567..3818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0005"
FT                   /product="Nlp family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81429"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544208.1"
FT                   /protein_id="ACX81429.1"
FT                   /translation="METKKTAIDWHREDIKAALAKKGWSLRQLSLKHGYSNGSTLKNAL
FT                   DRPWLKGERIIAEAIGVPAEVIWASRYEQRNLKKYADR"
FT   gene            4029..4727
FT                   /locus_tag="D11S_02215"
FT   CDS_pept        4029..4727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02215"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02215"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005705075.1"
FT                   /protein_id="ANN81524.1"
FT                   /translation="MRTKFKNFSLIGSRIREERERAGRTRNELADALGLSLSTLQLYET
FT                   NEREPQASLILTIAEELGVEPSYLLTGEKNGDVGSPPIKRAQTHEISGVSMIDCFCSVN
FT                   VSAGFGSFNEGVTAPDGQVPYSDSLLQKLGIKSTHAAVFWADGTSMRPTIDDGDQMLVD
FT                   LSKKEIKGDKIYLVQNRESVWVKRVKLNWNGIELISDNKEEYAPITLTKEEADKLEIIG
FT                   QVAYIGKSVI"
FT   gene            complement(5001..6176)
FT                   /locus_tag="D11S_0008"
FT   CDS_pept        complement(5001..6176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0008"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81432"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575808.1"
FT                   /protein_id="ACX81432.1"
FT                   /translation="MNRSDYFSTQLGILRQKDQYRRFPQIHHNGKFVEQNGHQMLNLAS
FT                   NDYLGLAGDVSLQQAFLKKYIEKLPHFTSSSSRLLTGNFPEYEALEQLMANAFRREACL
FT                   LFNSGYHANIGILPAVANKQTLIVADKLVHASIIDGIRLSNSPFLRYRHNDYDHLYNIL
FT                   HKQYLHYERIIVVTESVFSMDGDLADLSQLVAFKKQFDNVMLYVDEAHGIGVYGERRLG
FT                   VAEQTNCLPDIDFLVGTFGKAFASMGAYVVCDRVIKDYLINTMRPLIFSTALPPFNVAW
FT                   TTFLFEKQPHFQAKRQHLMQLSARLRQVLAEQFNMPMPSESHIVPYILGENQRTIKIAH
FT                   RLQQCGYYCLPIRPPTVPVGTSRIRLSLTADMTHDEIEQFIEQLFYAISIN"
FT   gene            complement(6169..7302)
FT                   /locus_tag="D11S_0009"
FT   CDS_pept        complement(6169..7302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0009"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81433"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575806.1"
FT                   /protein_id="ACX81433.2"
FT                   /translation="MVAALHGYNHPRLNAAANKQLAQMSHIMFGGLTHEPAIKLTQKLL
FT                   PLLPSGLEQIFFADSGSIAVEVAMKMAIQYQHAKGETQRYKFATIRSGYHGDTWHAMSV
FT                   CDPVTGMHSLFAKSLPVQYFLPQPQTSFGQPWCEEDIAPLADLLEKRGAELAALILEPV
FT                   VQGAGGMYFYSPMYLVRAQQLCQQYGVLLIFDEIATGFGRTGKLFAAEYAGISPDIMCI
FT                   GKALTGGYLTLSATITTRVIAQTICRGEAQCFMHGPTFMANPLACAIATASIDLLLEND
FT                   WQGNVKRIEQQLKAELQIAENFNAVKAVRVLGAIGVLEMYEPVNLTSLQVRLVANGVWV
FT                   RPFGRLVYLMPPFIISPSQLSALTSGMLAAIREEYYE"
FT   gene            7680..8549
FT                   /locus_tag="D11S_0011"
FT   CDS_pept        7680..8549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0011"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81435"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567744.1"
FT                   /protein_id="ACX81435.1"
FT                   /translation="MNKSTYWQRLKVAFQYVMPQLYLTQLAGWFAKQKWGAVTHFVIKL
FT                   FAKKYNVDMSEAKKENFSDYESFNQFFIRELKDGARKINENPTALCLPADGRVSQIGHI
FT                   DDELLLQAKGHFFSLSDLLAGDEELVNTFKNGEFATIYLSPRDYHRVHMPCDATLRKMI
FT                   YVPGALFSVNPFLAEHVPNLFARNERVICLFDTEFGPMVQILVGATITASMSTVWAGVI
FT                   NPPRADEVKVWTYQEENAVKLTKGQEMGAFQLGSTVINLFPANRVTLAEHLQVDEPVRV
FT                   GEMLATIN"
FT   gene            8575..9207
FT                   /locus_tag="D11S_0012"
FT   CDS_pept        8575..9207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0012"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81436"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547705.1"
FT                   /protein_id="ACX81436.1"
FT                   /translation="MTAAFFNQVKLDDTQAKGSYGIGLQIGQQLLDSQLAVKTEAVAKG
FT                   IYDVLNQHAPVLDFNEISQALQQLQQQAAEAQQAQFKEIEAAGKAFLEANKQKDGVKMT
FT                   DSGLQYEVLIEGDGKVPSATDKVSVHYTGTLPDGTVFDSSVTRGQPAEFPVNGVVKGWV
FT                   EALSMMPVGSKWRLAIPHELAYGERGAGAAIPPFSPLVFEVELLDIL"
FT   gene            complement(9271..9513)
FT                   /locus_tag="D11S_0013"
FT   CDS_pept        complement(9271..9513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0013"
FT                   /product="glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81437"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562677.1"
FT                   /protein_id="ACX81437.1"
FT                   /translation="MLIQHKSLLPAGIVRVSRRFSRGEVVRIRNAQGKDIALGMPRYNS
FT                   DALELIKGKQSQDIEQQLGYEYGAVAIHRDDMIVL"
FT   gene            complement(9507..10007)
FT                   /locus_tag="D11S_0014"
FT   CDS_pept        complement(9507..10007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0014"
FT                   /product="glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81438"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547708.1"
FT                   /protein_id="ACX81438.1"
FT                   /translation="MMEIVRQLAQLHQAGFRLVIVTSGAIAVGRHYLNHPQLPPTVASK
FT                   QLLAAVGQSQLIQTWEKLFAIYDIHIGQMLLTRTDIEDRERFLNARDTLHALLDNRIIP
FT                   VINENDAVATAEIKVGDNDNLSALVAILVQADRLESRKQWLFAAPSAGVLTIDEMKAHK
FT                   VRC"
FT   gene            10243..11028
FT                   /locus_tag="D11S_0016"
FT   CDS_pept        10243..11028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81440"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167461.1"
FT                   /protein_id="ACX81440.1"
FT                   /translation="MERENITPDYQREVTRLCVQTALLLLQHGAESTVVSQMAQRLGLA
FT                   LGVDSVECALTANAVVITTLANNHCITTARKSTDKGINMQMVTDVQRIVISAEHKIYDI
FT                   QLVRKKLSQLKPLKYNHYFVVLMIGLSCASFAHLSGGNALISLITFLAASVAMFVRQEL
FT                   SKRHYNPVIVFAVTAFVASLIAGISLKYQLGNDPQIALASSVLLLVPGFPLINSLADIL
FT                   KGYVNMGIGRWAIATILTFGACLGIVFALSVLNITTWGH"
FT   gene            11030..11494
FT                   /locus_tag="D11S_0017"
FT   CDS_pept        11030..11494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0017"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81441"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006716906.1"
FT                   /protein_id="ACX81441.1"
FT                   /translation="MDWLLLLLDDMFFAAIPAVGFALVFNVPPKALKYCALLGALGHVT
FT                   RTILIQCNIPIVFATLVGAALIGFIGVHLSHRYLAHPKVFTVAAIIPMIPGVQAYKAMI
FT                   AIVQIHHYGFSDALFEQMIASFISTTFILGALVFGLALPGLLFYREKPVV"
FT   gene            11534..12019
FT                   /locus_tag="D11S_0018"
FT   CDS_pept        11534..12019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0018"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81442"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566121.1"
FT                   /protein_id="ACX81442.1"
FT                   /translation="MRLSLIVAMTKNHVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGR
FT                   KTFESIGRPLPKRTNIVLSRQPFVHDGIIWKDSLESAVDFVIDSDEIMLIGGGQLFKQY
FT                   LPQATRLYLTEIQTELEGDTFFPPIDWNHWNIEFEQYRPADEQNPYDCRFMILVRKG"
FT   gene            complement(12139..13449)
FT                   /locus_tag="D11S_0019"
FT   CDS_pept        complement(12139..13449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0019"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81443"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577108.1"
FT                   /protein_id="ACX81443.1"
FT                   /translation="MSLFTAILVLILLIIISAVVSSAEISLAGARRIKLQNMVNEGNTK
FT                   AAMVLKLQEQPGRFITVVQIGLNMVAVLGGVIGEATIRVHLQHVIHQYTDAAWVESAAS
FT                   WIAFFIVTASFILLADLMPKRLAMTNPEVVALRTVRIMQICIFLLKPIVWVFDSVANFI
FT                   FRIFKVSTVREESMTSEDIVAVVDAGAEAGVLKAQEHYLIENIFDMQQRTVTSTMTTRE
FT                   NIIFLDRTFTRQQVLDTLTKNSHSKLLICDQGLDHILGYVESHSLLTLFLKEEQVQLTD
FT                   NRLLRKPLFVPDTLSLYEVLELFKSTGEDFAVIVNEYALVVGIVTLNDVMSIVMGELVS
FT                   SEEEQIIRRDEDSWLVDGATPLEDVKRALDIEVFPHDENYETIAGFMMYMLRKIPKKTD
FT                   FVLYGRYKFEIIDTENFKIDQLMVSFRRDLEESNHKD"
FT   gene            complement(13540..14064)
FT                   /locus_tag="D11S_0021"
FT   CDS_pept        complement(13540..14064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81445"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577106.1"
FT                   /protein_id="ACX81445.1"
FT                   /translation="MRKFFKYFFITVILVFHLFLFATVHYVFPRYDVTQVTGVEVKRMD
FT                   KDGLITKTNPADGPTRDVYFINTQHPDGKVRVYRNEDTGWGFPFYFKFGSANLQAEAQA
FT                   LGNEQKTVQMKYYGWRITVFNEFPNALSVEALAEGESPNHPIFAYIFYVILLFTLFFSV
FT                   QFVRGWFDSEN"
FT   gene            complement(14096..14878)
FT                   /locus_tag="D11S_0022"
FT   CDS_pept        complement(14096..14878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0022"
FT                   /product="DNAse"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81446"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518335.1"
FT                   /protein_id="ACX81446.1"
FT                   /translation="MFIVDSHCHLDALDYEKLHENIADVVAKANARDVKHLLAIGVTLS
FT                   RFEKAYPELVKFDNVSLACGVHPLDFEEEPYDAARLLHLAQDPKVVAIGEIGLDYYYSA
FT                   ENKAQQQAVFASQIEVANQLNKPVIIHTREAREDTMSLLRDNHAEKCGGVLHCFTENYD
FT                   MAKQALDLGFYISISGIVTFKNAEEIRDVVRKLPLDCLLVETDSPYLAPVPYRGKQNQP
FT                   AYTREVCEYVAALKGVSVQEMAQITTQNFERLFKIQVQ"
FT   gene            complement(14882..15865)
FT                   /locus_tag="D11S_0023"
FT   CDS_pept        complement(14882..15865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0023"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="catalyzes the DNA-template-directed extension of the
FT                   3'-end of a DNA strand; the delta' subunit seems to
FT                   interact with the gamma subunit to transfer the beta
FT                   subunit on the DNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81447"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518334.1"
FT                   /protein_id="ACX81447.1"
FT                   /translation="MIALYPWLTPVYQKITQAFEEGLGHHALLIRADEGLGAEQLCRLL
FT                   AQRLMCLTPKGAEPCGECHACHLMQANSHPDFQHIAPIENKDIGVDQIRAMNEQASQHA
FT                   QQNGNKVIYIEQAHRLTEAAANAILKTLEEPRPNTYFILQNDMQKALLPTIYSRCQVWN
FT                   LLPPATDTALHWLQTQTSAETSEILTALLVNYGRPLLALAMLTQHLPEQRREFLRQFWL
FT                   FYRRRSPLELLPFFNKEILLQQLDWLLAFLSDSLKNKLAIQENWICRDIERGVIQFSQG
FT                   LSAPALLKATQIVGKVRSDLAANNALNQELILLDGLTRLITEVFEG"
FT   gene            complement(15862..16491)
FT                   /locus_tag="D11S_0024"
FT   CDS_pept        complement(15862..16491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0024"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81448"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547728.1"
FT                   /protein_id="ACX81448.1"
FT                   /translation="MVGKFIVIEGLEGAGKSTAHQCVVDTLKTLGIGEVISTREPGGTP
FT                   LAEKLRHLIKHENEEPTDKAELLMLYAARVQLVENVIKPALAQGKWVVGDRHDMSSQAY
FT                   QGGGRQLGKDLLSSLKQTVLSDFEPDLTLYLDIDPAVGLARARGRGELDRIEQQNPDFF
FT                   HRTRARYLELVKDNPKAVIIDAAQPVEQVRADIQSAVKNWWVSLSR"
FT   gene            complement(16493..17536)
FT                   /locus_tag="D11S_0025"
FT   CDS_pept        complement(16493..17536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0025"
FT                   /product="aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81449"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005550170.1"
FT                   /protein_id="ACX81449.1"
FT                   /translation="MKKFCLFLLFLLIFLAGASFWGYRQLQQFVQQPVNVQKDRLFTVE
FT                   RGTTGNKLVTLLQNEHLLENASLLPWVLKIYPEFNKVKAGTYALDNVKTVEDLLKLLNS
FT                   GKEAQFNVQFIEGNTFKTWRKRLENAPHLKQTLKDKSEQEIFHLLAIPDVAQEVYEWLK
FT                   IEGWLYPDTYNYTPNSTDLELLQRSAERMKKALDKAWQERDKDLPLANPYEMLILASIV
FT                   EKETGIAAERPQVASVFINRLRAKMKLQTDPTVIYGMGDDYNGNIRKKDLETPTPYNTY
FT                   VIDGLPPTPIAMPSEEALQAVAHPAQTAFYYFVADGTGGHKFSRNLNEHNKAVQQYLRW
FT                   YREQNGK"
FT   gene            complement(17675..18013)
FT                   /locus_tag="D11S_0026"
FT   CDS_pept        complement(17675..18013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81450"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005758618.1"
FT                   /protein_id="ACX81450.1"
FT                   /translation="MKKIEAIIKPFKLDDVREALSDIGITGMTVIEVRGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKMEIVVPNDLLDRCLDAIIDTAQTGKIGDGKIFVYEVERVIRIRT
FT                   GEENEDAI"
FT   gene            complement(18089..18847)
FT                   /locus_tag="D11S_0027"
FT   CDS_pept        complement(18089..18847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0027"
FT                   /product="DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81451"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567726.1"
FT                   /protein_id="ACX81451.1"
FT                   /translation="MIPAERQKLLLNLINQKGIVSISKLMESLNVSHMTIRRDIQKLEE
FT                   MGKVVSVSGGVKIHEHLSFEPTHQDKSLLFHDQKEKIGEQAAKLIPSNTTIYLDAGTTT
FT                   LEIAYRIIERDDLLVITNDFSITHFLMTSGKCQLIHIGGSVNKLNHSSVGELAGQFLRQ
FT                   LSVDIAFISTSSWTLTGLTTPDEMKLPVKKTIIESSNKRILVSDSSKYGKVATFKIAAL
FT                   SVFNTIICDKNLLPNTKEAIHDMDIELLLV"
FT   gene            19040..19945
FT                   /locus_tag="D11S_0028"
FT   CDS_pept        19040..19945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0028"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81452"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567723.1"
FT                   /protein_id="ACX81452.2"
FT                   /translation="MTNKSYSVAIVGLGAMGMGAAQSCIRAGLTTYGVDLNPKALEKLK
FT                   TDGAHATSQSAVDFADKLDAVLLLVVNAVQVNSVLFGENGLAAKLNKGTAVMVSSTISA
FT                   QDAKAISQKLTDLGLVMLDAPVSGGAAKAALGEMTVMASGSAQAFEKLQPVLDAVAGKV
FT                   YNIGEEIGLGATVKIIHQLLAGVHIAAGAEAMALAAKAGIPLNLMYDVVTNAAGNSWMF
FT                   ENRMKHVVEGDYSPLSMVDIFVKDLGLVNDTAKSLHFPLHLASTAYSMFTEASNAGYGK
FT                   EDDSAVIKIFSGIELPKKGA"
FT   gene            19945..21192
FT                   /locus_tag="D11S_0029"
FT   CDS_pept        19945..21192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0029"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81453"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538581.1"
FT                   /protein_id="ACX81453.2"
FT                   /translation="MMLGVIADDFTGASDIASFLVENGLHTVQMNGVPNAPLTEKVDAI
FT                   VISLKSRSNPVNEAIEQSLQALHWLQKSGCSQFYFKYCSTFDSTPKGNIGPVTDALLEA
FT                   LDDDFTVITPALPVNGRTIFNGYLFVGNVLLNESGMRDHPITPMKDANLIRLMDAQAKG
FT                   KTGLVSYADVIQGAEHLKACFTRLKQAGFRYAVVDAVDNSELAVLAEAVSELKLVTGGS
FT                   GLGAYMAARLSGGKKATDAFVPKKGRSVILSGSCSVMTNKQVNAYKEKATAIYLDVEKA
FT                   IAESNYTETLFDQVQPHFSEPLAPMVYATVPPEQLKQIQSRFGGERASHAIEKAFANLA
FT                   QLLKEKAKVENFITAGGETSSIVVQQLGFTGFQIGKQIAPGVPWLKVLGESTALALKSG
FT                   NFGKETFFTDAQGMML"
FT   gene            21189..21821
FT                   /locus_tag="D11S_0030"
FT   CDS_pept        21189..21821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0030"
FT                   /product="aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81454"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558412.1"
FT                   /protein_id="ACX81454.1"
FT                   /translation="MSDGELKKIMVRLGHSFYERGYTVGGAGNLSTRLDGNRILVTPTG
FT                   SSLGRLEEARLSILDMEGNLLEGDKPSKESVFHLAMYRKNPECKAIVHLHSTYLTALSC
FT                   LENLDPQNAIKAFTPYYVMRVGSLPVIPYYRPGSPRIAEELEARALSGKAFLLANHGVV
FT                   VTGKDLLDAADNTEELEEAAKLFFLLQGQPIRYLNDDEVNELKNRGK"
FT   gene            21824..22600
FT                   /locus_tag="D11S_0031"
FT   CDS_pept        21824..22600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81455"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547735.1"
FT                   /protein_id="ACX81455.1"
FT                   /translation="MPKFAANLTMMFNEVSFIDRFEAAANAGFKYVEFLWPYDYSVETI
FT                   RQELDKHGLKVVLFNTPAGDVSKGGWGVSAIPGREEQSHQHIDMALEYALGLGCPNVHI
FT                   MAAVVPEGADKSEYQQIFIQNIRYASEKFKPHGVNILLEALSPEVKPHYLLKSQYDTLD
FT                   IVERVERDNVFVQLDYFHAQNVDGNLSRLTDKLNGKFAHVQIASVPDRHEPDEGEINYE
FT                   YLFNKLDEIGYQGFVGCEYKPRGETSSGLGWFEQYK"
FT   gene            22689..24041
FT                   /locus_tag="D11S_0032"
FT   CDS_pept        22689..24041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0032"
FT                   /product="GntT protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81456"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547737.1"
FT                   /protein_id="ACX81456.1"
FT                   /translation="MSNEILILIGITSVAALLTIMIKGKVHPFIALGLVSITVALSAGI
FT                   PTNKVIPTLVSGMGGTLGNVALIVGLGAMLGKIIEKSNGADVLAAWLLDKFGEKHAAFA
FT                   LGATGFIFGIPVFVDVGFIVLLPIIFSVARRLGGNMLVYALPIGLSMLMVHVMLPPHPG
FT                   VVAGAQVLNADIGFVLGIGLCAALPAYLLGQLFIPFFTNRTFIHIPTSADLIQYQKQLS
FT                   HDASGLPKFGTVLSIIVFPLVLIMLGTITAVTLPKEHIIREIFSMVGSSPFALLLAVCV
FT                   SSYVLGLRRGWNKEKLEEILNSSLAPIAGIILITGAGGMFGKVLDASGVGKALAEVLSG
FT                   TGLHVLTLGFVLAALLRAAQGSATVAIITTATILSPIITTAGYSGVRITLITAAMGAGS
FT                   MTLSHVNDSLFWVWTKFFGISVADGLKTWTILTTIYGSIAFLIISLMWFFI"
FT   gene            24066..25406
FT                   /locus_tag="D11S_0033"
FT   CDS_pept        24066..25406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0033"
FT                   /product="phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81457"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558407.1"
FT                   /protein_id="ACX81457.1"
FT                   /translation="MLRKILIAFLLLITDLGILAQDDTPKEGKPINIILLAEVTSSGQK
FT                   ITGLALEYEDYVLSSSDLRNTYQVFTLLERQEQPRTIIRAYVNNLPEKTPQAKSGKFVI
FT                   IEFDDRDTNANLYSLITDNKNPMKFRAKDQSGHIIEIEKVQSTKIPQYYDEKLVYKIKQ
FT                   IGYVKLSNGKTIDRNEVIQNAERKNVRTLFIDDFSEQVVALNENNLLKYRFYRPHLTEH
FT                   KKYPLTIFLHGSGQVGSDNIAHIISNKGAISTLQYEPGFVLAPQYNTIFDPFDDKNHGQ
FT                   KGGIHWQTRNRANLVLKMIDETVQQNPAIDEKRIYLIGLSRGSEGVLNLLLMRPNFFAG
FT                   ALLASGREAHTIEWLDGNANSINLAPIKNVPMWFFHSKEDQISPVKGSRINYQILVNEL
FT                   NAKNVRYTEFSTERAGDNGILNNAHNTWEAVFNSPEVISWLLQQKRH"
FT   gene            25424..26116
FT                   /locus_tag="D11S_0034"
FT   CDS_pept        25424..26116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0034"
FT                   /product="cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81458"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575783.1"
FT                   /protein_id="ACX81458.1"
FT                   /translation="MFIYLSHPLDPNDLVWPGEPTVKVTRCTDVVSDNAPFSSFITELP
FT                   NHCGTHMDAPRHFVKDGLSINELPIEYFCHKKAALLEIPKSDAEGITQEDLVPYADTLK
FT                   NVSFAFLRTGFEKYRTEDPVRYQNEGPYIATSAGKYLSENFPNLKGVGIDFLSLGSPSA
FT                   KVPAVENPRNCHRAILGYYTGKFTTVIEDMHLSELPRNARIKQFFNAPLRIVGLDSSQV
FT                   TCIAEVFD"
FT   gene            26164..27960
FT                   /locus_tag="D11S_0035"
FT   CDS_pept        26164..27960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81459"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566203.1"
FT                   /protein_id="ACX81459.1"
FT                   /translation="MIRKSFVWGGLFLIFTFISAYVAALVERDFGQLEISTISFMTEEQ
FT                   QPMVAKLYRPQSATDKTPKPGLLALHGYQSDKEATNTFGALELAKRGFVVLAIDHFGHG
FT                   YSTKLPASNKNMSGANNGYQYLKSLPFVDSRRLGIFGHSTGALNAIRVAQLNPDHKAIN
FT                   GQSSNGGDPGLHNYLLTQGLYEEIAGYREKSFPVKELAKNTNRLKAFSLEKSGGLQWDH
FT                   TYGNFTDGSARRAALVEGTHLGVMVSSHTNKEAILWFNQALQQGQQDADWIEPEQQTYW
FT                   YKEIAGLFALSFAVISALCLAAGLLKNPYFSAVTQMPSRKVELPSGKWVHFAMCNIIAT
FT                   MILYPLFTQWGGANEPIASMISFMPLEMGNGIVLWLVVSAIVNYLLFFLWSHKKSISWQ
FT                   EFGILAGKPNITTSQLIGLYLILAAILVSYLYGIAYVVHSYWQVELRFLWPAFKPLTPE
FT                   RFALFPIYWLFILFFFYSFNGLVVTVQMRMKQAKNFTITLIGWTIKTSFFAVSGLVLLW
FT                   LFHFIPDFMQLGPGFDLIGLPQFGGRWMMMLSVIIPQFIVLILISHWCYLKTGYVYLGV
FT                   FLTSILMTWIIVGGQVIGRFLA"
FT   gene            28156..28974
FT                   /locus_tag="D11S_0036"
FT   CDS_pept        28156..28974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0036"
FT                   /product="HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81460"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518333.1"
FT                   /protein_id="ACX81460.1"
FT                   /translation="MTYQVIAFDLDGTLLNRQGSILPASKHAIQLARKQGMKVVFVTGR
FT                   HHTAVKPYYHEVNLDTPIICCNGTYLYYPQTDEVKFANPLSAAQCHKVLDIADQFDTHL
FT                   LMYSRDAMNYTRLNPHMEKFTQWAMSCPPAVRPDVRLVTDFKVIINNSKENIWKFVISS
FT                   PDRQAMESAVKSLPESEFSCEWSWIDRVDVANNGNSKGARLLDLLKLWNINPQNVIAFG
FT                   DNHNDISMLTAVGLSVAMGNAEDAVKAQAKRVIGSNDSDGIARFIEEILG"
FT   gene            complement(29180..31780)
FT                   /locus_tag="D11S_0037"
FT   CDS_pept        complement(29180..31780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0037"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="This protein performs the mismatch recognition step
FT                   during the DNA repair process"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81461"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006710252.1"
FT                   /protein_id="ACX81461.1"
FT                   /translation="MILEDNLTQHTPMMKQYLQLKAENPDILLFYRMGDFYELFYDDAK
FT                   RASALLDISLTKRGQSAGQPIPMAGVPYHAVEGYLAKLVQLGESVAICEQVGDPNTAKG
FT                   PVERQIVRIVTPGTVSDEALLPERQDNLIAAVYQEKDHFGLATLDMTSGRFQVCEPQSP
FT                   ADLQTELQRIAPVELLYCEDFADFQLIEHAKGLRRRPIWEFELKTAIQQLCHQFNTKDL
FT                   RGFGVEKAILGLCAAGCLLQYARETQRTALPHIQSIYLVQHSENIQLDAATRRNLELTQ
FT                   NLSGGTENTLAAVLDKCVTPMGSRLLKRWIHQPICDVAKLMQRQQAIGTILEQDLAADL
FT                   QPYLQQVGDMERILARVALRTVRPRDLTRLRTALEQIPYIKNLLAEKTSAKMTALYQQL
FT                   SDFSVQFDLLQRAIIESPPVLIRDGGVIAPGYHAELDEWRALADGATRYLEELEQRERE
FT                   STGIDSLKIGFNAVHGYYIQISQGQAHKAPIHYVRRQTLKNAERYIIPELKTYEDKVLK
FT                   AKGASLALEKQLYDEIFAQLLPHLSRLQLAGLALAELDVLTNLAERAENLNYVAPTFSE
FT                   QTGIHIQNGRHPVVEQVLKEPFIANPTELTEQQHFLIITGPNMGGKSTYMRQTALITLM
FT                   AYMGSFVPADSAVIGPIDRIFTRIGASDDLASGRSTFMVEMTEMANILHQATEKSLVLI
FT                   DEIGRGTSTYDGLSLAWACAEWLAKKIRSLTLFATHYFELTILPEQVNGIGNIHLDAME
FT                   HNDTIAFMHAVQHGAASKSYGLAVAALAGVPQQVIKLAEQKLAQLEKLSNQNTNQQIQD
FT                   LRLLNQRQGELAFESAEDENKDMLLHMLQELDPDELSPKQALAYLYQLKKMVKN"
FT   gene            complement(31865..32911)
FT                   /locus_tag="D11S_0038"
FT   CDS_pept        complement(31865..32911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0038"
FT                   /product="signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81462"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012820796.1"
FT                   /protein_id="ACX81462.1"
FT                   /translation="MSDRESYQQAVETFLSTQNLSGHFQLAALPIQTWFTRHGFSAPLW
FT                   RLAQQISPENPIILFWENALSVEAIAEDTEYLVQESVTFEPFLDIFSKNALPDILKKGF
FT                   FAELIGLDERHFLTDKEEIPLQLQQTGKHYYAVIDTSKVVAYPSALKGSGQIANLYKGK
FT                   TGETLEDAAPYLFEFDPGNSGSIMFLQKLFRKMESRVLSHWETNPVIFIRSDKDFDMVY
FT                   HHLRKFTHLYNPEEEIWYFFRFYDPKVLSACLPYDERQPADRRMEHITSVFNKATAIFG
FT                   DARRSPTGFKYHYIIFILFGSLTPRIRWFFYLTPHTIALSLSSRFLLKLWICYTMYFQR
FT                   LQKTYIKT"
FT   gene            complement(33098..33856)
FT                   /locus_tag="D11S_0039"
FT   CDS_pept        complement(33098..33856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0039"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81463"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564125.1"
FT                   /protein_id="ACX81463.1"
FT                   /translation="MNIQLLCETKTPEKPTALFTDAGLTHDPHSPLALVWTEADGVERL
FT                   ELRKLDEPKLGAVFVDFVGGAMAHRRKFGGGRGEAVAKAVGVKQDKLPTVIDATAGLGR
FT                   DAFVLATLGCQVKLVERHPVVRLLLQDGLQRAYADEEIGSWMQRNMQLLPYQHINELNP
FT                   ETDCADVVYLDPMYPHKTKSALVKKEMRVFQHLVGADLDADELLAPALQLARQRVVVKR
FT                   PDYADFLARKTPHFSRETKNHRFDVYVKHG"
FT   gene            complement(33858..34955)
FT                   /locus_tag="D11S_0040"
FT   CDS_pept        complement(33858..34955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0040"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="catalyzes the formation of 5-methyl-uridine at
FT                   position 54 in all tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81464"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564127.1"
FT                   /protein_id="ACX81464.1"
FT                   /translation="MLNLPVERYSALLAEKQKKLTALFAPFNAPELQVFASPTQHFRMR
FT                   AEFRIWHEQDDFYHIMFDQQSKQRYRVDCFPIANELVNRMMTALLPLLKQQIVLHHKLF
FT                   QIDYLSTQSQQIIVSLLYHKTLDDAWQTAARTLRSQLHQQGFNVQLIGRASKQKICLEQ
FT                   DYVDEILSVHGKQYIYRQVENSFIQPNAAVNSKMLEWAVDCTRNSHGDLLELYCGNGNF
FT                   SITLAQNFRQVLATEIAKPSVAAAQFNIAANKVENLQIIRMSAEEFTQAMQGVRAFNRL
FT                   KGIDLTAYQCNTIFVDPPRAGLDNETLKLVQQYERVLYISCNPHTLCDNLQILCQTHRI
FT                   EKAALFDQFPYTEHMEAGVWLVRKS"
FT   gene            complement(35025..35354)
FT                   /locus_tag="D11S_0041"
FT   CDS_pept        complement(35025..35354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81465"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005701977.1"
FT                   /protein_id="ACX81465.1"
FT                   /translation="MAESFSVTRRFFDDKNYPRGFARHGDYTIKEAQALEQYGQAFRAL
FT                   DSGERKPATAEEKAFVAFCRGKREAETFFEKTWNKYRSHISASKRLYTLSGVVGVDNLD
FT                   DYSAD"
FT   gene            complement(35414..36031)
FT                   /locus_tag="D11S_0042"
FT   CDS_pept        complement(35414..36031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0042"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81466"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566499.1"
FT                   /protein_id="ACX81466.1"
FT                   /translation="MKKWLFLALTAAFSVSVQAQDLTEGKQYTVVEGQQRTAQPEVIEF
FT                   FSFYCPHCYSFEAQYHIPQKVAEALPEGTSFKQYHVDFLGLQSENLTRAWALAIAIKAE
FT                   EKVKIPLFKAAQTNTLKAMDDIRQIFIDNGISAEQFDGGINSFAVSGLVAKQQNLVEKY
FT                   QLRGVPDFYVNGKYRVNTEGLARDEKGFVAEYVETVKGLLQR"
FT   gene            complement(36050..36316)
FT                   /locus_tag="D11S_0043"
FT   CDS_pept        complement(36050..36316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81467"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547759.1"
FT                   /protein_id="ACX81467.1"
FT                   /translation="MKCHRLNEVLELLQPYWSKDSDLHLTQILQKIADEAGFDKPLTEL
FT                   PDEVIIYHLKMAGKDKFEPIPGIKKDYEEDFKAALLKARGIIK"
FT   gene            36400..36984
FT                   /locus_tag="D11S_0044"
FT   CDS_pept        36400..36984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0044"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81468"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564132.1"
FT                   /protein_id="ACX81468.1"
FT                   /translation="MTISISAVILAGGRATRMGGADKGLQRLHGKPLFQWIYERLRPQV
FT                   AQVSVNANRNQADYAAAGLPVFADNMEGFQGPLSGILTALERSDTDFVLFVPCDSPFFP
FT                   ENLLEKLKSAVIFHSVSVAYAHDGEREHPTFCLMARSLKDKLAAYLASGERRMLHFMRQ
FT                   NGAVSVDFSENKQAFANINTFDELQQLNGQA"
FT   gene            37083..37613
FT                   /locus_tag="D11S_0045"
FT   CDS_pept        37083..37613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81469"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167466.1"
FT                   /protein_id="ACX81469.1"
FT                   /translation="MLKKLSILVFASLLSACSLSSISSYVPFMGDKKTVINLDEDKIDQ
FT                   KSYATAYEATVETYRDRVNDNYNVNSFASGAKDWYLGRILIPVEQIKEKLYSPQGQDSD
FT                   VYAYYSGVLHAEALQGNFAKLNPNCWSYIDTPSTTQGIYDAMLDLQKGKVRSEHDEYIA
FT                   QGSEQLLKLCTGK"
FT   gene            37725..39254
FT                   /locus_tag="D11S_0046"
FT   CDS_pept        37725..39254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0046"
FT                   /product="bifunctional PTS system fructose-specific
FT                   transporter subunit IIA/HPr protein"
FT                   /note="phosphoenolpyruvate (PEP)-dependent, sugar
FT                   transporting phosphotransferase system; catalyzes the
FT                   phosphorylation of incoming sugar substrates concomitant
FT                   with their translocation across the cell membrane; IIA is
FT                   phosphorylated by phospho-HP which then transfers the
FT                   phosphoryl group to the IIB componentr"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81470"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588813.1"
FT                   /protein_id="ACX81470.1"
FT                   /translation="MFNLPESNIHLAAQADNKQQAIEMAVNALEQAGYVESGYLQGMLG
FT                   REQQTSTFLGNGIAIPHGTLETRSMVKNTGVQIFQFPQGIEWGEGNIAYVVIGIAARSD
FT                   EHLALLRQLTHVLGDEDTAAKLATLTDVKKFRAILMGEAEEFKVAAENISLDVDTASLL
FT                   TLIAINAGKLEQQSAVNNQYVSEVIANPALPLAQGLWVTDAAVGNQKNAIAFSRAKQAF
FT                   SLNNKAVHGVVTVAYANDQINEALTRLLDAKVKQILLNGDGAQIVAALNGAAIPEAAAP
FT                   TASSEPVVAGGSVVGTFTIRNEHGLHARPSAILVNEVKKFTSKINVENLTRGSAPVSAK
FT                   SLMKIVALGVTQGHRLRFVAEGEDAQAAMEAIGKVIAAGLGEGVSAVPPSEPDTIEVMG
FT                   QATPAASASSHESAVQNPGESVEGIFEVKNEHGLHARPAAVLVSEVKKYNANVAVQNLS
FT                   RDSQLVSAKSLMKVVALGVVKGHRLRFVATGEQAQQAIDGIGAAINAGLGE"
FT   gene            39257..40198
FT                   /gene="fruK"
FT                   /locus_tag="D11S_0047"
FT   CDS_pept        39257..40198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="D11S_0047"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="converts fructose-1-phosphate and ATP to
FT                   fructose-1,6-bisphosphate and ADP; highly specific for
FT                   fructose-1-phopshate; similar to PfkB; forms homodimers"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81471"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547767.1"
FT                   /protein_id="ACX81471.1"
FT                   /translation="MAKVATITLNAAYDLVGRLKRIELGEVNTVETLGFFPAGKGINVA
FT                   KVLKDLDVDVTVGGFLGEDNQGDFVTLFDKLGLQDKFQRVPGKTRINVKITETEADVTD
FT                   LNFLGYEISTDAWQQFVTDSLAYCKAFDIVAVCGSLPRGVTPELFADWLKQLHQAGVKV
FT                   VLDSSNAALTAGLTAQPWLVKPNHRELEAWIGHALPTLDDIIAAAKKLKAQGIANVIIS
FT                   MGANGSLWLSDAAVVQAQPPKCENVVSTVGAGDSMVAGLIYGVINGLPQHQTLAFASAV
FT                   SAFAVSQSNVGISDRSLLEPILNNVKITVIEG"
FT   gene            40203..41867
FT                   /locus_tag="D11S_0048"
FT   CDS_pept        40203..41867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0048"
FT                   /product="PTS system fructose-specific transporter subunits
FT                   IIBC"
FT                   /note="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system; catalyzes the phosphorylation of
FT                   incoming sugar substrates concomitant with their
FT                   translocation across the cell membrane; IIB is
FT                   phosphorylated by IIA and then transfers the phosphoryl
FT                   group to the sugar; IIC forms the translocation channel"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81472"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005550580.1"
FT                   /protein_id="ACX81472.1"
FT                   /translation="MHIYFTPSANFGNAKAFLLRQMLSAAATQHQIVDNADAAELIIVL
FT                   GDQLPNNPQFHGKKVFLAKIDEHFNAPEQLLDTAIQQAQDYVPPTESAVISDGKIKNIV
FT                   AVTACPTGVAHTFMSAEAIETYAKQQGWQVKVETRGQVGAGNEITPEEVAAADLVFVAA
FT                   DIDVPLDKFKGKLMYRTSTGLALKKTAQEFDKAFKEAKVFDGGAAQVGAKAEESGEKKG
FT                   VYKHLMTGVSHMLPLVVAGGLLIAISFMFGIEAFKDETIAGGLPKALMDIGGGAAFHLM
FT                   IAVFAGYVAFSIADRPGLAVGLIGGMLATTAGAGILGGIIAGFLAGYVVKGLNNAIKLP
FT                   SSLTSLKPILILPLLGALIVGLAMIYIINPPVAKIMAALSDWLKSIGDVNAIVLGVIIG
FT                   SMMCIDMGGPVNKAAYTFSVGLLASQIHTPMAAAMAAGMVPPIGMAIATWLARNKFTAN
FT                   QCDAGKASFVLGLCFISEGALPFVAADPLRVIISSVLGGATAGAISMSCGIALQAPHGG
FT                   LFVIPFVSEPLMYLSAIAIGSVVTGVVYAVIKPKAEA"
FT   gene            41931..42167
FT                   /locus_tag="D11S_0049"
FT   CDS_pept        41931..42167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0049"
FT                   /product="recombinase RecA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81473"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167467.1"
FT                   /protein_id="ACX81473.2"
FT                   /translation="MPFSDSEKRALLAQKGIGETILKRLEEMGLDDVSTLAATSPDFIL
FT                   QRGAEITGSTCWRNSPQARKTIETAVNWAKSVI"
FT   gene            complement(42385..42531)
FT                   /locus_tag="D11S_0051"
FT   CDS_pept        complement(42385..42531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0051"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81475"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547773.1"
FT                   /protein_id="ACX81475.1"
FT                   /translation="MDIGRIFETSLQFFPDKAQFIPVLQKYWRQSPALYLYYLQHSQKA
FT                   KKE"
FT   gene            complement(42552..42884)
FT                   /locus_tag="D11S_0052"
FT   CDS_pept        complement(42552..42884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0052"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81476"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547775.1"
FT                   /protein_id="ACX81476.1"
FT                   /translation="MLIRHLVLHIEVLTNLIEDGFDLGIRFGNRLNEGIVARKLMNPFK
FT                   EGLYVSKSYVAQYGIPKTPKALAGHKLIGYRFISSNRIEPLVLDIDGQDTALDMGMPLF
FT                   VTTRKS"
FT   gene            42899..43450
FT                   /locus_tag="D11S_0053"
FT   CDS_pept        42899..43450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0053"
FT                   /product="NAD(P)H dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81477"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167469.1"
FT                   /protein_id="ACX81477.1"
FT                   /translation="MKNVLIVSGHPDSNHSVANVEILQAVENTLPDVKIRRLDSLYPTY
FT                   KFDIDAEQSVILEADVIVFQFPFSWYSVPSNEIVNRQSFVYGFAHGSAAKIGGKKLIIS
FT                   TTGAPNEVYQKDGFFKHTVEDYLSQFETFATLCALDYQALVITCGVSYAGRDEAKVAAQ
FT                   KAMAPDHAARLVAVIDKATA"
FT   gene            43532..43870
FT                   /locus_tag="D11S_0054"
FT   CDS_pept        43532..43870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81478"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547779.1"
FT                   /protein_id="ACX81478.1"
FT                   /translation="MYIINITVNPSVSEEKQNELFPIHVEWFKKYFQAGKFLMLGPYID
FT                   TDAHSGVIFAKTESREAFQKIFEEDCYYPDFAKYEIREFAPKMIAADISKAKFRIGFGD
FT                   CFGNGKTL"
FT   gene            44016..44720
FT                   /locus_tag="D11S_0055"
FT   CDS_pept        44016..44720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0055"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81479"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547780.1"
FT                   /protein_id="ACX81479.1"
FT                   /translation="MKKLTALLGVMSMAMTAQAAPIINLFELGIQPGKNAQYEAVGEQN
FT                   IKTSMQTEKGTLAMHSVKQKADANMAYMVEIYADQNAYEIHRTSPQYKAFLTASPEILT
FT                   DHKKRTVLTPQFLADKKVEQTANTRTNLVMVEVKPSENDKFKAIVLAEMAQSLKVEDGV
FT                   IAMYAATAQENPNKWMFFEIYANDDAYAAHRETPHFKDYLKQTAEMLVDKQSIEIQPTY
FT                   LGNKGGLQFEKP"
FT   gene            45162..45572
FT                   /locus_tag="D11S_0056"
FT   CDS_pept        45162..45572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0056"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81480"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585556.1"
FT                   /protein_id="ACX81480.1"
FT                   /translation="MALEIEKKKNAPEAPIEKAKGLNIFLWLLTVLIIAVAAFGNIYFQ
FT                   DQYSTPIRVVAIVVLLSVSLGVAASTNQGGKALGFFKDARTELRKIVWPTRPEATQTTL
FT                   MVVGVTVFVSLILWGLDSIIVSIITFLTDWRF"
FT   gene            45574..46125
FT                   /gene="nusG"
FT                   /locus_tag="D11S_0057"
FT   CDS_pept        45574..46125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="D11S_0057"
FT                   /product="transcription antiterminator NusG"
FT                   /note="Modulates Rho-dependent transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81481"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558359.1"
FT                   /protein_id="ACX81481.1"
FT                   /translation="MTETANKKRWYVLQAFSGFEARVATTLREYIKLHNMEDQFGEVLV
FT                   PTEEVVENVAGKRRKSERKYFPGYVLVQMEMNDDTWHLVRSVPRVMGFIGGTPDKPAPI
FT                   SSREADIILNRLEQSNDKPKPRTTFQPGEEVRVTEGPFIDFNGTVEEVDYEKGRLKVSV
FT                   SIFGRATPVELEFGQVEKNN"
FT   gene            46281..46709
FT                   /locus_tag="D11S_0058"
FT   CDS_pept        46281..46709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0058"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81482"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005763439.1"
FT                   /protein_id="ACX81482.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLD
FT                   QIRQIAETKAADMTGATIETKMKSIAGTARSMGLVVEE"
FT   gene            46714..47403
FT                   /locus_tag="D11S_0059"
FT   CDS_pept        46714..47403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0059"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81483"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566509.1"
FT                   /protein_id="ACX81483.1"
FT                   /translation="MAKLTKKMKAIKAGVDSTKAYEINEAIALLKQFATAKFVESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANAEAAKAAGADLVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRY
FT                   RNDKNGIIHTTIGKANFSEDQLKENLQALLAALTKAKPTTSKGIFIKKVSLSTTMGAGV
FT                   AIDQASL"
FT   gene            47765..48256
FT                   /gene="rplJ"
FT                   /locus_tag="D11S_0061"
FT   CDS_pept        47765..48256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="D11S_0061"
FT                   /product="50S ribosomal protein L10"
FT                   /note="binds the two ribosomal protein L7/L12 dimers and
FT                   anchors them to the large ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81485"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005694693.1"
FT                   /protein_id="ACX81485.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKSA
FT                   REAGVSMRVVRNTLLRRAVEGTEFECLKDAFTGPTLIAFSNEHPGAAARLFKEFAKAND
FT                   KFELKGAAFEGKIQDVEFLATLPTYDEAIARLMGTMKEAAAGKLVRTFAALRDKLQEAA
FT                   "
FT   gene            48308..48679
FT                   /gene="rplL"
FT                   /locus_tag="D11S_0062"
FT   CDS_pept        48308..48679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="D11S_0062"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="present in two forms; L12 is normal, while L7 is
FT                   aminoacylated at the N-terminal serine; the only multicopy
FT                   ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
FT                   L12 dimers bind L10; critically important for translation
FT                   efficiency and fidelity; stimulates GTPase activity of
FT                   translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81486"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A3N319.1"
FT                   /protein_id="ACX81486.1"
FT                   /translation="MSLTNEQIIEAIASKSVTEIVELIAAMEEKFGVSAAAAVAAAPAG
FT                   GAVAAAEEKTEFDVVLAEAGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGIAKA
FT                   EAEALKKELEEAGAKVEIK"
FT   gene            48950..52978
FT                   /gene="rpoB"
FT                   /locus_tag="D11S_0063"
FT   CDS_pept        48950..52978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="D11S_0063"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-dependent RNA polymerase catalyzes the
FT                   transcription of DNA into RNA using the four ribonucleoside
FT                   triphosphates as substrates; beta subunit is part of the
FT                   catalytic core which binds with a sigma factor to produce
FT                   the holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81487"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585558.1"
FT                   /protein_id="ACX81487.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLNIPYLLTIQIDSFEKFIKRDPDG
FT                   QQGLEAAFRSVFPIVSTNGNTELQYVSYQLGEPVFDVRECQIRGTTYAAPLRVKLRLVS
FT                   YDKDAAPGTIKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLYARIDRRRKLPATIILRALGYTTEQILD
FT                   LFFYKITFEIKDNKLLMTLVPERLRGETAAFDIETKGKVYVERGRRITARHIKALEKDK
FT                   VTQVEVPTEYIIGKVAAKDYVDLETGELICPANMELSLELLAKLAQAGYTTLETLFTND
FT                   LDYGPYISETLRVDPSNDRLSALVEIYRMMRPGEPPTKEAAEALFDNLFFSSDRYDLSA
FT                   VGRMKFNRSLGIEETTGGGTLSNEDIVSVMKKLIDIRNGRGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRIGLVRVERAVKERLSLGDLEAVTPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHATHYGRVCPIETPEGPNIGLINSLS
FT                   VYARTNDYGFLETPYRKVVNGQVTEEIEYLSAIEEGKYVIAQANSNLDDDFRFTDAFVT
FT                   CRGEHGESGLYKPEEIHYMDVSTQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGIEKAVALDSGVAVVAKRGGTVQYVDASRIVVKVNEDETVAGEAGIDIYN
FT                   LIKYTRSNQNTCINQIPCVELGDPVERGEILADGPSTDLGELALGQNIRVAFMPWNGYN
FT                   FEDSMLVSERVVQQDRFTTIHIQELSCVARDTKLGAEEITADIPNVGEAALSKLDESGI
FT                   VYIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVI
FT                   DVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEEFEILEAGLFMRVRNLLLSGGFDAKS
FT                   LDKLDRTKWLEQTLDNEEKQHQLEQLAEQHEELRKEFERKLEIQRNKIIQGDDLAPGVL
FT                   KVVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPVEDMPYDENGQPVEIVLNPLGVPSR
FT                   MNIGQILETHLGLAAKGIGDQINAMIKQQQSIAKLREYMQKAYDLGGGSQKVDLSTFTD
FT                   EEVMRLAQNLRKGLPVATPVFDGAHEKEIKGLLELGGLPTSGQITLYDGRTGEKFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVSGNQQMDPGTPESFNVIMKEIRSLGINIDLDEE"
FT   gene            53083..57351
FT                   /locus_tag="D11S_0064"
FT   CDS_pept        53083..57351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0064"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-dependent RNA polymerase catalyzes the
FT                   transcription of DNA into RNA using the four ribonucleoside
FT                   triphosphates as substrates. Subunit beta' binds to sigma
FT                   factor allowing it to bind to the -10 region of the
FT                   promoter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81488"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518331.1"
FT                   /protein_id="ACX81488.1"
FT                   /translation="MKDLVKFLKAQSKTAEDFDVIKIGLASPDMIRSWSYGEVKKPETI
FT                   NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMG
FT                   HIELASPVAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYIVIEPGMTDLERGQLLTE
FT                   EQYLDAEDRWQDEFDAKMGAEAIQALLRGIDLEAECENLREELQETNSETKRKKITKRL
FT                   KLLEAFLQSGNKPEWMVMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLLDLIAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNRRPLKSLADMIKGKQGRFR
FT                   QNLLGKRVDYSGRSVITVGPYLHLHQCGLPKKMALELFRPFIYAKLESRGYATTIKAAK
FT                   KMVEREDAIVWDILAEVIREHPILLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAF
FT                   NADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRE
FT                   KVNGKGEGMLLQDPREAEKAYRTGQAELHSRVKVRITEYVKNDAGEFEPKTTLTDTTIG
FT                   RAILWMIAPKGMPFSLFNQTLGKKAISKLINESYRRLGLKASVMFADQIMYTGFAYAAR
FT                   SGSSVGIDDMVIPAKKYEIISAAEEEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERV
FT                   AKAMMENLSSEEVINREGKPEKQASFNSIFMMADSGARGSAAQIRQLAGMRGLMARPDG
FT                   SIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVIIE
FT                   DDCGTHEGIVMTPLIEGGDEKVPLRELVLGRVAAEDILKPGTEDVLIPRNTLLDEKLCD
FT                   VLDENSVDSVKVRSVVTCNTDFGVCAKCYGRDLARGHLINQGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASAAAKESSVQVKNNGTLRLANAKFVTNNEGKLVLTSRNTELTVVDNF
FT                   GRTKEHYKVPYGAILSKGDHQEVNAGETIANWDPHTMPVISEVGGFVKFVDIVDGLTVT
FT                   RQTDELTGLSSIVVQDVGERATAGKDLRPAIKLVDEKGNDVLVSGTDVAAQYFLPSKAI
FT                   VTLDDGAEVHVGDPLARIPQESVGTKDITGGLPRVADLFEARKPKEPAILAEISGIVSF
FT                   GKETKGKRRLLITPTEGEVYEEMIPKWRQLNVFEGEMVQCGDLISDGAETPHDILRLRG
FT                   VHAVTEYIVNEVQEVYRLQGVKINDKHIEVIVRQMLRKAIVTKAYDSEFLEGEQVEVAR
FT                   VKIVNRKREAEGKPPVEYERELLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGFAYHRNRHKNPTAIADDEVPVRLSAADEEEIASEFVMTSE
FT                   DASASLTEMLNMVEEDNHAE"
FT   gene            complement(57477..57929)
FT                   /pseudo
FT                   /locus_tag="D11S_02220"
FT                   /note="transposase; disrupted"
FT   gene            complement(58115..58372)
FT                   /locus_tag="D11S_0065"
FT   CDS_pept        complement(58115..58372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0065"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81489"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005764317.1"
FT                   /protein_id="ACX81489.1"
FT                   /translation="MTDKIRSVQGRVVSDKMEKSFVVAIERKVKHPLYGKFIRRTTKLH
FT                   VHDENNEAKLGDLVEVRECRPISKTKSWTLVRVVEKAVIA"
FT   gene            complement(58372..58563)
FT                   /locus_tag="D11S_0066"
FT   CDS_pept        complement(58372..58563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0066"
FT                   /product="50S ribosomal protein L29"
FT                   /note="one of the stabilizing components for the large
FT                   ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81490"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q0I155.1"
FT                   /protein_id="ACX81490.1"
FT                   /translation="MKAQELRTKSVEELNAELVNLLGEQFKLRMQAATGQLQQTHQLKQ
FT                   VRRSIAQIKTVLTEKAGE"
FT   gene            complement(58563..58973)
FT                   /locus_tag="D11S_0067"
FT   CDS_pept        complement(58563..58973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0067"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81491"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017805229.1"
FT                   /protein_id="ACX81491.1"
FT                   /translation="MLQPKRTKFRKVHKGRNRGIAGGTEVSFGTFGLKAVGRGRLTARQ
FT                   IEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYE
FT                   MDGVSEEIAREAFALAAAKLPVKTTFVTKTVM"
FT   gene            complement(58987..59694)
FT                   /locus_tag="D11S_0068"
FT   CDS_pept        complement(58987..59694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0068"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81492"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007526115.1"
FT                   /protein_id="ACX81492.1"
FT                   /translation="MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRQFLNK
FT                   ELANASVSRITIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRNAVAKIAGVPAQINIA
FT                   EVKKPELDAKLVADSIASQLERRVMFRRAMKKAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAALAQPEQQPT
FT                   DKPKKVPRGKGRK"
FT   gene            complement(59711..60043)
FT                   /locus_tag="D11S_0069"
FT   CDS_pept        complement(59711..60043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0069"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81493"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_000447526.1"
FT                   /protein_id="ACX81493.1"
FT                   /translation="METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTYTNKKASA
FT                   LVKKVLESAIANAEHNDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            complement(60054..60329)
FT                   /locus_tag="D11S_02225"
FT   CDS_pept        complement(60054..60329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02225"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02225"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013745959.1"
FT                   /protein_id="ANN81525.1"
FT                   /translation="MPRSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMI
FT                   GLTIAVHNGRQHVPVYVSDEMIGHKLGEFAPTRTYRGHAADKKAKK"
FT   gene            complement(60355..61176)
FT                   /locus_tag="D11S_0071"
FT   CDS_pept        complement(60355..61176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0071"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81495"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704442.1"
FT                   /protein_id="ACX81495.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKVVNPELHKGKPFAALLDTKSKTGGRNN
FT                   YGRITTRHIGGGHKQHYRLIDFKRNKLDIPGVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLAAGDQIQAGAHAPIKVGNALPMRNIPVGSTVHNVELKPGKGGQIARSAGSYVQ
FT                   IIAREGNYVTLRLRSGEMRKVLAECSATIGEVGNSEHMLRVLGKAGANRWRGVRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRHNKRTDKYIVRRRGK"
FT   gene            complement(61197..61499)
FT                   /locus_tag="D11S_0072"
FT   CDS_pept        complement(61197..61499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0072"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81496"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P55839.1"
FT                   /protein_id="ACX81496.1"
FT                   /translation="MSQERLLKVLKAPHISEKATNNAEKSNTIVCKVALDANKVEITNA
FT                   VEQLFEVKVDSVRTVVVKGKTKRRGAKIGRRSDWKKAYVTLQEGQSLDFVEGAAE"
FT   gene            complement(61496..62098)
FT                   /gene="rplD"
FT                   /locus_tag="D11S_0073"
FT   CDS_pept        complement(61496..62098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="D11S_0073"
FT                   /product="50S ribosomal protein L4"
FT                   /note="L4 is important during the early stages of 50S
FT                   assembly; it initially binds near the 5' end of the 23S
FT                   rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81497"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018652707.1"
FT                   /protein_id="ACX81497.1"
FT                   /translation="MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGSRAQ
FT                   KTRAEVSGSGKKPWRQKGTGRARSGDIRSPIWRSGGVTFAAKPQDHSQKVNKKMYRGAI
FT                   KSILSELVRQDRLVVVDKFEIDAPKTKVLVQKLKELALEDVLIITASLDENLFLAARNL
FT                   YKVDVRDAQGIDPVSLIAFDKVVVTVDAVKQIEEMLA"
FT   gene            complement(62114..62740)
FT                   /locus_tag="D11S_0074"
FT   CDS_pept        complement(62114..62740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0074"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81498"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005759592.1"
FT                   /protein_id="ACX81498.1"
FT                   /translation="MIGLVGRKVGMTRIFNEDGVSVPVTVIEIEANRVTQVKTLENDGY
FT                   TAVQVTTGSKKASRVTKPEAGHFVKAGVEAGRGLWEFRTEGEEFTLGQEINVDIFADVK
FT                   KVDVTGTSKGKGFQGGVKRWNFRTQDATHGNSLSHRVLGSIGQNQTPGRVFKGKKMAGH
FT                   LGNERVTVQSLEVVRVDAERKLLLVKGAVPGATGSDVIVKPAVKA"
FT   gene            complement(62757..63068)
FT                   /gene="rpsJ"
FT                   /gene_synonym="nusE"
FT                   /locus_tag="D11S_0075"
FT   CDS_pept        complement(62757..63068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /gene_synonym="nusE"
FT                   /locus_tag="D11S_0075"
FT                   /product="30S ribosomal protein S10"
FT                   /note="NusE; involved in assembly of the 30S subunit; in
FT                   the ribosome, this protein is involved in the binding of
FT                   tRNA; in Escherichia coli this protein was also found to be
FT                   involved in transcription antitermination; NusB/S10
FT                   heterodimers bind boxA sequences in the leader RNA of rrn
FT                   operons which is required for antitermination; binding of
FT                   NusB/S10 to boxA nucleates assembly of the antitermination
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81499"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014268624.1"
FT                   /protein_id="ACX81499.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            complement(63320..64216)
FT                   /locus_tag="D11S_0076"
FT   CDS_pept        complement(63320..64216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0076"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81500"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585594.1"
FT                   /protein_id="ACX81500.1"
FT                   /translation="MDIRHLRYFVSIVDNDFNLSRASLNLYVSQPALSMMISDFENKEG
FT                   VQLFKRAQGKIVGLTYVGENYYRDAKEVIKKYNEMHSNLHKSIEQIKGHISIGIPPLIL
FT                   SVVFSEVMPKLILDNPEINFTIKELGAYLLKSDLLLENIDFAVLLNPERISKNIIESYE
FT                   IHRSELSLFLSPKHHLSAKENITWRDLHGEKIVIFDQTFMIHHQLVESFERHNVYPNIV
FT                   LKSSSWDFLLNSVKINESLLTILPLPMYEQYKSTEFICRRMEEAIPWSVTLCRLKKNCY
FT                   TNVEEYIFDSLLKAFKP"
FT   gene            64491..65144
FT                   /locus_tag="D11S_0077"
FT   CDS_pept        64491..65144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0077"
FT                   /product="acetyl-CoA:acetoacetyl-CoA transferase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81501"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518461.1"
FT                   /protein_id="ACX81501.2"
FT                   /translation="MTKKRIDLSDVKNHLHDGMSIMFGGFMGIGTPEKLVKEILDSGVK
FT                   DLTLIGNDTAFVDTGVGPLITNNRVKRVIASHIGTNPETGKKMIAGEIDVELVPQGTLA
FT                   ERVRAGGAGLGGILTPTGVGTVVEEGKQKIQINGVEHLIELPLKADLAIVRAKKADEAG
FT                   NLVYELSAQNFNPLIALASKTVIVQADQVVKTGDISPDAVVTPAALVDYIVYPE"
FT   gene            65156..65821
FT                   /locus_tag="D11S_0078"
FT   CDS_pept        65156..65821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0078"
FT                   /product="acetate CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81502"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539434.1"
FT                   /protein_id="ACX81502.1"
FT                   /translation="MNAKELIARRIAMELNDGDIVNLGIGLPTQVANYLPDDVDITLQS
FT                   ENGFMGLTALDPEYPNPNLVNAGGQPCGIKAGGATFDSAFSFALIRGGHVDACVLGGLE
FT                   VDQQGNLANWMVPGKMVPGMGGAMDLVTGSRKVIIGMEHCAKSGSSKILKQCTLPLTAR
FT                   NKVTMVVTELAVFRFIDDQLVLKEHAPDVDLDTIRGKTEADFIVSDDFKEMHISQKGM"
FT   gene            65824..67167
FT                   /locus_tag="D11S_0079"
FT   CDS_pept        65824..67167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0079"
FT                   /product="short-chain fatty acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81503"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167471.1"
FT                   /protein_id="ACX81503.1"
FT                   /translation="MISRVSRFMTALVSKYLPDPLIFAVLLTFITFVCALCLTDSTPVD
FT                   LVNMWGDGFWNLLAFGMQMALIVVTGNALATSPQIKSFLTTMASLAKTPAQGVVLVTFM
FT                   SSIACIINWGFGLVVGAMFAKEVARRVKGSDYALLIACAYIAFITWGGGLSGSMPLLAA
FT                   TPGNPVAHIMVTESNPQGIIPATETLFSSYNLFITGCLILCLPFITYMMMPKSGEVKSI
FT                   DPTLLAPDPEFTKKLDQNATVAEKMEESRLLAYAIGALGYGYLAMYFHKNGFNLTINNV
FT                   NLIFLITGIVLHGSLMAYMRAILNATRSTAGILIQFPFYAGVQLMMEHSGLGGLITEFF
FT                   INIANKDTFPVLTFFSSALINFAVPSGGGHWVIQGPFVIPAAQALGADLGKSTMAIAYG
FT                   EQWMNMAQPFWALPALGIAGLGVRDIMGFCMTALIFTTPIFLIGLYFF"
FT   gene            67185..68366
FT                   /locus_tag="D11S_0080"
FT   CDS_pept        67185..68366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0080"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="Catalyzes the synthesis of acetoacetyl coenzyme A
FT                   from two molecules of acetyl coenzyme A. It can also act as
FT                   a thiolase, catalyzing the reverse reaction and generating
FT                   two-carbon units from the four-carbon product of fatty acid
FT                   oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81504"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568693.1"
FT                   /protein_id="ACX81504.1"
FT                   /translation="MENIVIVSAVRTPIGSFNGSLAAVSAVDLGATVIKEVINRADIDS
FT                   ALVNEVIMGNVLQAGIGQNPARQAALKAGVAKGIPSYTVNKVCGSGLKSVALGAQAIAS
FT                   GDADIVAAGGMESMSQAPYILDHKIRSGVRMGNLPLRDSMIEDGLTCAINHYHMGITAE
FT                   NIAEQYGISREEQDQLALRSQTLASQAVQNGVFDKEIVSVTVKTRKGDIAVSRDEYPKP
FT                   DTTAEGLAKLRPAFKKDGTVTAGNASGINDGAAALLLMSESKANALGLKPLARIRGYAS
FT                   AGVDPAVMGLGPVPATQKALRKAGLTLDDIDLIEANEAFASQFLGVGRELHFNMEKTNI
FT                   HGGAISLGHPIGASGARILVTLLHNLIEKDKKLGLATLCIGGGEGISVIVERI"
FT   gene            complement(68464..68931)
FT                   /locus_tag="D11S_0081"
FT   CDS_pept        complement(68464..68931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0081"
FT                   /product="AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81505"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578370.1"
FT                   /protein_id="ACX81505.1"
FT                   /translation="MRKKLFDNIDTRILKALQRNGRLPNNELAKEVGLSNSACLRRVNQ
FT                   LEESGVIDGYAALLHPKKLNCNLLVYVQGTFFEEDPELKERFIFEVKLIPQITECHLMA
FT                   GSYDFILKMWVSDLEEFNSIKNKYLTKDIGIKTLKSEVSLKTVKSTTELPL"
FT   gene            complement(69022..70551)
FT                   /locus_tag="D11S_0082"
FT   CDS_pept        complement(69022..70551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81506"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539441.1"
FT                   /protein_id="ACX81506.1"
FT                   /translation="MEASTQKKTFNFPSAFTILFFILILAVGLTWVIPSGSYSKLTYSM
FT                   TDKMFVVKTYGEQDKTYPATEETLNNLNIKIKLSNFTEGVIKKPIAIPGTYQRIEQHYK
FT                   GIKDIPISMVEGTIEAVDVMVFIFVLGGMIGVINKTGSFNAGLMALARRTKGNEFMIVF
FT                   SVSVLMVLGGTTCGIEEEAVAFYPILVPVFLALGYDAIVCVGAIFLAASMGTAFSTINP
FT                   FSVVIASNAAGIQFTEGIGFRTIGLILGSACVIAYLYWYCKKVKADPSFSYTYEDREEF
FT                   RHRYMKNFDPNVVVEFTLRRKLILILFCIAFPMMIWGVMAGGWWFPQMAASFLSITIII
FT                   MFISGLKEKDIVESFTEGASELVGVSLIIGLARGVNLVLEQGMISDTILDYMSNLVSGM
FT                   PGSIFILGQLIVFVFLGLIVPSSSGLAVLSMPIMAPLADAVGIPRDIVVSAYNWGQYAM
FT                   LFLAPTGLVLVTLQMLHIPFNKWVKFVLPMIGCLLVIGATLLVIQVSLYSV"
FT   gene            complement(70668..71600)
FT                   /locus_tag="D11S_0083"
FT   CDS_pept        complement(70668..71600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0083"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="reversible synthesis of carbamate and ATP from
FT                   carbamoyl phosphate and ADP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81507"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005560895.1"
FT                   /protein_id="ACX81507.1"
FT                   /translation="MRIVIALGGNALLRRGEPLTAENQRLNVRIACEQIAKIYPNNELV
FT                   IAHGNGPQVGLLALQGAAYKDVPTYPLDVLGAESVGMIGYMIQQELGNLVPFEVPFATL
FT                   LSQVEVDINDPAFKNPTKPIGPVYSKEEAERLAKEKNWSIAQDGDKYRRVVPSPLPKRI
FT                   FEIRPVKWLLEKGSIVICAGGGGIPTYYDEQHNLQGVEAVIDKDLCSALLAENLDADLF
FT                   IIATDVSAVFVDWGKPTQKAIALAPPDEIEKLAFAAGSMGPKVQAAVNFARHTGKDAVI
FT                   GSLSDIVDIVKGKAGTRITNKAKEISYYS"
FT   gene            complement(71610..72614)
FT                   /locus_tag="D11S_0084"
FT   CDS_pept        complement(71610..72614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0084"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="catalyzes the formation of ornithine and
FT                   carbamylphosphate from citrulline in the arginine catabolic
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81508"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005565002.1"
FT                   /protein_id="ACX81508.1"
FT                   /translation="MAFNLKNRHLLSLVNHSEREINYLLDLSRDLKRAKYAGTEQQKLK
FT                   GKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDPNSSQIGHKESMKDTARVLGRMYDA
FT                   IEYRGFKKEIVDELAEYAGVPVFNGLTDEFHPTQMLADVLTMIENCDKPLSEISYVYIG
FT                   DARNNMGNSLLLIGAKLGMDVRICGPKALLPDAGLVEMCEGFAKQSGARITVTDDIDKA
FT                   VKGVDFVHTDVWVSMGEPLETWGERIKLLLPYQVTPELMKRTGNPRVKFMHCLPAFHNS
FT                   ETKVGRQIAEKYPELANGIEVTEDVFESPMNVAFEQAENRMHTIKAVLYSSLI"
FT   gene            72857..74248
FT                   /locus_tag="D11S_0085"
FT   CDS_pept        72857..74248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0085"
FT                   /product="chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81509"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005556228.1"
FT                   /protein_id="ACX81509.1"
FT                   /translation="MNAFITSLRHFVLKVRYVLHKKLRQSHRLSHKTVEFSCLMIGAAL
FT                   VSLFSLGFAKLADLGLEWNAQWTQQYPLAAWVVMPCGLAALAWFVLKYTPYVGGSGIPQ
FT                   VIASLSLPHNSDKTRLVAFAPTLWKIPLTFLAMLFGASVGREGPSVQVGAAVMLWWGNL
FT                   CRQYGVAFKGLSANELMATGAAGGLAAAFNAPLAGVIFAIEELGRGVLLRWERRVLLGV
FT                   LAAGFILVAIDGNNPYFPKYHGVTDIPYLYLWVLLCGVVCGVFGGIFARLLAKGVGGVL
FT                   PNLCRGWVRNHPIYTAFILGLILTALGLYTNGQTYGTGYHVVTQALDGQAMQTDIGIMK
FT                   LFATVGTYWTGIAGGIFTPSLTIGAGLGVQVATLTDGLIDQRLLVLLCMAAFLAGATQS
FT                   PVTASVIVMEMTGCQPVLIWLLICCLISSIISRQFNPKPFYHFAAGRFRHRIQEEMQQD
FT                   MKDNS"
FT   gene            74251..75234
FT                   /locus_tag="D11S_0086"
FT   CDS_pept        74251..75234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0086"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81510"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574861.1"
FT                   /protein_id="ACX81510.1"
FT                   /translation="MPQNPPHFYRGRFAVAPMLDWTTRHCRYFHRQFSRHALLYTEMVT
FT                   TQAIIHAKYDHLDFDPAEQPVALQLGGSDPAQLKHCAQLAEQRGYQEINLNVGCPSDRV
FT                   QNGMFGACLMAKAELVAECVQQMQEAVRIPVTVKTRIGIDDFDSYDFLCDFIEKVQQAG
FT                   CREFIVHARKAWLSGLSPKQNREIPPLDYERVYQLKRDFPHLLISINGGIKTIDEMQQH
FT                   LQRVDGVMVGREAYQNPSLLGYIDQALFNANAPIVTPREAVEKMLPYIEQQLSRGVYLN
FT                   HIVRHILSAFQHCKGARQWRRYLSENAYKEGAGIEVVETALGFVEA"
FT   gene            complement(75290..76282)
FT                   /locus_tag="D11S_0087"
FT   CDS_pept        complement(75290..76282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0087"
FT                   /product="asparagine synthetase AsnA"
FT                   /EC_number="6.3.1.1"
FT                   /note="catalyzes the formation of asparagine from aspartate
FT                   and ammonia"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81511"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167472.1"
FT                   /protein_id="ACX81511.1"
FT                   /translation="MKKTFILQQQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQ
FT                   DNLSGIEKAVQVHVKQIPGVVFEVVHSLAKWKRHTLARFHFKENEGLFVHMKALRPDED
FT                   SLDPTHSIYVDQWDWEKVIPEGRRNFAYLKETVNAIYRAIRLTELAVEARFDIPSILPK
FT                   HITFVHTEDLVQRYPNLSGKERENAICKEYGAVFLIGIGGNLSDGKPHDGRAPDYDDWT
FT                   TESENGYKGLNGDILVWNEQLGTAFELSSMGIRVDEAALRLQVGLTGDEDRLTMDWHQE
FT                   LLQGKLPLTIGGGIGQSRMAMFLLRKKHIGEVQSSVWPEEMLEQYQHIL"
FT   gene            76448..76900
FT                   /locus_tag="D11S_0088"
FT   CDS_pept        76448..76900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0088"
FT                   /product="transcriptional regulator"
FT                   /note="transcriptional repressor of asnA which codes for
FT                   aspartate-ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81512"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005715729.1"
FT                   /protein_id="ACX81512.1"
FT                   /translation="MHNIDNLDQQILRVLTRDARTPYAEMAKNFGVSPGTIHVRVEKMR
FT                   QSGVIEGTKVRINERKLGYDVCGFIGIILKSAKDYDKVIKKLETIDEVVEAYYTTGNYS
FT                   IFIKVMTHTIAELHFVLSAKIQLIDEIQSTETLISMQNPILRDIKP"
FT   gene            76934..77692
FT                   /locus_tag="D11S_0089"
FT   CDS_pept        76934..77692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0089"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /note="catalyzes the reversible phosphorylytic cleavage of
FT                   uridine and deoxyuridine to uracil and ribose- or
FT                   deoxyribose-1-phosphate; involved in the pyrimidine salvage
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81513"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005571655.1"
FT                   /protein_id="ACX81513.1"
FT                   /translation="MSDVFHLGLTKAMLDGAKLAIVPGAPERVERIARLLNRPKFLAAT
FT                   REFTSWLGYIDEHAVVVCSTGIGGPSVSIAVEELAQLGVRTFLRIGTTGAIQPHINVGD
FT                   LLITTGAVRLDGASRHFAPLEYPAVADFACTNALYNVATEDAGNHVHVGITASSDTFYP
FT                   GQERYDTFTGKIYRHFQGSLKQWQELHVMNYEMESATLFTMCSALGLRAGMIAGAIVNR
FT                   TQQEIPNEETIKSTEEKAIHAVVKAAGLLV"
FT   gene            complement(77829..78890)
FT                   /locus_tag="D11S_0090"
FT   CDS_pept        complement(77829..78890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0090"
FT                   /product="permase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81514"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539465.1"
FT                   /protein_id="ACX81514.1"
FT                   /translation="MIEMLKNWYRRRFSDPQAMGLFAILFFGFVAIYFFSDLIAPLLVA
FT                   IVLAYLLEWPVRLLNEKLKCPRLLATGLVIGSFTGLVFLVVLVLIPNLWTQMVNLLSDL
FT                   PHMFNRFNEWLLSLPVRYPDMIDAQTVESIFGTVKEKILGLGESALKLSLASIMNLVTL
FT                   GIYAFLVPLMVFFLLKDKRQLMDGVSRFLPRNRTLASKVWVEMQQQIANYIRGKLVEIL
FT                   VVTIVTYAIFLIFGLNYPLLLAVAVGLSVLVPYIGAVLVTIPVVLVAIFQFGDTHTFWY
FT                   IVIAFVVSQLLDGNLLVPFLFSEAVNLHPLVIIIAVLIFGGLWGFWGVFFAIPLATLVK
FT                   AVVNAWPSNEAVE"
FT   gene            78964..79314
FT                   /locus_tag="D11S_0091"
FT   CDS_pept        78964..79314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0091"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81515"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548334.1"
FT                   /protein_id="ACX81515.1"
FT                   /translation="MSIIIYHNPSCSKSCETLALLESHQIQPQIELYLQKTYSVAELQA
FT                   IADKLGISDIRQMMRTKDDLYKKLGLDNPTLGQQDLLQAIAQHSALLERPIVINGDKAK
FT                   IGRPPESVLAIL"
FT   gene            complement(79418..79780)
FT                   /locus_tag="D11S_0092"
FT   CDS_pept        complement(79418..79780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0092"
FT                   /product="dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81516"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548333.1"
FT                   /protein_id="ACX81516.1"
FT                   /translation="MLLSGFFLSIYFVQYIDIEEVIMTAKTEVLFNNTWNVRISDPGEE
FT                   GAQSHFFETIYITLEAHINGNDTTYEFTRKVEDQIKIKKTFTDLDKLFIYLSEQISPVA
FT                   LGHLGIKIGNLRLTNE"
FT   gene            complement(79731..80015)
FT                   /locus_tag="D11S_0093"
FT   CDS_pept        complement(79731..80015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81517"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539471.1"
FT                   /protein_id="ACX81517.1"
FT                   /translation="MAKQKYALQTPPQNVQGTLTYQHQRGVIKDNAIQALLHDKLFRQR
FT                   IERNKKGKGSYQRKAKHANRYYEKPDNNISLIRDVIIGLFSFYLFCAIY"
FT   gene            80224..81555
FT                   /gene="rimO"
FT                   /locus_tag="D11S_0094"
FT   CDS_pept        80224..81555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimO"
FT                   /locus_tag="D11S_0094"
FT                   /product="ribosomal protein S12 methylthiotransferase"
FT                   /note="catalyzes the methylthiolation of an aspartic acid
FT                   residue of the S12 protein of the 30S ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81518"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578393.1"
FT                   /protein_id="ACX81518.1"
FT                   /translation="MSTPPNIGFVSLGCPKNLVDSERILTELRSNGYNIIPSYENADLV
FT                   IVNTCGFIDSAVQESLEAIGEALEENGKVIVTGCLGAKEDQIRQVHPKVLEISGPHSYE
FT                   TVMNQVHKYVPKPQYSPYESLVPAQGVKLTPKHYAYLKISEGCDHRCTFCIIPSMRGDL
FT                   DSRPITQVLDEAKRLVDAGVKELLIVSQDTSAYALDQSKENQNKTVFWNGMPIKNNLIS
FT                   LCRQLGNLGVWVRLHYVYPYPHVDDLIPLMAEGKLLPYLDIPLQHASPKILKTMKRPGK
FT                   IDRTLERIQQWREICPELTLRSTFIVGFPGETEEDFQMLLDFLKAAQLDRVGCFKFSPV
FT                   EGAPATDMPDQVPEEVKEERFHRFMQVQQEISAARLQQKIGKTLSVIVDEVNMKGVIGR
FT                   SMADAPEIDGVVYVENQSQSAVNIGDVISVTITDADEYDLWGTC"
FT   gene            81611..82084
FT                   /locus_tag="D11S_0095"
FT   CDS_pept        81611..82084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0095"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81519"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005554889.1"
FT                   /protein_id="ACX81519.2"
FT                   /translation="MSLVKILFVCLGNICRSPMAEYVMREKVKQANVQKHIITASAGTS
FT                   GWHDGEDMHCGTADILDRHKISSNGFVSRKVQSTDWTDFDYIIAMDNHNLRDLERLFGS
FT                   HPKKLFQITALCPTLGTDHIPDPWYTKDFNQTYTLLDQCCDALLAKIRREHHL"
FT   gene            82211..82429
FT                   /locus_tag="D11S_0096"
FT   CDS_pept        82211..82429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81520"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548330.1"
FT                   /protein_id="ACX81520.1"
FT                   /translation="MFPEFRELITKLKTENAYFANLFDKHNELDQRIKNIESHIELGTH
FT                   NEVEMLKKEKLRLKDQMYDMLKKADAK"
FT   gene            complement(82513..83109)
FT                   /locus_tag="D11S_0097"
FT   CDS_pept        complement(82513..83109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0097"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81521"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567565.1"
FT                   /protein_id="ACX81521.1"
FT                   /translation="MKVAKNVVVSIAYQVRTEDGVLVDEAPANQPLQYLQGHNNLVIGL
FT                   ENALEGKSVGDKFEVRVKPEEGYGEYNENMVQRVPKDVFVGVDDLEEGMRFIADTNMGP
FT                   LPVVITEVCDTDVVVDGNHMLAGQELHFTVEVVDTREATLEEIAHGHLHQEGGCCGGHG
FT                   HDSDEEGHGCGCGGHHHHHDHHHHGESGCGCGGKH"
FT   gene            complement(83204..83923)
FT                   /locus_tag="D11S_0098"
FT   CDS_pept        complement(83204..83923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81522"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539481.1"
FT                   /protein_id="ACX81522.1"
FT                   /translation="MKFKDLVLLLLPLSVALTANAEAKVTDEPEKNVISFNTEVTKEVD
FT                   YDVMEVTLFVKQENKNLKELNQAINEKVNAALDVIKKQSAVKIKKNTRNTQVRYDNKGK
FT                   QSGWIERADLVLESKDFVVLSQVISDLNETFAIADVMQKLSNEAAVKFEDEMLKSALAQ
FT                   FQHKAQLIQTSLNAKGYEVISLGLDNRNEIPYFGGRMIPVAKMKSFASEVADEVSLDSN
FT                   DKAELKTSVSAQIRLLN"
FT   gene            complement(83974..84408)
FT                   /locus_tag="D11S_0099"
FT   CDS_pept        complement(83974..84408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0099"
FT                   /product="RNase E inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81523"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539482.1"
FT                   /protein_id="ACX81523.1"
FT                   /translation="MTNLDELQAETREIITDLLNDGSDPNALYIIEHHISHHNFDKLEK
FT                   IAMDAFKSGYEVSEAEEFEEENGRVIFCCDIISEVELKPELIDAQQKELLPLIAKYQGG
FT                   YDGWGTYFEDPDADDDEYGDDGEFFDEDDALDDDDEFVKR"
FT   gene            complement(84503..84898)
FT                   /locus_tag="D11S_0100"
FT   CDS_pept        complement(84503..84898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81524"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P57950.1"
FT                   /protein_id="ACX81524.1"
FT                   /translation="MSFIKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVADVFMPVL
FT                   GILTGGMDFKDLKFVLEPANGDIPAVTLNYGVFIQNVFDFVIIAFAIFMMIKALNKLKK
FT                   PEVAEEAPAEPSTEEKLLTEIRDLLKK"
FT   gene            complement(85008..86384)
FT                   /gene="trkA"
FT                   /gene_synonym="sapG"
FT                   /locus_tag="D11S_0101"
FT   CDS_pept        complement(85008..86384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /gene_synonym="sapG"
FT                   /locus_tag="D11S_0101"
FT                   /product="potassium transporter peripheral membrane
FT                   component"
FT                   /note="involved in potassium uptake; found to be
FT                   peripherally associated with the inner membrane in
FT                   Escherichia coli; contains an NAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81525"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704421.1"
FT                   /protein_id="ACX81525.1"
FT                   /translation="MKIIILGAGQVGSTLAANLVSEDNDITLIDDESMRLEHLQDKHDL
FT                   RVMQGLASSPKVLREAGAPDADLLIAVTGSDEINMVACQIAYTLFNTPTKIARIRNGEY
FT                   LKEKEKLFNPDVLPIDHIISPENLVTKDIVRLIEYPGALQVAHLAKDKISLVVVKAYYG
FT                   GPLVGYPISTLKEHIPHVDCRVVSILRQDKAIRPQGSTIIEAGDEVTFICATAYIKAVM
FT                   SELQRLEKPYKRIMIVGGGNVGTGVAKQLEDHCTVKLIERNTERAAVLAEKLSKTLVFN
FT                   GDASDQSLLFEEHIENIDVFLSLSSDDEANIMSALLAKRLGAKKAMVLIQRMAYISLIQ
FT                   GGTIDIAISPQQATISALLGHVRKGDVANVVSLRHGLAEALEIIVHGDETTSNVIGRLI
FT                   GDLKLPTGAIIGAILRGNEVIIGNNQLVIQEEDHVVVYLSDKKYISDLEKLFQPSAFFI
FT                   "
FT   gene            complement(86408..87763)
FT                   /locus_tag="D11S_0102"
FT   CDS_pept        complement(86408..87763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0102"
FT                   /product="16S rRNA methyltransferase"
FT                   /note="catalyzes the methylation of cytosine at position
FT                   967 (m5C967) of 16S rRNA; SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81526"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548325.1"
FT                   /protein_id="ACX81526.1"
FT                   /translation="MKTSKAKTSAETTALSARTAAVQILFQVLEQGKSLSSLLPDAQVV
FT                   IKAQDLPLLQEICFGVCRVLPRLEQIIAQLVDKPLRGKKRIVHCLLLVGLYQILYTRIP
FT                   VYAAVDEIVNTAKNLQLQSFQGLVNAVLRRFLREQESMLAKVDKHWQTLHPDWLVNKLK
FT                   KVYPNWREIIEANNQKPPMWLRVNTQKNSLETYRTLLTAQQMDAQITSHPQALGLTQPT
FT                   SVQYLPLFAEGGVTVQDLHAQWAALLLQPQNGELILDACAAPGGKTTHILELAPQAEVV
FT                   ALDVEENRLQRVKENLARMQQQATIVCGDAANPRAWLTKLGKSAVRFDRILLDAPCSAT
FT                   GVIRRHPDIKWLRKEADIEPLVELQEQILQALWPYLKPSGVLLYATCSVLAEENARQIE
FT                   RFLQHTPDAQPTALNLPEEVLARNQSAVGFQFIPQTDGGDGFYYAKLVKRES"
FT   gene            complement(87763..88719)
FT                   /gene="fmt"
FT                   /locus_tag="D11S_0103"
FT   CDS_pept        complement(87763..88719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="D11S_0103"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="modifies the free amino group of the aminoacyl
FT                   moiety of methionyl-tRNA(fMet) which is important in
FT                   translation initiation; inactivation of this gene in
FT                   Escherichia coli severely impairs growth"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81527"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548324.1"
FT                   /protein_id="ACX81527.1"
FT                   /translation="MKPLNIIFAGTPDFAARHLQALLNSSHNVIAVYTQPDKPAGRGKK
FT                   LQSSPVKQLAEQHQIPVYQPKSLRKAETQAELTALQADVMVVVAYGLILPQVVLDAPKY
FT                   GCLNVHGSLLPRWRGAAPIQRAIWAGDAQTGVTTMQMDAGLDTGDMLHKVYCDITLQET
FT                   SAGLYAKLAEIAPAALVEVLDHLTDGTFTAERQDDAQSSYAEKLSKEEAKLNWQLSAAQ
FT                   LERNIRAFNPWPIAYLELTDGAGNPQTLKVYQAAVLPHTNKAPGTILSADKHGIQIATV
FT                   DGVLNLLQLQPSGKKPMSAQDLLNGRADWFQVGKALP"
FT   gene            complement(88785..89297)
FT                   /locus_tag="D11S_0104"
FT   CDS_pept        complement(88785..89297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0104"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81528"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006719518.1"
FT                   /protein_id="ACX81528.1"
FT                   /translation="MTALNVLIYPEEHLKVVCDPVVEVNDNTRKIIDNMFDTMYQEGGI
FT                   GLAAPQVDILQRIITIDIEGDKQNQLVLINPEILESEGETGIEEGCLSIPGFRALVPRK
FT                   EKVTVKALDRHGKEFTLKADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLIKMK
FT                   KQMEKQK"
FT   gene            complement(89409..89524)
FT                   /locus_tag="D11S_02235"
FT   rRNA            complement(89409..89524)
FT                   /locus_tag="D11S_02235"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(89807..92843)
FT                   /locus_tag="D11S_02240"
FT   rRNA            complement(89807..92843)
FT                   /locus_tag="D11S_02240"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(93116..93191)
FT                   /locus_tag="D11S_0108"
FT   tRNA            complement(93116..93191)
FT                   /locus_tag="D11S_0108"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:93156..93158,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(93241..93317)
FT                   /locus_tag="D11S_0109"
FT   tRNA            complement(93241..93317)
FT                   /locus_tag="D11S_0109"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:93281..93283,aa:Ile,seq:gat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(93357..94961)
FT                   /locus_tag="D11S_0110"
FT   rRNA            complement(93357..94961)
FT                   /locus_tag="D11S_0110"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(95223..95780)
FT                   /locus_tag="D11S_0111"
FT   CDS_pept        complement(95223..95780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0111"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81530"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548251.1"
FT                   /protein_id="ACX81530.1"
FT                   /translation="MKKAVFLDRDGTLNIDYGYVHEINHFRFIDGSIEALKKLKNMGYL
FT                   LVLVTNQSGIARGYFTEQQFLQLTEWMDWSLADRGVDLDGIYYCPHHPEAKIAEFKQDC
FT                   DCRKPKSGMLLQGIKELNIDPSRSIMIGDKTVDLLAGKGAKIGTTILVRTGKEVTSEGE
FT                   KEADYVLDSIADLPGLISAQKI"
FT   gene            95977..97014
FT                   /gene="metN"
FT                   /locus_tag="D11S_0112"
FT   CDS_pept        95977..97014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="D11S_0112"
FT                   /product="DL-methionine transporter ATP-binding subunit"
FT                   /note="part of the metNIQ transport system for methionine"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81531"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585487.1"
FT                   /protein_id="ACX81531.1"
FT                   /translation="MIKLQNVSKIFDVSGKKLTALDNVSLDIPKGYICGVIGASGAGKS
FT                   TLIRCVNLLEKPTMGAVIIDGNDLTQLSDAELVLERRNIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELENTPKENIESKVNELLSLVGLSDKRNVYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTQSILKLLKEINRTLGITILLITHEMDVVKRICDSVAIIDQGKLVEQ
FT                   GSVSDIFSNPKTELAQQFIRSTFNVNLPDEYLDNLLQTPKHAKSYPIIKFEFTGRSVDA
FT                   PLLSQTSKKFGVELSILTSQIEYVGGVKFGFTVAEVEGDEDAITQAKIYLMENNVRVEV
FT                   LGYVE"
FT   gene            97004..97681
FT                   /locus_tag="D11S_0113"
FT   CDS_pept        97004..97681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0113"
FT                   /product="methionine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81532"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704899.1"
FT                   /protein_id="ACX81532.1"
FT                   /translation="MWNDFLTQLTPQMWQTVWVSTYETVYISFASTFLAVIVGLPFGVL
FT                   TFLTGKGEILQNARLNLILNIVINIGRSIPFIILLIILLPFTRFVLNTTLGTTAAIIPL
FT                   SICAMPFVARLTANALVEIPKGLTEAAKAMGATNWQIIRKFYLPEALPTLINGITLTLV
FT                   TLVGYSAMAGIVGGGGLGSLAINYGEYRNMTYVKWVATIIIVVFVMISQKLGDDLAKRV
FT                   DHR"
FT   gene            97716..98558
FT                   /gene="metQ"
FT                   /locus_tag="D11S_0114"
FT   CDS_pept        97716..98558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="D11S_0114"
FT                   /product="DL-methionine transporter substrate-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81533"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542505.1"
FT                   /protein_id="ACX81533.1"
FT                   /translation="MNLKKLLGVATLASVFALTACNEEKKPEAAPADKPAAEAPATIKV
FT                   GVMAGPEHQVAEIAAKVAKEKYNLDVEYVLFNDYALPNTAVSKGDLDVNAMQHKPYLDK
FT                   DSQAKGLNNLVIVGNTFVYPLAGYSKKIKNVNDLQDSAVVAVPNDPSNLARALILLEKQ
FT                   GLIKLKDPTNLFSTSIDIIENPKNLQIKEVDTSVAARALDDVDLAVVNNNYAGQVGLNA
FT                   QDHGVFVEDKDSPYVNIIVARTDNKDSKAVQAFVKAYQTPEVEQEAKKHFKDGVVKGW"
FT   gene            98664..99161
FT                   /locus_tag="D11S_0115"
FT   CDS_pept        98664..99161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0115"
FT                   /product="phosphatidylethanolamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81534"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003822962.1"
FT                   /protein_id="ACX81534.1"
FT                   /translation="MKVTSLAIENGHFADKYGKRGSQFSPNGMPTYSIPFEITDAPADT
FT                   KSFAVVLEDKDAITASGFVWIHWLIADLARTSVRENESQTATDFVQGANSWASVLGKFD
FT                   IKEASAYGGMAPPNSNHRYELYVYALDTKLNLPQGFRFNDLHYAMQGHILAEAYLVGWY
FT                   NV"
FT   gene            99280..99756
FT                   /locus_tag="D11S_0116"
FT   CDS_pept        99280..99756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0116"
FT                   /product="rRNA methylase"
FT                   /note="member of the SPOUT superfamily of RNA
FT                   methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81535"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567012.1"
FT                   /protein_id="ACX81535.1"
FT                   /translation="MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLR
FT                   RSGLDYHEFAEIKKHKTFEAFLQSEQPKRLFALTTKGTPAHSEVKFSLGDYLLFGPETR
FT                   GIPMDILNSMPPEQKIRIPMTANSRSMNLSNSVAVTVYEAWRQLGYEGAVNINR"
FT   gene            complement(99852..100727)
FT                   /locus_tag="D11S_0117"
FT   CDS_pept        complement(99852..100727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0117"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81536"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548245.1"
FT                   /protein_id="ACX81536.1"
FT                   /translation="MTEQRPYQWPDPFLLYPDQGKKSYRMKRFRYHLRSLLHWQTIKKF
FT                   ERFVNQNPLLVMLLNARPGFSYPLVHRFLDKRFNSRQRFEEMCANLTFLPEKLTALHLP
FT                   PLWQQPICFGEVIPDFELYLTINDYQAMEGYWALELRYKPTQELVYLLTFGRVQKALLI
FT                   AVIQGPNFEGSKEMVKSLTKKCHGLRPAYLMVEAMKAFTHVLGYTALWGIPHKYQNKSR
FT                   IVQSKRYVVDYDAIFAESAGTLKEYWELPLHFETKNMNDIPSNKRSMYRKRYAMLAQLQ
FT                   ENMAEALKVR"
FT   gene            100860..101474
FT                   /locus_tag="D11S_0119"
FT   CDS_pept        100860..101474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0119"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81538"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549225.1"
FT                   /protein_id="ACX81538.1"
FT                   /translation="MSYIKLNYHKTHFLTSSPNLKSLPEDTGIEIAFAGRSNAGKSTAL
FT                   NALTNQKNLARTSKTPGRTQLINLFEVEPQCKLVDLPGYGYAAVPEQMKLQWQQALGEY
FT                   LQKRECLAGIVILMDIRHPLKDLDQQMIEWAVASQLPVLLLLTKADKLSQSERSKQMKM
FT                   VREAILPFRGDIQVEAFSALKRTGIDRLAATLDGWFAPVFA"
FT   gene            102558..104390
FT                   /locus_tag="D11S_0121"
FT   CDS_pept        102558..104390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81540"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548238.1"
FT                   /protein_id="ACX81540.1"
FT                   /translation="MSFVNKLTTNEATYEPYDGFCPDFSAYFNKLKSPDNHKELNPKPT
FT                   PPIQGSGWYFPSYEYIVVWYDDNLIFHRKNTQANVKIKLVNLTRPTYRNAHKLSVLYIT
FT                   VPINVLHYFSIGSVWKNGKAIKQVQLKEYLITANQEVSEERDNVSYRSFNDTKHQRRST
FT                   PFEPNLYTIDSDCNNYRYDQNQLIKIQQEGTDFIVHPLQLFCSHYGMSADIKRILATYN
FT                   WDNVRERFYLDENEASLHSQKHVLLPKHFVKKDAIFLYHLKYDLTTLYKVKKLIQEILL
FT                   SHQTHISINVPFWHTQPVQLKIRGIELGDVVLCAEVIGINQPEGDDITLVLHRNKKADG
FT                   KGSLPENGEKPIIKRYKREVKTEALANKIVDSEPDNRTVQDIKKLFENLGKQRIINQIK
FT                   LESKNNNPPQRQALLPKEANTSGFGDYYGAEGSTGLAMCYLDDSAENKDIRLFRLWEMA
FT                   KDFASLNRGTAHWFTPNLGYRDDDNLVFLSLEHDTAFAYPEIAFVIRIVLGDETFFIVD
FT                   FSQKSYDISMSGIAYKKSSNEDFISLNDIQSSKLAEILSEVILKEQLPTEYISEQNQYQ
FT                   TKISTFRHPTAKSSNWVYNAVSKLTPQNLINPNK"
FT   gene            104387..105487
FT                   /locus_tag="D11S_0122"
FT   CDS_pept        104387..105487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81541"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548236.1"
FT                   /protein_id="ACX81541.2"
FT                   /translation="MSNNMNFENLQVKKVISHFIHQPDYEGNPIPAIISQELISLDTLA
FT                   KSLLTERLVKVLGSDSKSVEMQISDAQIGSCFDYINKALINNRSNFIEQSQNIANKLAS
FT                   IQNSDRKYPSGLLIVIYATVTASNLDCIIIIKAEEQSAFQKILDVNTSSISLNMLNDLF
FT                   LTPQSKLYKVGVFIKNSNANAVDSLEEITTTYTAILYDSNFTKDLKNAAKYFYSLFLGL
FT                   SIPENDKIITQKFYEETRKFINNMQISSEKKIELQNALYTELKTNTSPTISTATFSENY
FT                   LDEDEQDNYLSVMSDANIPDRSFTKDISLIENMLKLRRYHFSSGVKIISPSESDLVKII
FT                   STDEEISLIDRTQSTIIRIKGILSEQ"
FT   gene            105484..106482
FT                   /locus_tag="D11S_0123"
FT   CDS_pept        105484..106482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0123"
FT                   /product="(p)ppGpp synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81542"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548234.1"
FT                   /protein_id="ACX81542.1"
FT                   /translation="MTREEFIAKYEQDKPMLDAWAKFIIAEIRKHLPEGFEQHSVKIPV
FT                   SYRLKDNQSILEKVFIRKKDKYKDPYKDVQDKVGLRWVVLLTEQLKTFCKIIENSEYWS
FT                   FSKDRTLNDWEEKPEVFSYQSIHYILIAKQQLVYENTEIQIGTPCEVQLRTLLQHTYSE
FT                   FGHDTIYKGNLNKPPEVLRYLAKSMALLETTDELLCNAKEKIEEINYQDPSYPLIKKSN
FT                   EIFKSYFNFTENQILDSEKTACFILNKIRSIIDENKNFSEDNFNTFLESRKFILERIKD
FT                   KQSYFIEFSQPIILLIYFLVSKNRRRKDWHPFSDNIMEKIYTDLGYSYAQD"
FT   gene            106697..109564
FT                   /locus_tag="D11S_0124"
FT   CDS_pept        106697..109564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0124"
FT                   /product="helicase IV"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81543"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564281.1"
FT                   /protein_id="ACX81543.1"
FT                   /translation="MTDNVDSVIILPNFLGKIFGNFKQVELQQDTVLLMGRDGKTKSYS
FT                   TFHIETFPQFTSSILGIQLSFLCEQELVSVRFLSKANVEQFYQGLEEKIAQNILNKLKP
FT                   AITTFDRLAKNQYLRDSDIPLLESQLDLLISKYIENKEILHRYFDNQTIQALDYICNVM
FT                   PVGKIKQEVVRQDYERKRLVERNHFFDVIESNPLTQQQRLAVIRNNDINMVLAAAGTGK
FT                   TSVMVAKALDLIDSGVATSEEILILAYNKDAATELTERLEARAEAANLDLSESPSISTF
FT                   HALGRNIIKSCGKSVRLSKFAEDSAKLDEWFTKWLENYIQEDPDNLLSFISLSYQPIDP
FT                   FQFKTKQEYDAYVRDNEYRTLQGERVRGYQELLIANWFFMNNIPYEYEPRYVSKRRIEI
FT                   GFDYKPDFGLGDGVYLEHFGIDRQGKTRPDIDAVKYNNDIVRKRQLHQEHNTTLLETYH
FT                   YNWTENNLYKSLEQLMHQQFIAIRPKTDKEIREALENSGIFKESKNRYLKCLQAIRTER
FT                   LDYTQVLKRLQKANVAHARQYTDFLMCIHDAYVKKLNEAQEIDFDDMILQATMLIKNGS
FT                   FTPKWKHILVDEFQDISMARLELLKEIYSKGPRPIWTVVGDDWQSIYRFSGGKLEVTTQ
FT                   FGKMIGSHTLSKLEKTYRYNNSIADTAGHFIMQNPEQYKKDVVTHTQVNDSCVHLYDSY
FT                   VMKEGKRESNISLKALEIYKQIRKQHPDASIAILARYRYLIKEAKDVIKDTNVKFWTFH
FT                   GSKGLEADYCILLGFFQGKTGFPNNNKEDAVVEALLPTLDDYPHSEERRLFYVALTRAK
FT                   KESYLIADATAPSEFINELLSPQYNIDIVSEGFKDKYRKIFKCPVCSTGYFALKVGKFG
FT                   NFYSCTSGSVCRSSPRVCEKCGSPSIDTENVSTCQNPNCRNSFPICDKCGRPMRLREGK
FT                   FGKFWGCSGYGIKDDPCSNTRKYFM"
FT   gene            109600..110832
FT                   /locus_tag="D11S_0125"
FT   CDS_pept        109600..110832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81544"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018003234.1"
FT                   /protein_id="ACX81544.2"
FT                   /translation="MSNNISPNYITHSLELLIKIAEYGDANAQKMLGWHYLNGSAIEKN
FT                   VKQAFIWNSKAAKQNDIEACFIVGWHYENGVGVEISYKDALEWYGKAARKGHTEAALRL
FT                   AELYFYGTQKVDDYQFNIEANLEEAIHYSEPLAKNGNTVAQRIFALCLIKEKDFAAIRY
FT                   FGKASKQGDLIATERLIKILERINSAPDLDQEIYTYLVELIEIFDRNVEFTDCVSMFKD
FT                   IKGFVIYFHKKAIEQGSTTAEACLMKFYDRYKDDSAISLIANNNQDAQDWKNFASKNYL
FT                   SENLQEVKNLALEGDIDSQLALAKFYRNSDKTKKWLEMSALQGDERGQYLLAHFYEQNK
FT                   NYQEALNWYRKCSHEHNLAEAQERMSYFFEHGLGVEQNGYLAYFWAKIAVDNGNNDARD
FT                   RLSSLSIYSDE"
FT   gene            110861..111571
FT                   /locus_tag="D11S_0126"
FT   CDS_pept        110861..111571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81545"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ACX81545.2"
FT                   /translation="MSNFKIWAILSGLDLVLMMMLDSRLTSIFVASILLWSLIFSVREY
FT                   ISKNYSNIFHWIIVIPATIYLFYSGVNIWLIVLYVIFGLLSGINVPDMEKDRNSIDDIV
FT                   IAITFLFIWLTRDAPFTYKLIAPVIFVVFYAMVMSEKEKKERDAARQHINIDGNDYMIP
FT                   QCNKCNSYDTILVELEELSTSYGNTEGYVEERFLKNVVKVRRTRYTDYNLTYKCKNCGE
FT                   VGVKNLQTRTREHI"
FT   gene            111731..111943
FT                   /locus_tag="D11S_0127"
FT   CDS_pept        111731..111943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0127"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81546"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548227.1"
FT                   /protein_id="ACX81546.1"
FT                   /translation="MDKNQYLVCFGKKVKELRKQKGLSQEALALLCDLDRSYIGGVERG
FT                   ERNISLINIYKITLALNIDIKDFFL"
FT   gene            111955..112629
FT                   /locus_tag="D11S_0128"
FT   CDS_pept        111955..112629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81547"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ACX81547.1"
FT                   /translation="MNYQHYKPKNLEEIKKKAITFSKFRNRCKEYLIRNNVKFDKFTIV
FT                   GHDSEIGYISERTLKSYLESNYSDVKICSWENKCDIKRIFRILDNNLTDQESVRIVSEY
FT                   FYDKYDLVLSYNNKSIYIDVKTAKTKKEPTSNWKFLYPEIQTTKIGKDYIALIYCIYDD
FT                   NNNIKDTVIIGAIKHSDIKNYNLVEKGSINRNGAPSQTKNYETDLNDYCSIDDLINILK
FT                   QS"
FT   gene            complement(112709..113185)
FT                   /locus_tag="D11S_0129"
FT   CDS_pept        complement(112709..113185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81548"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548222.1"
FT                   /protein_id="ACX81548.1"
FT                   /translation="MQHMTHTPLNVDLKKMDYETFKTFMQELAQMYSNVKDDAYFLFYR
FT                   NLRELAKEVSALPRNPLVFYGAYEIANNQVVVAIFEMQFTDEIYETEDGRPYQMLSIIS
FT                   SFAEDKVYLRCPTKIRKHLTQPEYVALCEQAYPTIMEKMLLDEQREKFFKKSEK"
FT   gene            complement(113315..115936)
FT                   /locus_tag="D11S_0130"
FT   CDS_pept        complement(113315..115936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0130"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81549"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548220.1"
FT                   /protein_id="ACX81549.1"
FT                   /translation="MELNSYQVQVINDLNDYLSELNQYGSHRLKQVFSNYWAKKGVPNQ
FT                   QYVEKITNTPHICVKVPTAGGKTFIAVNALQSIYSAIEFHGEIKPRFTVWLVPSTAILE
FT                   QTIRSLRNPEHTYRQKLNVLFNGRVNVYEKDDILLGRGFDADTVKSGISIVVMTFDAFR
FT                   TRNKEGRLIYRENGYLASFDTKATALPDSDETSLINVIRSLEPVVIVDESHNATSDLSL
FT                   EMLTNLNAKFILDLTATPRKESNIISYVSSLALKKENMVKLPVNASNQASKEDVLISAV
FT                   TFQRHLEQVAQKAFENGEPYVRPIVLFQAEAKTKGDNTTFEKVKRTLIEELNIPIEQIK
FT                   IKTADIDELKNVDLFSPDCPVRFVITVNALKEGWDCSFAYILANLANKHSEIDVTQIVG
FT                   RILRQPNAKQFSNPLLNMSYVFTASAQFRNVLGNIVEGLTLAGFSPKDYRAIGNNSESN
FT                   QEFTSELDNLPLTLMSPQQNEPTENGSFDFDTNKLKENIQQSTTGNSEFNPISNEFIQD
FT                   VVTQSESFNLEVKNSTVTVPNELKEKMNMAKINAEFKESVKNIRIPQFFETMSGGLFDD
FT                   IVLFEKENLLTKFELNQCDTQISFSDLDPELYSIDIENEQNVKFTPLNKEKSEQLLKLF
FT                   RDYSLERKKESIVGSLLNFAGRNAFYPIADSEIKVYFRRIIEQMSIADMENCLIKPSIY
FT                   FDKIKNKIKQLQEKFSQQEFYKWIDQECFQIKAEYQLPIEITPQNFADSLSRSLYEREA
FT                   SMNNYEFNVISRVISLDNVVWWHRIDDKRKEYSFKINGFINHYPDFLILTKKNTLILVE
FT                   VKGEQLANPESKNKLELGKKWESLANQLSLPHKFKYFMVFITKPMEGAKSLDELIKTIS
FT                   YL"
FT   gene            complement(115946..117586)
FT                   /locus_tag="D11S_0131"
FT   CDS_pept        complement(115946..117586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81550"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015564497.1"
FT                   /protein_id="ACX81550.1"
FT                   /translation="MPELNWIGKQKIKNHHNEIPFHLLEKKYTYKLENVHHKNNEDNIL
FT                   IHGDNLLALKSLLPKYEGKINCIYIDPPYNTGKTPEDGGWTYNDNVSDPRIEKWLGDVV
FT                   GKEGEDLTRHDKWLCMMYPRLKIMEKLLHEDGVIFISIDDTELAHLRLVCDEIFGYQNF
FT                   IECFCWEKTTTPASLSKTSRSNIDYILTYQKKNTQKIFDSHKEDKKSTDSPVENKDNPI
FT                   STIILNSGVIKCNFPDGIYNKEKYGDGKLLNDLVVKNGTNQETLKYSSNLKWSQDYLDN
FT                   EIKQGTELLFKSTKMSLRYKKIEGRKKIMAPNKLIDNKFGVGTNDNAKSDLDELGITFS
FT                   YSKPYSLVSFLINIISNKDAIILDGFMGSGTTAHAVLNLNAKDSGNRQFIGIEMMDYAE
FT                   NITAERIRRVINGYGSKAETQKGTGGGFSFYTIGETLFDSDGNLNNQADLISIREYIAH
FT                   SEKLETVFDNHTSGYFLGLNYQTAYIFYYESDQVTTLSLDFLRSLNANFMAEKPKDFII
FT                   YADKCSLTDEQLAQFKIRFKRIPRDISKL"
FT   gene            complement(117599..117811)
FT                   /locus_tag="D11S_0132"
FT   CDS_pept        complement(117599..117811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0132"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81551"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548214.1"
FT                   /protein_id="ACX81551.1"
FT                   /translation="MNSTKNLTLKAQFKQWLEEEQKTDEMIAFATIPHILRRFDKRLAI
FT                   IKGNRFEKRYLSEWRRAFRVDNTLY"
FT   gene            complement(117932..119392)
FT                   /locus_tag="D11S_0133"
FT   CDS_pept        complement(117932..119392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81552"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548212.1"
FT                   /protein_id="ACX81552.2"
FT                   /translation="MGALKTTAKNHSMKITKIRSQKRNSCSICGKAQVTRKFQKEYYCA
FT                   NCYAQWFKQKTCKRCGQLKRIHRDGKLCLECEKLTDCVRCGKEAGTFEIGMISRYGAVC
FT                   CSCTRYFREEIECSECGKMTRDRYRSPVTNESVCLSCYRKYTFGTCKNCRRYRKIHNEE
FT                   KRLCKKCDEKLLSTCPKCKGEMPSGYGKVCPDCARRTLLFNMIRLNVHIFRNKAVKTAY
FT                   KKFIFWYMRKCGISVALHKGSDFMRFFIDCDDIWQKIPNYAELVTHFKPNGLRANLTVL
FT                   RWLLDTHQIVIDEALKGDLAELERIQALFNKLKESVPCIASYYQMLQQRFDSGKTSLKS
FT                   VRLALQPAIDLISSQAITDYPTQEQLNHYLSEKIGQMAAITGFINHLKSAYHRELDIDR
FT                   KLIQQMKAKRLKKHYSQRLVELYKQTELTATEQMELVSVVLYSLHSIEIKKPKLDAILL
FT                   LDGVTYYRDKTKDYFLPQDICLRIKPQF"
FT   gene            complement(119353..120471)
FT                   /locus_tag="D11S_0134"
FT   CDS_pept        complement(119353..120471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81553"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548211.1"
FT                   /protein_id="ACX81553.1"
FT                   /translation="MGTTNAGLTKNYRIKSRIIRTPLYLNESISSWLIRAALDCGTEPI
FT                   TFTGFYWDKWRLWIYDLDRGFEPIAPQIYEDIRALSFNQQVNLVNHSLYSVLRPINGES
FT                   TLIKGQAKWVISRGSRNRTFRVGQSYCPCCLGETPYLRNEWRFAWHFGCSKHQVLLESK
FT                   CPCCGELYQPHLLSAEKRHLNYCHQCGEKLQVVTTPLNEVEIATMETLNNVFMTNSGEC
FT                   FRKRVNAQVYFAILRYFINLIRRATVVKSTHAFAKFVEECGISQAEICQTKTALAFEQL
FT                   PVEERKNLLVNAIKILKLPSKDFIQAIQQSGITQKAFDFEKYPMELDILFKYAPEGKTV
FT                   SRKTVTNKPKTDSVLSLNRQWERLKRRLKITA"
FT   gene            complement(120429..121322)
FT                   /locus_tag="D11S_0135"
FT   CDS_pept        complement(120429..121322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0135"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81554"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541478.1"
FT                   /protein_id="ACX81554.1"
FT                   /translation="MEKQYEYVHEKFRHLVIASNQERIEFLDEPRWVGYAVANKIIDNL
FT                   VSLMNKPKRPRMFNLLVVGDSNNGKTTLIRHFYDLYGIPFVDSQSDGIRPIILAEAPPS
FT                   ANEKELYISLLERFYVPYRPTDSVAKLRYQTIHLFREYKVKMLIIDEFHSLLVGTPRLQ
FT                   RQVMNAIKMLCNELQIPIVGVGTKDAIRVLHTDPQHASRFDVAELPTWKLDKDFQKLLF
FT                   QFQGILPLKKCSNLQSPELATKIHTISGGNLGNVHRLLTACAIEAITTGTEQITLDIIE
FT                   HNSWVQPTQGLRKIIG"
FT   gene            complement(121322..123241)
FT                   /locus_tag="D11S_0136"
FT   CDS_pept        complement(121322..123241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0136"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81555"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005760718.1"
FT                   /protein_id="ACX81555.1"
FT                   /translation="MTKGFIHPRYHGRLERGRLILQKGNVYVNREDGEQYELIEYLDED
FT                   AQVMIRNLHTRQSKISSIHQLENLKVNEREDVSVDLSAISDEYWEKALEKYEMIKPLLN
FT                   YEQHCPASVKERAKEVGVSDRSLYRWIQAYNSLGSIAGLVSRKRGWAEGNSRLSKEQDE
FT                   LVTAVINEFYLHKQRPTIEQTIREVQRVASQKGLDSPSRRTIRQRILRISEEERLRKRG
FT                   QKEKAKNKFTPKPNSFPNVDFPLSVIQIDHTPVDLIIVDNQYRKPIGRPYLTLAMDVYS
FT                   RMITGYYLSLDAPSVTSVAMCIARSILPKERLLLDHNVKGEWAVFGYPNKIHVDNGADF
FT                   RSLDLSKSCEAHGIALEFRPVGRPEFGGHIERVIGTFMKEVHGLSGTTFSNTKEKDTYQ
FT                   SEAEAVMTLDEFETWLINYIVNVYHKRTHSALGMSPVQKWRLGIFGDKDHVGCGYPQMP
FT                   VDEQTLLLDFLPSEKRTIQHNGVTIDGLRYYDVALNMYINDSDENGKSKEFLFRRDPRN
FT                   IGKIWFYDPKLKHYFQIPFADQSLPDMSIWEYKQVRHFLKDKDEKLIHSQQIHDALTEM
FT                   RELVEQSAQRTKKARRQAQRQKVHAKSKVVIPTSLPESKPTETVKTPASNLLLDNDFTF
FT                   GDIE"
FT   gene            complement(123234..123896)
FT                   /locus_tag="D11S_0137"
FT   CDS_pept        complement(123234..123896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0137"
FT                   /product="TnsA endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81556"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548207.1"
FT                   /protein_id="ACX81556.1"
FT                   /translation="MKTEPIFQQVRKIKPTRLSVSGLLPFKDGVSIPYESTLERDLLLY
FT                   FTYMPAVEEIISQPVRILFVKNRMTYPYTPDFFIRFNDGRPSLLIEVKPKSKWQKHWRD
FT                   WKEKWKAAMAFSKKNKCIFHIYDEDRIRHLALFNINAVQRYKRLQCDPEDIGAILTQVK
FT                   LHGGTTIDFLLSRLFTGSLYRTKGLQIIYHLLATKQLTCNWFEPLSEFTEVWGYSND"
FT   gene            complement(124748..125575)
FT                   /locus_tag="D11S_0139"
FT   CDS_pept        complement(124748..125575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81558"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564271.1"
FT                   /protein_id="ACX81558.1"
FT                   /translation="MKLMSVKTLIFLTALLWLPVAYSAKLAIVIDDLGYHPKEDAQILA
FT                   LPKAVSVAIIPAAPYAKQRNQQAHQQGRDILIHMPMETVSKMKIEGGGLHLGMNQEEVN
FT                   HRVQTAKKIVSHAIGMNNHMGSAATADVPLMTKLMTALRERHLFFLDSRTIGRSVAGKI
FT                   AKAQGVLALDRHIFLDDSNDLADVQRQFRAAVQYAQKHGTAIAIGHPRKNTIAVLQAGI
FT                   INLPSDVQLVSMGSLWRNEKVIPPKPFIFLFSEAAAPTSVPPYENVPLLRGVP"
FT   gene            complement(125572..126831)
FT                   /locus_tag="D11S_0140"
FT   CDS_pept        complement(125572..126831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81559"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702467.1"
FT                   /protein_id="ACX81559.2"
FT                   /translation="MWQLYEIKRRRKFLVGRVRIKTLGIFTALLCAAPSVFAAQQDLSK
FT                   IHQQIKQQEQKIASQKAEQQKLQSTLKTQENQINNVIGQLRQTESDLKAIRKNISDTDK
FT                   QIKQLQKQEKEQKAKLAKQLDAAYRSGVNPSVAERILSDKGQNAERMKAYYAHLNRARM
FT                   KLIAELQDTRAQLAKQKEAIAEQQKTQQSQLADQKKQQQALQKVQQERQSTLSQLNHNL
FT                   TRDESKLEALKANENALRQEIQRAEQAVKQQEQHEREALAQKQRAEETKTHKPYKPTEQ
FT                   EKRLLSSTSGLGAPQKQYGFPVAGKVVNRFGSTQMGELRWKGIVIAAGSGTPVKAIADG
FT                   RVILANWLQGYGLMVIVKHGDSDLSLYGYNQSLAVKEGQLVKAGQKIGEVGSSGGQSKT
FT                   ALYFEIRRKGVAVNPVGWLR"
FT   gene            complement(127040..128698)
FT                   /locus_tag="D11S_0141"
FT   CDS_pept        complement(127040..128698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0141"
FT                   /product="alpha-D-phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81560"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518365.1"
FT                   /protein_id="ACX81560.1"
FT                   /translation="MSVLFDTAQNWLNQDPDVETHAELTALLSAAKGGDAKAQAELAER
FT                   FSGRLQFGTAGLRGRLQAGSMGMNRVLVAQAAGGLALFLKEYDKQPSIVIGYDGRKNSD
FT                   VFARDTAEIMAGAGIKAYLLPRKLPTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVY
FT                   LGKANGGGQIVSPADKQIAALIDKVAAGSIKDLPRSQDYAVLDDTVVDAYIAKTASLAK
FT                   EPQTDINYVYTAMHGVGYEVLSKTLTKAGLPQPHIVAEQVWPDGTFPTVNFPNPEEKGA
FT                   LDLAIKVAKENNAEFIIANDPDADRLAVAIPDAEGNWKPLHGNVVGCFLGWYLAKQYQA
FT                   QGKKGVLACSLVSSPALAEIAKRYGFGSEETLTGFKYIGKVQGLLFGFEEALGYLVDPD
FT                   KVRDKDGISAAIVFLDLVRHLKKQGKTLADYAAEFTSEFGAYVSGQISIRVSDLSEIGK
FT                   LMTALRNNPPSQIGGFNVAQFIDHTKTDRQSDILVFVLENGSRLIARPSGTEPKIKFYL
FT                   DARGTDPKNADQVLADFDASVRAILRQEAYGKQDC"
FT   gene            129004..129687
FT                   /gene="gpmA"
FT                   /locus_tag="D11S_0142"
FT   CDS_pept        129004..129687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="D11S_0142"
FT                   /product="phosphoglyceromutase"
FT                   /note="2,3-bisphosphoglycerate-dependent; catalyzes the
FT                   interconversion of 2-phosphoglycerate to
FT                   3-phosphoglycerate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81561"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575952.1"
FT                   /protein_id="ACX81561.1"
FT                   /translation="MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDA
FT                   GFEFDIAFTSVLTRAIKTCNIVLEESHQLWIPQVKNWRLNERHYGELQGLDKKATAEKY
FT                   GDEQVHIWRRSYDTLPPLLDPKDPNSAHNDRRYAHLPDDVIPDGENLKVTLARVLPFWD
FT                   DQIALALLSGKRVLVVAHGNSLRALAKHIEGISDADIMDLEIPTGQPLVYKLDDNLKMV
FT                   EKFYL"
FT   gene            complement(129772..130266)
FT                   /locus_tag="D11S_0143"
FT   CDS_pept        complement(129772..130266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81562"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561330.1"
FT                   /protein_id="ACX81562.1"
FT                   /translation="MEMSTTQRLILANQYKLMSLLDCDNAAKYQRLETIVKGGFALELN
FT                   TLENDFTNISERECQIVLDTLEMYKALQISYNNLENKSELSEHRLQFVGYCAIREKKYL
FT                   SYLRFITGVEGKYQEFMRCEHGCDSQTPMWDKYSRMLEVWRACPHEYHLSMVEIQNILN
FT                   A"
FT   gene            complement(130284..131060)
FT                   /locus_tag="D11S_0144"
FT   CDS_pept        complement(130284..131060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81563"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561328.1"
FT                   /protein_id="ACX81563.1"
FT                   /translation="MKPFLIKQSVIMKTQKLLAALLLGSVVLAGCSSTIDPETGERKDA
FT                   LEGFNRKMWDFNYNVADPYVLKPLAKGWKEYVPSPVRTGVINVADNLDEPASFANRLVQ
FT                   GEFKQALIHFNRFWINTIFGLGGLIDVASYSDPLKKQGDNRFGDTLGSYGVGTGPYVML
FT                   PLYGPATPRQDIGNLADTTYPMLSLLGPWGFLKAGLQSIDTRAKLIDKEALLDQAQDPY
FT                   VAFREAYFQNLDQRINESKGKQADSELSQDILNQIN"
FT   gene            complement(131126..132709)
FT                   /locus_tag="D11S_0145"
FT   CDS_pept        complement(131126..132709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0145"
FT                   /product="nickel ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81564"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518366.1"
FT                   /protein_id="ACX81564.1"
FT                   /translation="MKKITLILTALFTALPSWANMQNNELDYASTKDIRDINPHLYSGE
FT                   MAAQNMVFEPLVLNTEFGPQPYLAESWSISPDGKTYIFKLRKDVKFSDGEPFNAQAVKL
FT                   NIDAVLDNYTRHAWLELVQQIDSVRVIDDYTIELKLKNAYYPTLTELSLTRPFRFISPK
FT                   SFIDGKTKDGVKEYAGTGPWMLVAHEENQYARFTVNPHYWGKKPQLNAVVWNVISDRQA
FT                   MLAALENGDIQLIFGSDGDMVNMDAFDKLKSSKTLSTLLSEPTATRFIILNSGREITGE
FT                   LPVREALEHAVNKQGIAQTVFANSESVAQTLMSKNVPYSDVEVKTFDYDIAKARQLLDF
FT                   AGWKLPAGKSVREKQDKVLSLLFSYNADNAAEKEIAELIQTDLKNIGVDLRIVGEEKTA
FT                   YLERQKTGDFDVQYSLSWGKPYEPASYISSFRSPAHADYQAQKGLKNKPEINLIIGELL
FT                   ITPDETLRKKLYVNLWRTLADQAVYLPLTYARTKAVFANELKGVGFNQSQYEIPFERMY
FT                   FSSAQAPVTK"
FT   gene            complement(132775..134106)
FT                   /gene="hslU"
FT                   /locus_tag="D11S_0146"
FT   CDS_pept        complement(132775..134106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="D11S_0146"
FT                   /product="ATP-dependent protease ATP-binding subunit HslU"
FT                   /note="heat shock protein involved in degradation of
FT                   misfolded proteins"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81565"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018356878.1"
FT                   /protein_id="ACX81565.1"
FT                   /translation="MSEMTPREIVSELDQHIIGQSEAKRAVAIALRNRWRRMQLQEPMR
FT                   YEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DSAMKLVRQTEIEKNRVKAEEAAEERILDALLPAAKNQWGEMENRDVQNNTRQIFRKKL
FT                   REGELDDKEVEIDVAGVPMGVEIMAPPGMEDMTSQLQSMFQNLSSGQTKKRKMKIKDAL
FT                   KTLVDDEAAKLVNPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDL
FT                   LPLVEGSTVNTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELSALTAGDF
FT                   ERILAEPNASLTEQYKALMATEGVNIEFTQDAIKKIAEAAFRVNEKTENIGARRLHTVM
FT                   ERLMDKISFNASDMDGQTVSIDAAYVSEALGDVIENEDLSRFIL"
FT   gene            complement(134127..134654)
FT                   /locus_tag="D11S_0147"
FT   CDS_pept        complement(134127..134654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0147"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81566"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538653.1"
FT                   /protein_id="ACX81566.1"
FT                   /translation="MTTIVSVRRNGKVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLLKSAVELAKDWRTDRALRKLEAMLIVADEKES
FT                   LIITGIGDVVQPETDQILAIGSGGNYALSAARALVENTDLSAREIVEKSLKIAGEICVF
FT                   TNTNFTIEELPN"
FT   gene            134869..135576
FT                   /locus_tag="D11S_0149"
FT   CDS_pept        134869..135576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0149"
FT                   /product="acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81568"
FT                   /db_xref="GOA:C9R7B6"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR010025"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9R7B6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548187.1"
FT                   /protein_id="ACX81568.1"
FT                   /translation="MKNLVKLSLIAMLTAATLPAMAAKSEPYTHQGTNAREMLVEQPIH
FT                   WISVDQLKKELEGKAPMNISFDIDETVLFSSPCFYHGQQKYSPGKQDYLKNQDFWNEVN
FT                   AGCDQYSIPKQIAVDLINMHQERGDQIYFITGRTAEDKDGVTPVLQKAFNIKNMHPVEF
FT                   MGGRDRTTKYNKTPGIIEHKVTIHYGDSDDDILAAKEAGVRGIRLMRAANSTYQPMPTL
FT                   GGYGEEVLINSSY"
FT   gene            complement(135958..136275)
FT                   /pseudo
FT                   /locus_tag="D11S_02245"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(136554..137798)
FT                   /locus_tag="D11S_0152"
FT   CDS_pept        complement(136554..137798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0152"
FT                   /product="tryptophan permease"
FT                   /note="tryptophan transporter of high affinity"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81571"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548180.1"
FT                   /protein_id="ACX81571.1"
FT                   /translation="MTTAKRPSLLGGAMIITGTAIGAGMLANPTSTAGIWFAGSIVILI
FT                   YTWFCMTTSGLMILEANLHYPTGASFDTIVTDLLGRGWNVINGLSVAFVLYILTYAYIT
FT                   SGGSITESFLNQLGENVEVGRSAGSLIFCIVLAAFVWLSTKAVDRFSTVLIAGMVISFF
FT                   LSTAGLLSSVKIDVLFNTVAQGEQQYLPYILTALPVCLVSFGFHGNVPSLVKYYDRDGN
FT                   RVMKSIFLGTGLGLVVYILWQLAIQGNLPRAEFAPVIAKGGDVAALLEALSKYIQTDYI
FT                   GIILNFFAYMAIASSFLGVTLGLFDYIADLCKFDDSRLGRTKTTLVTFLPPLLLSLQFP
FT                   FGFVLAIGYAGLAATIWAAIVPALLAKASRKKFPNATYRVHGGNFMIYFVILFGLLNIF
FT                   VQVALQFGWLSDFKG"
FT   gene            137960..138487
FT                   /locus_tag="D11S_0153"
FT   CDS_pept        137960..138487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0153"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="catalyzes the hydrolysis of pyrophosphate to
FT                   phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81572"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548178.1"
FT                   /protein_id="ACX81572.1"
FT                   /translation="MGLERVPAGKALPDDIYVVIEIPANSDPIKYEVDKETGTLFVDRF
FT                   MATAMFYPANYGYVNNTLSSDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGGDA
FT                   KVVAVPHTKLSKEYDHIQDVGDLPALLKAQIQHFFESYKALETGKWVKVEGWEGVEAAR
FT                   HEILDSFERAKK"
FT   gene            138563..139336
FT                   /locus_tag="D11S_0154"
FT   CDS_pept        138563..139336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0154"
FT                   /product="deoxyribonuclease HsdR"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81573"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548176.1"
FT                   /protein_id="ACX81573.1"
FT                   /translation="MSRLGKMLVLVSTIGILTACADSASINQEAATGYAQMISQAQAHG
FT                   QVDNKSKTAQRVRKIFNKMVPYANAENKTGQAFDWQISVIKSKELNAWAMPGGKMAFYT
FT                   GLVDNLRLTDDEIATVMGHEMAHALKEHGKKKANIGQFTDVVASVAQEALATKIGADSS
FT                   SMVVGLAKDWGLDKPYSRSAETEADEVGLILMAKSGYNPEAAPKLWDKMQKASTGSQGI
FT                   LDKLSSTHPSDKDRQENLVRLMPEAVALYKQSRKR"
FT   misc_binding    139740..139923
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch"
FT   gene            140016..140660
FT                   /gene="ribB"
FT                   /locus_tag="D11S_0155"
FT   CDS_pept        140016..140660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="D11S_0155"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="DHBP synthase; functions during riboflavin
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81574"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575934.1"
FT                   /protein_id="ACX81574.1"
FT                   /translation="MNQSLLSPFGTAEERVKAAIDAFKQGDGVLVLDDENRENEGDLIF
FT                   PAETITAAQMAKLIRYGSGIVCLCITDELCKQLDLPPMVNHNTSVNKTAFTVTIEAAEG
FT                   VSTGVSAADRVTTIKAAIADGAKPSDLHRPGHVFPLRAAPNGVLQRNGHTEAAVDLARL
FT                   AGYKEAGVICEITNDDGTMARAPELVEFVKQQGYAIVTIEDLITYRQKYHC"
FT   gene            complement(140747..141751)
FT                   /locus_tag="D11S_0156"
FT   CDS_pept        complement(140747..141751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0156"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number="6.1.1.2"
FT                   /note="catalyzes a two-step reaction, first charging a
FT                   tryptophan molecule by linking its carboxyl group to the
FT                   alpha-phosphate of ATP, followed by transfer of the
FT                   aminoacyl-adenylate to its tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81575"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518368.1"
FT                   /protein_id="ACX81575.1"
FT                   /translation="MSKPIVFSGVQPSGELTIGNYLGALRQWVKMQDDYECLFCIVDQH
FT                   AITVRQDPAALRKATLDVLALYLACGIDPAKSTIFIQSHVPEHAQLAWALNCYTYFGEM
FT                   SRMTQFKDKSTRYAENVNVGLFTYPVLMAADILLYQANQVPVGEDQKQHLEITRDIAQR
FT                   FNALYGPHFAVPEVFIPKAGARVMSLLEPEKKMSKSDENRNNVIGLLEDPKAVAKKIKR
FT                   AVTDSDEPPVIRYDVKNKAGVSNLLDILSGVSGKTIAELEQEFEGKMYGHLKGAVAEEV
FT                   SAMLTTLQERYHHFRNNEVLLHQIAKEGAKKAQARARATLAKVYEAVGFIAAK"
FT   gene            complement(141926..143287)
FT                   /locus_tag="D11S_0157"
FT   CDS_pept        complement(141926..143287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0157"
FT                   /product="cell division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81576"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167486.1"
FT                   /protein_id="ACX81576.1"
FT                   /translation="MPDEKKKGGFWSWFGLGKNKQEESEEPKEQASQEKTSHYVQESQP
FT                   EAQETAEKNTALPEEAETENTLTEDTSMVHASQPVPSDETPVDVGVESNPVIEETIANS
FT                   TALLDDETEAQAESAVEISNESHEEDSAVADMVETQEKPSEGGFFSRLLKGLVKTKQNI
FT                   GAGFRSFFLGKKIDDDLFEELEEQLLIADIGVPTTTKIINNLTQHATRQQLQNADSLYQ
FT                   QLKLEMGEILKPVAQPLHIDGSKKPYVILMVGVNGVGKTTTIGKLARKFQMEGKSVMLA
FT                   AGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSAAARNIDILIADTAGR
FT                   LQNKNNLMDELKKIVRVMKKYDESAPHEIMLTLDAGTGQNAISQAKLFNEAVGLTGISL
FT                   TKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLREFNAEEFIEALFAHEEED"
FT   gene            143375..143959
FT                   /locus_tag="D11S_0158"
FT   CDS_pept        143375..143959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0158"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81577"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548167.1"
FT                   /protein_id="ACX81577.1"
FT                   /translation="MKKPTIPQGTKGEVRIIAGLWRGRKLPVLSYQGLRPTGDRVKETL
FT                   FNWLMPYIAGSECLDCFAGSGSLGFEALSRQASKVTFLELEKAVAHQLTKNIQTLKCAD
FT                   RAQVVNQNSLQFLNHPQNQPHFDVVFLDPPFHFDLAEQAIALLAQHHWLRPQALVYVET
FT                   EKGKDLQVPATWALLKEKDSGRVSYRLYQAA"
FT   gene            144246..145211
FT                   /locus_tag="D11S_0159"
FT   CDS_pept        144246..145211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81578"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590513.1"
FT                   /protein_id="ACX81578.1"
FT                   /translation="MTHIIVATHGKFSEEIVNSAAMVFGEDENCHVVTFLPGEGGEHLV
FT                   EKYNAIIATLPENEPVLFLVDLFGGSPYNAAARVATGRENTDIVTGISLPMLLEVLDAK
FT                   NGASLPELVETAKEVGVAAVKSFRQPKEDANPATPPAQAAKPAEAEKPTALSGNMNISL
FT                   LRIDSRLIHGQVATSWAKAVKCEAIFAVNDDVANDPLRRDLLLQVAPPHLKAYVIPVEK
FT                   AIKVYHNPKYAGKNILWLVTNPSDIVRLIDGGVKVEKVNVGGMTYREGNKLLSQAVAVN
FT                   PTDVEAFKQLLDKGVELSLQQVAANPKVMLTHKELDAVKF"
FT   gene            145229..146026
FT                   /locus_tag="D11S_0160"
FT   CDS_pept        145229..146026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0160"
FT                   /product="PTS mannose transporter subunit IIC"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; the IIC domain forms the PTS system
FT                   translocation channel and contains the specific
FT                   substrate-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81579"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549073.1"
FT                   /protein_id="ACX81579.1"
FT                   /translation="MTTMEIILVTLVAAICGMGSVLDERQTHRPLVACTLIGLVLGDLQ
FT                   TGIIVGGTLELVALGWMNVGAAMAPDAALASVIAAILVIKGGQDKGSALAIAIPVAAAG
FT                   QVLTIFVRTLTIFLQHKADDYATQANFRGIEFCHFAGLSLQALRVAIPTFFVALVAGTD
FT                   TVTHALNSIPEVVTRGLQIAGGFIVVVGYAMVINMMRAGALMPFFFLGFVIASFSGYNL
FT                   VGLGILGTCLAILYIQLNPRFNQAALLPSSAKRELADDELEGL"
FT   gene            146040..146876
FT                   /locus_tag="D11S_0161"
FT   CDS_pept        146040..146876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0161"
FT                   /product="PTS mannose transporter subunit IID"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81580"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575925.1"
FT                   /protein_id="ACX81580.1"
FT                   /translation="MTEQNKLALTKKDIRSTYWRSTFLLGSFNFERMQAMGFCVSMIPA
FT                   IKRLYSKKEDQAAALKRHLEFFNTQPWVASSIIGVTAAMEQERANGAKDIDDAAISGVK
FT                   VGLMGPLAGVGDPIFWGTLRPVLAALGAGLAITGSRLGPLLFFIGINLCRALTRWYGFK
FT                   YGYEKGTEIVNDMGGGRLQKLTQGASILGLFVMGSLVSKWTSINIPLELSRYRNQMGDE
FT                   VVTTVQSVLNDLLPGLAALLLTFLCMYLLRKKINAMYIIFALFGVGIIGYHFGVLA"
FT   gene            146986..148161
FT                   /locus_tag="D11S_0162"
FT   CDS_pept        146986..148161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0162"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81581"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167487.1"
FT                   /protein_id="ACX81581.1"
FT                   /translation="MKLKDLIKAPPAEGYIKNSSNLVTALFILAGVLYYPTNGYGAVIA
FT                   LAVALIVLIGQKMLIGQANKDFAEMQFAEKQFPQTKNLDYVRFIHARATQILKDNKVLS
FT                   EKGKKELHRLLKFADTTLAENAEQTTPQYKAVFSDIDGTLLNNQHQITLKTEDAIKNML
FT                   KRGIPFIPVSARPPYAITPYTEQLGAQHGMICYSGALILDKNLTALYSVILEPQDLQKL
FT                   NELLADFAHLSISYYAGLDWFCNDVNNDWIKQESAITGLTAAAMPDNLTEVHKLLIMGD
FT                   ADEIQAVEPVLKQALPNLSIHRSKNEYLEIMNAAATKAKAIQFMEQYLGITADQVIAFG
FT                   DNFNDLDMLQYAGLSVAMGNAPDAVKQAAKEVTANNNEGGIALVLNRVFGK"
FT   gene            148453..149703
FT                   /locus_tag="D11S_0163"
FT   CDS_pept        148453..149703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0163"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81582"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167488.1"
FT                   /protein_id="ACX81582.1"
FT                   /translation="MDILISIIGIFVLLGIAVLFSNNRKAINLRTVFGALAIQIAIGAF
FT                   VLYVDKGREALKAASDFIGKIIGFGNEGISFVFGGLTDPSQSFGFIFAVKVLPVIIFFS
FT                   ALISLLYYIGIMQWIIKLIGGGLQKLLGTSKAESMSAAANIFVGQTEAPLIVKPFIGRM
FT                   TQSELFTVMVGGVASIAGSVMAGYAGMGVPLTYLIAASFMAAPGGLLFAKIMFPQTEKS
FT                   DDALKEDANVEKPSNAIEALANGARDGMHLAMNVGAMLIAFVSVIALINWILSSFGGFF
FT                   GEPDLTLQVILGWIFKPLAYLIGIPWNESAVAGQMIGLKLAVNEFVGYLEFTKYLQPDA
FT                   AIVLSDKTKAIITFALCGFANFSSIAILIGGLGGMAPNRRSDVARLGLKAVVAGSLSNL
FT                   MSATIAGLFIGLSGAVL"
FT   gene            149829..150548
FT                   /gene="deoD"
FT                   /locus_tag="D11S_0164"
FT   CDS_pept        149829..150548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="D11S_0164"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="catalyzes the reversible phosphorolysis of
FT                   ribonucleosides and 2'- deoxyribonucleosides to the free
FT                   base and (2'-deoxy)ribose-1- phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81583"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541819.1"
FT                   /protein_id="ACX81583.1"
FT                   /translation="MTPHINAPAGAFADAVLMPGDPLRAKYIAETFLDDVKEVTNVRNM
FT                   LGFTGTYKGRRISVMAHGMGIPSCSIYAKELITEYGVKKLIRVGSCGAVRMDVKVRDVV
FT                   IGVGACTDSKVNRIRFKDNDFAAIADFGLTQAAVQAVKTLGVKARVGNLFSADLFYTPD
FT                   VAMFDVMEKYGILGVEMEAAGIYGVAAEYGARALTICTVSDHIRTHEQTSAEERQLTFN
FT                   EMIKIALEAILIDDKEA"
FT   gene            150842..153238
FT                   /locus_tag="D11S_0166"
FT   CDS_pept        150842..153238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0166"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81585"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005551713.1"
FT                   /protein_id="ACX81585.2"
FT                   /translation="MVFMSGISLSTIPFAHANQSPIDLEREKIIIFSRQGDSELKQAIP
FT                   QLEKLFERTKDLKVRDDLIALYLRNNQSIHALKVCESCTPTQFSESELENLGKAARNEK
FT                   QFQRSFELYSQLAKKYPQNPNGLLGKVLVATELKNYTVAKDALINYKKRFGENTAYWDA
FT                   NSYLLDFTQSDMAKLGRWQRELSRNPKNTHLAGNLYRLASKYNIHPLQKKLQSEYPDLF
FT                   SEKDLLWYEHDKIIASAKNAKNNRKHLKNSFAGLTALLRKIDPAHPLYQQTLMDRFILG
FT                   VQLHEFDAVRDDYATLKALPTPSAYLREAFADYELAHASPHKALATYQSLAQSALDKKA
FT                   PVSDELLLKMFSAASDAGEFALAQHYLEQINSSPYVNDYTHTSRVPNPSYDERYFGLAR
FT                   LALWRGNAGLAQKMIDERALDKTPGDGWVLLQKAELERNRYNFDEAKEWAHKAGVFFIE
FT                   SDQKYVRHALIEIALRQNDLPTAKRLIQEMSPEEMDSVKPLMERYELAHKGRIVGSVNL
FT                   QHRTSAPTKQHNESTQDYAIYTLKTAEGHDLYVRYTESRVPVDGNSLNAQFIGAGTELN
FT                   FYPLNVRIEAGKGIKLSKRGYVTSDLSYELNQRWAFNLRGHINGTDVPSRAAAQNVYTK
FT                   GGGASVVYTYSDLFQLGGGVYFSRFSDSNLRHDANLWLNTKTFKHDRWALTNNFRVDYT
FT                   RNKTVQSADYYNPIKAVSYEVGGDLSYYQPFDYALILTHHLKGNFGAYKQQAQQRSKTW
FT                   SVSYGHEWRIGKQYGFLYEIGRKKNIYDGNPEFNNFGNLSFSLYY"
FT   gene            153254..155170
FT                   /locus_tag="D11S_0167"
FT   CDS_pept        153254..155170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0167"
FT                   /product="biofilm synthesis protein PgaB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81586"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167490.1"
FT                   /protein_id="ACX81586.1"
FT                   /translation="MKILQKLLQIIVVSFVFITGVASAQDRYGVLAYHSVVDDTAAKEE
FT                   KQYFPQTISANLLISHFNWLKDNGYNVVSWQQIIDAENGKSTLPEKAVVLSFDDGYATM
FT                   YNVIYPILKAYNYPAVFAPVSSWLDTPVNQLIPYANIKLPRNVFVTWEQVREMEQSGLV
FT                   EIASHTDNLHHGVRANPAGSQLPAVVAPEYKNNRYESKTEYKNRLVQDFSRSSKSIQRQ
FT                   IGKKPRIMVWPYGQFNDVAIDAAKQSGMTHHFALGQKIINKIGDRYVGRLLIDTETGFS
FT                   TIKNFLDGVDDESKLMRIVHIDLDSLYDADKKQQAKNFDKLIERMYRYGITTVYLKAFS
FT                   DPDGDGVADALYFPNRYLPVRDDIFSQIAWQLRTRANVKVYAWMPVLAFDLRNHVKEAT
FT                   YVVDHRTNQPAKDKYLRLSPYDRKNVEMIKSIYNDLSFYAKFDGILFHDDAFLTDFEGV
FT                   ESHSEGDGVTAAAKQKTLDLIGVTDELTNALKPYFLSSTPALKTVRSLHASVITNPKAE
FT                   EWFAQNLTTLTKHYDTTAIMAMPYMEHHQTISAKQAEKWFAALIQRVKAQAPLNKVLFE
FT                   FQSVNLKTKQPIPETELISWIELLQRNGIYSYGYYPDNFVADQPNMQKMRRYMSLNTQA
FT                   GKP"
FT   gene            155179..156414
FT                   /locus_tag="D11S_0168"
FT   CDS_pept        155179..156414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0168"
FT                   /product="N-glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81587"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548147.1"
FT                   /protein_id="ACX81587.1"
FT                   /translation="MSVFEILSIFVFVYPAGMAIYWFMAGACYYLFKEGKLNEPISRYL
FT                   PGEQVPMISLMVPCYNEGNNLDESIPHLLQLRYPNYELIFINDGSKDNTAEVIDRWAAK
FT                   EPRITALHQENQGKASALNHGLTVAKGKYVACIDGDAVLDYYALDYMVQALEQDPKYAA
FT                   TTGNPRVRNRSTILGRLQVSEFSSIIGLIKRAQGLMGTIFTVSGVCCLFRKDVMEEIGG
FT                   WSTNMITEDIDISWKIQIAGYNIMYEPRALCWVLMPESIKGLYKQRLRWAQGGAETIMK
FT                   YFSKIWHWRNRRLWPMYIEYFATVIWAFLWVLLAVIALIQKYIFDISIENMGLFETNIS
FT                   IMFFAFFLQCLLSLYIDSRYERNLLRYGLSCIWYPYVYWLLNTVTLLVGIPKAIFRNKS
FT                   KFAVWTSPDRGV"
FT   gene            156417..156710
FT                   /locus_tag="D11S_0169"
FT   CDS_pept        156417..156710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0169"
FT                   /product="HmsD"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81588"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575916.1"
FT                   /protein_id="ACX81588.1"
FT                   /translation="MSSSDELQKLMVIDKSDRLSFKMLVKNFILDLLTWGLWIYSIAFI
FT                   IKYAKGIFTQPVLEQFFFHDVIVIMFSAAIILVIITFFWSIISAGRRRKKRK"
FT   gene            complement(156828..158153)
FT                   /locus_tag="D11S_0171"
FT   CDS_pept        complement(156828..158153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0171"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81590"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575914.1"
FT                   /protein_id="ACX81590.1"
FT                   /translation="MGIFSVQPDLPVTKSKEEIDKTYRYWRMHLMITSYIGYAVFYFTR
FT                   KSFNFVMPAMLTDLGLQKTDIGIMGTAFYLTYGVSKFLSGVLGDRSNPRYFMGIGLMMT
FT                   GVVNIFFGLSSSVFMFITLWMINAFFQGWGWPPCSKILNTWYSRNERGLWWAIWNTSHN
FT                   LGGALIPLLAGAVTLYWGWRYGMIVPGIIACVVGFAICFLLRDRPTSMGLPTVGEWRND
FT                   VAEKEHESEGVGLSDWEILKTYVFKNTIIWALAFSWCFIYMVRTGINDWGNLYLTETHG
FT                   YDLLKANSAVSFFEIGGFLGALFAGWGSDKFFHGNRTQMNIIYVLGIIAVSLALWFIPS
FT                   DNYFVMSTLFFLMGFFIFGPQFLIAMAAAENSHKYASGSATGFVSLFAYIGAAAAGVPL
FT                   AWIIKSLHWNGFFGSLFIVSLGCALLLVLVYFLQRRKNEMKA"
FT   gene            158324..158956
FT                   /locus_tag="D11S_0172"
FT   CDS_pept        158324..158956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0172"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81591"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570391.1"
FT                   /protein_id="ACX81591.1"
FT                   /translation="MDLHNIRAEYRKKVLSQLECHANPITQFEHWLDDAINAQVNEPTA
FT                   MNLATVNENGRPSSRMVLLKEVNVQGFVFFTNYHSRKGRAIEQQPYVALTFFWPELERS
FT                   VRIEGKAEKISAEQSDAYFASRPYTSRIGAWASEQSAVISGYKSLLAKAALIAAQHPLN
FT                   VPRPESWGGYLVTPDRIEFWQGRPSRLHDRICYLLENGEWKNVRLSP"
FT   gene            complement(159044..159688)
FT                   /locus_tag="D11S_0173"
FT   CDS_pept        complement(159044..159688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0173"
FT                   /product="molecular chaperone Tir"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81592"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167491.1"
FT                   /protein_id="ACX81592.1"
FT                   /translation="MGNKIFISYKYSDNAVKQLKEPNNLFSFYSQYKTTARDYVDIIQN
FT                   KFERDDIHINKGENDNESLAGFKTETIRSKLAEKIFDSSVTIVLISPNIKNSWKSEKDQ
FT                   WIPWEIAYSLRSKRRPDNRSKRNAILLVVLPDRYGYYDYVNSYGFYFDIIQRNLNNLHT
FT                   PYTTYKLRNGCSNSYMLQCNWDKFISNPNAWIEAAIEIRDKGNNYNIVIRP"
FT   gene            complement(159716..160198)
FT                   /locus_tag="D11S_0174"
FT   CDS_pept        complement(159716..160198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0174"
FT                   /product="molecular chaperone Tir"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81593"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575531.1"
FT                   /protein_id="ACX81593.1"
FT                   /translation="MKRNVFYSFHYEKDVFRVQQVRNIGKLEGNPPATPNTWEEIKRKG
FT                   DKEIQKWIDENLSGKSCLVVLIGEDTSKRKWVKYEIQKAWNDGKGVLGIYIHNLKDPKS
FT                   GECRKGDNPFEQFTFENGSKLSSIVKCYNPKSSDAYNDIADNIEKWIEEAISIRKK"
FT   gene            complement(160201..161600)
FT                   /pseudo
FT                   /locus_tag="D11S_02255"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(161659..162960)
FT                   /locus_tag="D11S_0176"
FT   CDS_pept        complement(161659..162960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0176"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81595"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518370.1"
FT                   /protein_id="ACX81595.1"
FT                   /translation="MKRYILDLLQKWKTKPNRKPLIIQGARQVGKTWAMKHFGEQAFEQ
FT                   VAYINFDNNPRMKTLFAGDYNIDRLILGLKIESGVDIQADNSLIIFDEIQEVPQALSSL
FT                   KYFYENAPHFYIVTAGSLLGVSLHHQASFPVGKVDFQPIYPMDFREFLLAMSKPDLVQL
FT                   LEMQDWALISAMKSTYIDLLRQYYFVGGMPEAVKTFVETQNLNEVRQIQRNLLMAYEQD
FT                   FSKHISDGQTVQRVRALWNSIPEQLAKENKKFVYSQLQKGARSKDYEIALQWLKDSGLV
FT                   HVVPRIKKPHLPLSAYQDNAFKLFSLDVGLLGAQSYLDSTVLLEGNRLFTEFKGALTEQ
FT                   YVLQQLLVLQDNPVFYWATEKGTAEVDFVLQQGQNITPIEVKAEENLKAKSLKVYVDQF
FT                   QPKRALRFSMADYKEQDWVVNVPLYGVTSLFKST"
FT   gene            complement(163431..164762)
FT                   /locus_tag="D11S_0177"
FT   CDS_pept        complement(163431..164762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0177"
FT                   /product="ATP-dependent RNA helicase SrmB"
FT                   /note="facilitates an early step in the assembly of the 50S
FT                   subunit of the ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81596"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562516.1"
FT                   /protein_id="ACX81596.1"
FT                   /translation="MTNLIQFADFDLAPELLNALQKKGYQRPTAIQQETIPAAMEGGDV
FT                   LGSAPTGTGKTAAFLLPAIQHLLDYPRRKPGAPRVLVLTPTRELAMQVAEQAKELACFT
FT                   KLSIATITGGVAYQNHGEIFNKNQDIVVATPGRLLQYIKEENFDCRTVEILIFDEADRM
FT                   LQMGFGQDAEKIAAETRWRKQTLLFSATLEGDLLEDFAARTLNEPVKIEAEPSRRERKK
FT                   IQQWYYHADSHEHKFKLLARFIEQEQVSKGIVFVRRREEVRELAENLRKRGIRSAYLEG
FT                   EMAQTQRNNAIDKLKNGVVKVLVSTDVSARGIDIDDVSHIMNFDLPYSADTYLHRIGRT
FT                   ARAGKKGTAVSFVEAHDYRLLGKIKRYTGEILKARVIEGLEPRTKAPKDGEIKTVSKKQ
FT                   KAKKLEKREARKKADKKVKQRHQDRKNIGKRRKPSASTTAAAVK"
FT   gene            164852..165559
FT                   /locus_tag="D11S_0179"
FT   CDS_pept        164852..165559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0179"
FT                   /product="tRNA (adenine-N6)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81598"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548129.1"
FT                   /protein_id="ACX81598.2"
FT                   /translation="MNNMGFQFKQFRVNHDRCAMKVGTDGILLGAWANVTQAKQILDLG
FT                   CGSGLIALMLAQRSSAESRICAVEIDPAAAQQAQENVSASPWKDKIQVYQQNIETFCAQ
FT                   SKHAFDLIVANPPYFQTGVDCRNEARNTARYLASQSHLHWLETAASCLASKGKISFVLP
FT                   LEAGETLLKTTALYCVERCYVTTKQGKMPQRMLLTFAMQPQPLQHSRLIIYDAHHRYHD
FT                   DFVALTREFYLKF"
FT   gene            complement(165634..166323)
FT                   /locus_tag="D11S_0180"
FT   CDS_pept        complement(165634..166323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0180"
FT                   /product="nicotinamide riboside transporter pnuC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81599"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540997.1"
FT                   /protein_id="ACX81599.1"
FT                   /translation="MNPEQLLQKAKQELFSGWKPFEVFWLLLFIAAQIIAFVLDPQSPL
FT                   AMISGIAGVICVVFVSKGKISNYLFGLIFAYTYFYVAWKANFIGEMNTVLYVYLPAQFI
FT                   GYFTWKAHMQQEKSGSESVIAKSLTLQGWIVLAATVSVGTLLFVQALKAAGGSSTGLDG
FT                   LTTIITVAAQLLMILRYREQWLLWILLNIISILLWAETPAIYLMYSAYLLNSLYGYYNW
FT                   TKLAKQG"
FT   gene            166704..167363
FT                   /locus_tag="D11S_0181"
FT   CDS_pept        166704..167363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0181"
FT                   /product="23S rRNA pseudouridylate synthase"
FT                   /note="catalyzes the synthesis of pseudouridine from
FT                   uracil-746 in 23S ribosomal RNA and from uracil-32 in the
FT                   anticodon stem and loop of transfer RNAs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81600"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518371.1"
FT                   /protein_id="ACX81600.1"
FT                   /translation="MALIEYNPPQEPWLDLVYRDDYIAVVNKPSGLLSVPGNQPQYYDS
FT                   AMSRVKEKYGFCEPAHRLDMATSGILLFALSKSADRELKRQFREREPKKYYQALVWGYL
FT                   EQEQGMVELPLICDWENRPRQKICFERGKRAVTFYDVLQRYPNNTTRIKLTPITGRSHQ
FT                   LRLHMLALGHPILGDKFYAHPQAKALSPRLCLHAESLQIRHPITGETMEFTTLVGF"
FT   gene            complement(167682..168188)
FT                   /locus_tag="D11S_0183"
FT   CDS_pept        complement(167682..168188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0183"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81602"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005715549.1"
FT                   /protein_id="ACX81602.1"
FT                   /translation="MPLLDSFKVDHTRMKAPAVRIAKIMRTPKGDNITVFDLRFTIPNK
FT                   ENLPPKGIHTLEHLFAGFMRDHLNGKDVEIIDISPMGCRTGFYMSLIGTPNETQIAQAW
FT                   AASMQDILNVKKQSEIPELNEYQCGTYTEHSLEEAHQIAQNVLDRGIGVNKNEDLTLDE
FT                   SLLKQ"
FT   gene            complement(168401..168886)
FT                   /locus_tag="D11S_0184"
FT   CDS_pept        complement(168401..168886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0184"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81603"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570046.1"
FT                   /protein_id="ACX81603.1"
FT                   /translation="MLDLFSWDWWQSLFGEHRLWIMFARAFLSSTVLPGNSEIIFLTIA
FT                   APLLWSGYHHFSIEVQSLLWVAVIGNTLGSLTTYVLGRWLPAFNKPPQNAELAWTLEKT
FT                   QRYGSLVLFFSWLPIIGDVFCAVAGWLRLNWLACLVFIALGKIVRYVFLLFLGVAFL"
FT   gene            complement(168889..169494)
FT                   /locus_tag="D11S_0185"
FT   CDS_pept        complement(168889..169494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0185"
FT                   /product="galactoside O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81604"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557780.1"
FT                   /protein_id="ACX81604.1"
FT                   /translation="MLSEKEKMLRGLAHQPYTDELVAMRLRAKELLYQFNILTRPSNKA
FT                   EKVRLILALFGKADATTHVNAPFYCDYGSNIKVGKNFFANYHCTILDNAPVTIGNDVMF
FT                   APNVSLYTVGHPLDPELRLAGWEQALPITIGNNVWLGGNVVVLGGVTIGDNVVIAAGSV
FT                   VTKDIPANTVAVGSPCRVVRQVNVADRENYLRTYRPQI"
FT   gene            complement(169494..170095)
FT                   /pseudo
FT                   /locus_tag="D11S_02260"
FT                   /note="hypothetical protein; disrupted"
FT   gene            170224..170604
FT                   /locus_tag="D11S_0188"
FT   CDS_pept        170224..170604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81607"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567066.1"
FT                   /protein_id="ACX81607.1"
FT                   /translation="MDIQQRLWIFQTRELIDDHIVETVLNVRRHLQRQWQVDVETEQVK
FT                   MMLVHIASALGRIKRGHCVSPLYAELLLEMKSAVVFPQVLQIHQNVLELIPLDIPEEEQ
FT                   TYFLANVYGLVLDQPHVLARVS"
FT   gene            complement(170676..170752)
FT                   /locus_tag="D11S_0189"
FT   tRNA            complement(170676..170752)
FT                   /locus_tag="D11S_0189"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:170716..170718,aa:Arg,seq:acg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(170807..170883)
FT                   /locus_tag="D11S_0190"
FT   tRNA            complement(170807..170883)
FT                   /locus_tag="D11S_0190"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:170847..170849,aa:Arg,seq:acg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(170901..170994)
FT                   /locus_tag="D11S_0191"
FT   tRNA            complement(170901..170994)
FT                   /locus_tag="D11S_0191"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:170957..170959,aa:Ser,seq:gct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(171120..173135)
FT                   /locus_tag="D11S_0192"
FT   CDS_pept        complement(171120..173135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0192"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="single-stranded DNA-dependent ATPase; initiates
FT                   unwinding at a nick in the DNA; involved in DNA
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81608"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005715557.1"
FT                   /protein_id="ACX81608.1"
FT                   /translation="MKLNPQQQQAVEYVSGPCLVLAGAGSGKTRVIINKIAHLIDKCGY
FT                   FPKQIAAVTFTNKAAREMKERVAQSIGKAQSKGLIVSTFHTLGFDIIKCEYKQLGFKAN
FT                   MTLFDEHDQMALLKELTADVLQEDKGVLRELINRISNWKNDLCSPQQALGLARDNKEQT
FT                   FAHCYDRYNKQLRAYNALDFDDLIMLPTLLFKQNAEVRLKWQEKIRYLLVDEYQDTNTS
FT                   QYELIKLLVGERARFTVVGDDDQSIYSWRGARPQNMVRLRDDFPALRVIKLEQNYRSSQ
FT                   RILHCANILIDNNEHVFDKKLFSNLGEGEKLQIIEAKNEEHEAERVVGELIAHRFIGKT
FT                   HYRDYAILYRGNHQSRLLEKILMQNRIPYKISGGTSFFSRTEIKDMMAYLRLVVNQDDD
FT                   AAFLRIVNTPKREIGTATLEKLGSLAQEKHISLFEAIFDFELLQRVTPKAYDALQKFAR
FT                   WTVELNDEIQRSEPERAVRSMLSSLHYEEYLYEYATSPKAAEMQSKNVATLFDWVAGML
FT                   KGDEFNEPMNLNQIVTRLTLRDMLERGEEENDGDQVQLMTLHASKGLEFPHVFLIGMEE
FT                   GILPHQTSIDEDNVEEERRLTYVGITRAQQNLWFSLCKERRQFGELIRPEPSRFLLELP
FT                   ENDLQWERDKPPLSAEQQQAKTQSHIANLRAILRGK"
FT   gene            complement(173145..173375)
FT                   /locus_tag="D11S_0193"
FT   CDS_pept        complement(173145..173375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81609"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539105.1"
FT                   /protein_id="ACX81609.1"
FT                   /translation="MKFQPVKTLFISTALFAISGCGTVVKLIDPTEPYSAYAGTKYDFD
FT                   MAKRWGLPILDLPLSFLLDTALLPYAWSQSE"
FT   gene            complement(173479..174042)
FT                   /locus_tag="D11S_0194"
FT   CDS_pept        complement(173479..174042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0194"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81610"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557768.1"
FT                   /protein_id="ACX81610.1"
FT                   /translation="MKKLTLLALSAAVLVSTSAVASSDFTGFGIGVGVGTTKYKDAKRI
FT                   SNVDLIADYGIDYGNDFVGIIEGKLKLNKSTLHDNNASGYRGKLNEKARLGVSYLQGYR
FT                   VTPSILPYAKVGVQTAKFESEVRTRNYSATHSDTKNGIGFGAGVKVNLVPDFELSLEYL
FT                   RTHNKFDGQKLRGNVYSTNATYRF"
FT   gene            174259..177060
FT                   /locus_tag="D11S_0195"
FT   CDS_pept        174259..177060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0195"
FT                   /product="DNA polymerase I"
FT                   /note="has 3'-5' exonuclease, 5'-3' exonuclease and
FT                   5'-3'polymerase activities, primarily functions to fill
FT                   gaps during DNA replication and repair"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81611"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567071.1"
FT                   /protein_id="ACX81611.1"
FT                   /translation="MAQIAANPLVLVDGSSYLYRAFHAFPPLTNSAGEPTGAMYGVLNM
FT                   LKSLISQVQPSHIAVVFDAKGKTFRDEMFEQYKSHRPPMPDDLRKQIQPLHDMIRALGI
FT                   PLLVVDGVEADDVIGTLASQASKNGQKVLISTGDKDMAQLVDDNIMLINTMNNSLLDRA
FT                   GVIEKYGIPPELIIDYLALMGDSSDNIPGVAGVGEKTALGLLQGIGSMAQIYANLDKVA
FT                   ELPIRGAKKLGKKLLAEKAMADLSYALATIKTDVMLEFSPHELAIGDSDNDALIAYFGR
FT                   YEFKRWLGEVMNGAGTVTQSAEQPVKINHYQATPAAKIDESAVENAVKFHIDRSRYENI
FT                   LTEADLARWLEKLNAAKLIAVDTETDGLDYMSANLVGVSFALENGEAAYLPLHLDYLGA
FT                   PKTLEKNTALSALKPILENPNIGKIGQNLKFDMTIFARNGIDLQGIEFDTMLLSYTLDS
FT                   TGRHNMDDLAKRYLGHQTISFEDIAGKGKNQLTFNQIPLEQAGEYAAEDADVTMKLQQV
FT                   LWQKLQPQPGLVELYQSIELPLLGVLSRMERYGVLIDSDALFLQSNEITERLTALEMQA
FT                   HTLAGQPFNLASTKQLQEILFDKLGLPVLQKTPKGVPSTNEEVLEELAYSHELPKVLVE
FT                   HRGLSKLKSTYTDKLPQMVNPQTGRVHTSYHQAVTATGRLSSSDPNLQNIPIRNEAGRR
FT                   IRQAFIARDGYKIIAADYSQIELRIMAHLSNDQGLINAFAQGKDIHRSTAAEIFGLPLE
FT                   QVTSEQRRNAKAINFGLIYGMSSFGLSRQLGISRADAQRYMDLYFQRYPNVQTFIHDIR
FT                   EKAKAQGYVETLFGRRLYLPEINSSNAMRRKGAERVAINAPMQGTAADTIKRAMIKLDG
FT                   ITRDDPDIHMIMQVHDELVFEVRSEKIAFFSDLIKQHMEAAAELVVPLIVDVGVGENWD
FT                   EAH"
FT   gene            177075..177197
FT                   /locus_tag="D11S_0196"
FT   CDS_pept        177075..177197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0196"
FT                   /product="oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81612"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548099.1"
FT                   /protein_id="ACX81612.1"
FT                   /translation="MTHKIVRSADFTAAHARGGLDITEINGISVRLHWTDEPYK"
FT   gene            177447..177794
FT                   /locus_tag="D11S_0197"
FT   CDS_pept        177447..177794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0197"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81613"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575561.1"
FT                   /protein_id="ACX81613.1"
FT                   /translation="MSYSYQFRLKIIKPITEQDFSIYKVSKLYKIPHSQVIYWLKAFRE
FT                   RGLDGIKSPYTKPKTSKILKPKMKKTQIEVAETTDFSPQAFKKLKREPALEKAEIDYLK
FT                   KLVELGRSKTN"
FT   gene            complement(177900..179714)
FT                   /locus_tag="D11S_0198"
FT   CDS_pept        complement(177900..179714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0198"
FT                   /product="metallophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81614"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005702434.1"
FT                   /protein_id="ACX81614.1"
FT                   /translation="MFTLKKTLTHILSTTFVFCSTSGLAANPPEDNHKAVELSILHIND
FT                   HHSYLEPHEARILLNGKETKVNIGGFSAVNSKLNELRKKYKNPLVLHAGDAITGTLYFT
FT                   LFGGSADAAVMNAGNFHYFTLGNHEFDAGNEGLLKLLEPLKIPVLSANVIPDKGSILYN
FT                   KWKPYDIFSVNGENIGIIGLDTVNKTVNSSSPGKDVKFYDEIATAQIMANALKAQGVNK
FT                   IILLSHAGSEKNIEIAQKVNDIDIIVTGDSHYLYGNDELRELKLPVVYEYPLEFKSPNG
FT                   EPVFVMEAWAYSAVVGDLGVKFSKDGIASIIRKTPHVLMSTNKLKVKNSDGNWQELSGE
FT                   ERQKAIQSLQKMKSISLDYHDKKTDKLISKYRYEKDQLAKEVIGSIVGQAMPGGSDNRI
FT                   PNKAGSNPEGSVATRFVAETMYNELKNVDLVIQNAGGVRSDILPGDVTFNDAYTFLPFG
FT                   NTLFTYKMEGSLIKQALEDALQFALVDGSTGGFPYGAGVRYEANETPNADGKRLVSVEV
FT                   FNKQTQQWEDIDDNKRYLVGTNSYIASGKDGYKTFGHLFNDPKYEGTDTYLPDAESFIK
FT                   FMKKNPRFEAFKTSNVKLNVVSEALPKK"
FT   gene            complement(179741..180517)
FT                   /locus_tag="D11S_0199"
FT   CDS_pept        complement(179741..180517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81615"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538480.1"
FT                   /protein_id="ACX81615.1"
FT                   /translation="MKKKIHSVLFLLTYFFSIQGQTMQNIEHTGQNRSNQSIQDVKQQL
FT                   AAALARQEQKQIIVLQKKLTSLSSLSPQRLAQQIRTTEKILTRIFKTEKNLTPKFIDYL
FT                   YFEPIETADDTLMQEMKKNLLISFLANERAQIYIKDMPNANQFVQLLTEKGAKTTQISV
FT                   LAEPAKTIFQRIREQMYQDFPNKKQFTITENRVSVIAPSSVIKPRLALAAAIFDQQFKG
FT                   VEVDDFSYLDQPRENLQHNNDTTRYKTFQAMLEGLE"
FT   gene            180796..181722
FT                   /gene="rfaD"
FT                   /locus_tag="D11S_0201"
FT   CDS_pept        180796..181722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="D11S_0201"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="catalyzes the interconversion between
FT                   ADP-D-glycero-beta-D-manno-heptose and
FT                   ADP-L-glycero-beta-D-manno-heptose"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81617"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704865.1"
FT                   /protein_id="ACX81617.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNDMGCKDILVVDNLKDGTKFINLVDL
FT                   DIADYCDKEDFIASIIAGDDLGDIDAVFHEGACSATTEWDGKYIMHNNYEYSKELLHYC
FT                   LDRQIPFLYASSAATYGDKTEFREEREFEGPLNVYGYSKFLFDQYVRAILPEAQSPVCG
FT                   FRYFNVYGPREGHKGSMASVAFHLNNQIVKGENPKLFAGSEHFHRDFVYVGDVAAINIW
FT                   CWQNKVSGIFNCGTGNAESFAEVAKAVIKFHNKGEVETIPFPEHLKSRYQEYTQADLTK
FT                   LRATGYDKPFKTVAEGVAEYMAWLNRK"
FT   gene            181892..183019
FT                   /locus_tag="D11S_0202"
FT   CDS_pept        181892..183019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0202"
FT                   /product="cell division protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81618"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538488.1"
FT                   /protein_id="ACX81618.1"
FT                   /translation="MEQQYIWQKVNWRQWEYDLPQLLPLLNQAHYQQGLLLGRLLDIGL
FT                   GEREQICLQALTNSVLKSSEIEGEMLNAQSVRSSLARRLGVNIGGLTATDRAVEGVVEM
FT                   TLNATEQFDSPLTLERLFGWHAALFPSGYSGMVRIRTAQLRDDNNGAMQVISGRIGRQK
FT                   IHFQAPPAEQLEKELMLFLTWLNDSNQLLDPFIKTGIAHLWFLTLHPFEDGNGRIARAI
FT                   ADYLLAKADRNPQRFYSLSAQIQKERSSYYVILEQTQKGETNLTQWLMWFLACLINAMK
FT                   QAQETLDKVLLKTRYWQSWHRFSLNERQIKVLNLMLDGFEGKLGNKKYAALTKVSRDTA
FT                   LRDLTDLVAKNILKRAEEGGRSIHYELTPPDLSQV"
FT   gene            183039..184082
FT                   /locus_tag="D11S_0203"
FT   CDS_pept        183039..184082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0203"
FT                   /product="ADP-heptose--LPS heptosyltransferase"
FT                   /note="catalyzes the transfer of the second heptose to the
FT                   heptosyl-KDO2 moiety of the lipopolysaccharide inner core"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81619"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575868.1"
FT                   /protein_id="ACX81619.1"
FT                   /translation="MNILIIGPSWVGDMMMSHSLYQQLKLQYPHCHIDVIAPNWCKPLL
FT                   ARMPEVRNAIEMPLGHGKFALCERYRLGKALRNQYDMAIVLPNSLKSAFIPLFAKIAVR
FT                   RGWKGESRYWLLNDLRHNKRDYPMMVQRYVALAFEKNAVPKAVEIPVLKPYLTVEPSRQ
FT                   AATLKTFEKPTALLGRRPIVGFCPGAEFGPAKRWPHYHYAELARMLIEKGYAVELFGSP
FT                   KDVDAGEQIRNALPVELQPFCLNLAGQTNLNQAVDLIANCTAVVSNDSGLMHIAAATDR
FT                   PLVALYGPTSPAYTPPLSDNAEIIRLIEGDLIKVRKSADSTEGYHQSLIDITPQLVFEK
FT                   LMGLLNQ"
FT   gene            184200..186095
FT                   /locus_tag="D11S_0204"
FT   CDS_pept        184200..186095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0204"
FT                   /product="glutathionylspermidine synthase"
FT                   /EC_number="3.5.1.78"
FT                   /EC_number="6.3.1.8"
FT                   /note="catalyzes the formation of glutathionylspermidine
FT                   from glutathione and spermidine; also catalyzes the reverse
FT                   reaction"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81620"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548082.1"
FT                   /protein_id="ACX81620.1"
FT                   /translation="MPDRSPNITTHDPFGSLLGYAPGGVAIYSSDYNTADAQEYPDDAA
FT                   FRSYLGGEYMGYKWQCVEFARRYLYLNYGMVFTDVGMAYEIFSLRFLRQVVNDALLPLQ
FT                   AFANGGKRAPECGALLIWQEGGEFKHTGHVAVITEVLADKVRIAEQNVIHSRLPSGQQW
FT                   TRELPMTVTAGRYRLQDTFDDTEILGWMIQTDNEEFSLPQPMPAPEKLTIHAEHIENQG
FT                   QFAANWLNEDNPLEAAYVKAMKGHIVNHGDQYRYFALSESAQHELIRATNELHLMYLHA
FT                   TDKVLKDDKLLQYFNIPKLLWPRLRLSWQNRRYQTITGRMDFCLDERGLKVYEYNTDSA
FT                   SCHAEAGAILPHWAALAGLTLRHDPGEGLRNALADTWKHSHATPLVHIMQDHDAEEEYH
FT                   ALFMRDTLTQAGFNTKIIHGTEGLHWDTRGQLLDDENQRVQSVWKTWAWETVLEQLRED
FT                   ATGREVAPPIRTGYPEDKVRLIDVLLRPEVLVYEPLWTAIPSNKAILPVLWSLFPNHRY
FT                   LLEAGFELTPKLIANGYAQKPIAGRRGDNVKLIGECKTVLDSTNGCFAKQENIYQQLWC
FT                   LPKVEDQYVQVCTFTVGGHYAGSCLRSDPTRVIVGDSDMQPLRILSDKVFTQKAK"
FT   gene            complement(186181..186816)
FT                   /locus_tag="D11S_0205"
FT   CDS_pept        complement(186181..186816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0205"
FT                   /product="cytochrome C"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81621"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548080.1"
FT                   /protein_id="ACX81621.1"
FT                   /translation="MSAKKPNILVRFWRWFRSPSRIAVGTIIVLSFIGGILSWVGFNYG
FT                   LEQTNTEQFCAGCHMNDAYPEYLHSVHYQTRTGVSASCPDCHVPHEFGPKMWRKMVAAK
FT                   EVYAHYMGLTDTLEKFNARRPHMAENEWERMKANDSQECRNCHKMDRMDFSQQKTVAQR
FT                   MHKFAQENGKTCIDCHKGIAHELPDMSRVAPGWLQDTEVKPAEEQGKK"
FT   gene            complement(186830..187279)
FT                   /locus_tag="D11S_0206"
FT   CDS_pept        complement(186830..187279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0206"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81622"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548078.1"
FT                   /protein_id="ACX81622.1"
FT                   /translation="MIRNNVFAFSGALFTALFATSVMAQQPTEGAGDFFHNSPESVSPA
FT                   FHDAPKQSELPALNYVNQPPMVPHSVKNYQVTKNVNQCLNCHSVEASRVTGATRISPTH
FT                   FMDRDGNLGSSSSPRRYFCLQCHVSQSDVEPIVPNEFKPMKGYGQ"
FT   gene            complement(187317..188198)
FT                   /gene="napH"
FT                   /locus_tag="D11S_0207"
FT   CDS_pept        complement(187317..188198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napH"
FT                   /locus_tag="D11S_0207"
FT                   /product="quinol dehydrogenase"
FT                   /note="part of NapHG quinol dehydrogenase; couples electron
FT                   transfer from ubiquinone-ubiquinol couple via NapC/B to
FT                   NapA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81623"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575576.1"
FT                   /protein_id="ACX81623.1"
FT                   /translation="MANSPKFAGKEAREKLGWWHAYRFLFWRRLTQFGILMMFLSGPYF
FT                   GVWILKGNYSGSLLFDVIPLSDPLITLESLSTRHLPGTLTLIGALIIFTLYALLGSKVF
FT                   CGWVCPLNVVTDCAAWIRRKLGIRQTAKIPRGLRYAILLMILVGSAVSGLLLWEWINPV
FT                   AALGRALIYSFGATAWLILAVFLFDLFIVEHGWCGHLCPIGATYGVIGVKSLIRIKVID
FT                   RARCDNCMDCYNVCPEPQVLRSPLHGKNNESLLVLSQDCISCGRCIDVCAENVLTFSHR
FT                   FNNDIPIVTLNQ"
FT   gene            complement(188198..189013)
FT                   /locus_tag="D11S_0208"
FT   CDS_pept        complement(188198..189013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0208"
FT                   /product="quinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81624"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557753.1"
FT                   /protein_id="ACX81624.2"
FT                   /translation="MQKPTVTPERRKFLKDATRTAGGLVGLGLLLGLQQKQSLAREGVA
FT                   LRPPFAIESDEKFASACIRCGQCVQACPYDMLHLASLLSPMEAGTPYFIARDKPCEMCP
FT                   DIPCAHACPSGALDREAQDINQSRMGLAVLLDHETCLNWQGLRCDVCYRVCPLIDKAIT
FT                   LESHRNERTGKHAVFIPTVHSDGCTGCGKCEQACVLEEAAIKVLPMHLAKGMLGKHYRL
FT                   GWEEKAKAGHSLAPKDLISMPTRMPEATMPVMGAEDIPEPILAPTLGGK"
FT   gene            complement(189085..191571)
FT                   /locus_tag="D11S_0209"
FT   CDS_pept        complement(189085..191571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0209"
FT                   /product="nitrate reductase"
FT                   /note="periplasmic; catalytic subunit; with NapBC catalyzes
FT                   the reduction of nitrate to nitrite; NapAB receives
FT                   electrons from NapC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81625"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q8VL02.1"
FT                   /protein_id="ACX81625.1"
FT                   /translation="MNLSRRDFMKANAAMAAATAAGLSIPVKNVEAAESEIKWDKAVCR
FT                   FCGTGCAVLVGTKDGRVVASQGDPDAEVNRGLNCIKGYFLPKIMYGKDRLTQPMLRMKD
FT                   GKYDKNGDFTPVSWDVAFKTMAEKFKAAVKELGPNGVGMFSSGQTTIFEGYAKSKLWKA
FT                   GFRSNNIDPNARHCMASAAVAFMRTFGMDEPMGCYDDIEQAEAFVLWGSNMAEMHPILW
FT                   SRITDRRLSNQDVKVAVLSTFEHRSFELADYSLIFKPHTDLVILNYIINYLIQNDAINR
FT                   DFVNKHTKFKRGETDIGYGLRPENPLEQKAKNVKTAGKMYDSNFDELKALVAEYTLDKA
FT                   HEMSGVPKDVLENLAKLYADPKKKVVSYWTMGFNQHTRGVWANHLIYNIHLLTGKISIP
FT                   GCGPFSLTGQPSACGTAREVGTFIHRLPADLVVTNPKHREKAEQIWKLPAGVITDVLGF
FT                   HAVAQSRALKDGKMRVLWQMCTNNMQGGPNINRETFPGWRNPDNFIVVSDPYPTVSCLA
FT                   ADLMLPTAMWVEKEGAYGNAERRTQFWRQQVKAPGEAKSDVWQLVEFSKYFTTDEMWPA
FT                   EILDKNPEYKGKTLYDVLYRNGQIDKFPLSELAEGQLNDESYHFGFYLQKGLFEEYASF
FT                   GRGHGHDLASFDTYHKARGLRWPVVDGKETLWRYREGYDPYVKEGEGVAFYGYPDKKAI
FT                   ILAVPYEPPAESPDEEYDLWLCTGRVLEHWHTGTMTRRVPELHRSFPNNLVWMHPTDAQ
FT                   KRGLRHGDKVKVASRRGEIISFLDTRGRNKVPEGLIYTTFFDAGQLANKLTLDATDPIS
FT                   KETDFKKCAVKVEKAA"
FT   gene            complement(191605..191889)
FT                   /locus_tag="D11S_0210"
FT   CDS_pept        complement(191605..191889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0210"
FT                   /product="nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81626"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012771904.1"
FT                   /protein_id="ACX81626.1"
FT                   /translation="MNKTDILTMEDAKDWHIVGLVVQGKPQKITAIRTALLAIPHTEIP
FT                   TFNENIGKIVAVMQSHDPHVLLKNMESVKEIDGVITVSLIYHQQDEQPE"
FT   gene            192166..193869
FT                   /locus_tag="D11S_0212"
FT   CDS_pept        192166..193869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0212"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81628"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167498.1"
FT                   /protein_id="ACX81628.1"
FT                   /translation="MKIKHSVSTRIANYLIVIIIFVGIIGALSLALMAGNKSYAEAINV
FT                   SGSLRMQSYRILYEIEHEPQMVESSLRQYRVSLHSKSLVEINYQSFASQDVKDSYHNLI
FT                   KRWEVMERLAREQNFTEYQKNIANYVEQVDQFVFTLQHSAEEKWIWALCVIIFSMLLIV
FT                   IMVSYVNWYTRKAVVRPLEQLTRASTQVQMGQFKHIPLDVRKEDELGHLARTFTKMSSE
FT                   LGKLYSGLEATVNEKTQKLQQTNRSLTTLYHCSQLVTTNKIDGKILQLVLQNVMISEHL
FT                   RYLELDVLDAPHWNICLGVKYDQLESQQTEMNIEGESLAVLRWQAGLPCPDLRTMQNVA
FT                   QMLSRSLYFQRMQRQQEQLLLMEERSIIARELHDSLAQVLAFLQIQLTLLKHNLNKGET
FT                   DSKQKSLSIIKQFEQALSDGYSQLRELLATFRLTVQEANLKLALEQVIDSLRNQTDIQM
FT                   SVDCTLPSQSFNAQQLVNALQIVREAVLNAIKHSQGTLIEVIAHTNEDGEYELVVRDNG
FT                   IGIPSLEEPDGHYGLNIMHERSIQLNAKLTIANRTDGGTEVKVTLAHTLA"
FT   gene            193884..194909
FT                   /gene="murB"
FT                   /locus_tag="D11S_0213"
FT   CDS_pept        193884..194909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="D11S_0213"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="catalyzes the reduction of UDP-N-acetylglucosamine
FT                   enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81629"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541968.1"
FT                   /protein_id="ACX81629.1"
FT                   /translation="MQNLQPFHTFSIPAQAQKLIEITSVPQLKQVWDEFQRENLPVLFL
FT                   GQGSNVLFVEDFAGAVLINRLRGIAHKEDDRFHYLHVNGGEVWHDLVQWSIAQGIYGLE
FT                   NLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEVLDLTSAEQFRLSCEECEFGYRESVFK
FT                   HKYAHGYVVTAVGLKLAKDWKPVLKYGNLANLDKSAVSSADVFAEVCAVRQSKLPDPKQ
FT                   FGNAGSFFKNPVVSAQQFARLKEDYPAIPHFPQADGSVKLAAGWLIDQCGLKGYQIGGA
FT                   AVHQQQALVIINKGNATASDVVELAHHIYQLVALRFDVRLQPEVRFIGKQGEVNSQQTI
FT                   S"
FT   gene            194925..195239
FT                   /locus_tag="D11S_0214"
FT   CDS_pept        194925..195239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0214"
FT                   /product="RNA polymerase subunit sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81630"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005553397.1"
FT                   /protein_id="ACX81630.1"
FT                   /translation="MNFNEILATLPAIDHLSGIHILHNGTLVHEIPAVAGKLGSLRVYN
FT                   ALAVKFNRKLDRTSAQKGLQLFAEYTEDAHKHPGKHPNIDLLLRVIEQDLTYQIKPLTE
FT                   "
FT   gene            195424..196272
FT                   /locus_tag="D11S_0215"
FT   CDS_pept        195424..196272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0215"
FT                   /product="RNA polymerase factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81631"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578417.1"
FT                   /protein_id="ACX81631.1"
FT                   /translation="MDKETQTMMLVPQGSIEAYIRAANEYPMLTAEEEKELAERLYYKE
FT                   DIEAAKKLVLSHLRFVIHVARGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNENEVDMVANELGV
FT                   SPQDVMEMESRMTGADVAFDLPGDEHDEETYAPALYLEDKSSNFAAELENENYEAQATD
FT                   QLAVALDNLDARSQDIIKARWLDETKATLQDLAAKYNISAERVRQLETNALKKLKSAVV
FT                   F"
FT   gene            complement(196339..196974)
FT                   /locus_tag="D11S_0216"
FT   CDS_pept        complement(196339..196974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0216"
FT                   /product="DNA transformation protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81632"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005594855.1"
FT                   /protein_id="ACX81632.1"
FT                   /translation="MTTVSQRLKNEFKQLVDGEISIKNLFTGHGIFHSGIMFALHQNDS
FT                   IFLRAEDELVPYLESLGAVAYSIDPNNTNKLALHRYYQLPHSIRKNKPLFEKTVKLSIQ
FT                   QAKFKKVAEDLTKKERIKELANFSIKHERLLAKINIYTVSEFQKIGAIHSYVRLKKLGV
FT                   SANVELLWTLCAALKNKHASLLTEKEKSAILTKLNVLLAANGLRKVKA"
FT   gene            complement(198261..199439)
FT                   /pseudo
FT                   /gene="tuf"
FT                   /locus_tag="D11S_02270"
FT                   /note="elongation factor Tu; disrupted"
FT   gene            complement(199503..201605)
FT                   /gene="fusA"
FT                   /locus_tag="D11S_0220"
FT   CDS_pept        complement(199503..201605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="D11S_0220"
FT                   /product="elongation factor G"
FT                   /note="EF-G; promotes GTP-dependent translocation of the
FT                   ribosome during translation; many organisms have multiple
FT                   copies of this gene"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81636"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005565478.1"
FT                   /protein_id="ACX81636.1"
FT                   /translation="MARTTPIERYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWSGMSQQFPQHRINVIDTPGHVDFTVEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYEVPRIAFVNKMDRTGANFLRVVDQLKTRLG
FT                   ANAVPLQLPTGSEENFTGVVDLIKMKAINWNEADQGMTFTYEDVPADMHAACEEWRQNL
FT                   IEAAAEASEELMEKYLGGEELTEEEIKAGLRQRVLANEIILVTCGSAFKNKGVQAMLDA
FT                   VVEYLPAPTDIPAIKGINPDETEGERHASDEEPFSSLAFKIATDPFVGNLTFFRVYSGV
FT                   INSGDTVLNSVRQKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCAIE
FT                   APIILERMEFPEPVISVAVEPKTKADQEKMGIALGRLAQEDPSFRVHTDEESGETIISG
FT                   MGELHLDIIVDRMKREFKVEANIGKPQVSYRETIRTRVNDVEGKHAKQSGGRGQYGHVV
FT                   IDLYPLEPEGPGYEFVNEIKGGVIPGEYIPAVDKGIQEQLKSGPLAGYPVVDIGVRLHF
FT                   GSYHDVDSSELAFKLAASLAFKAAFAKANPVLLEPIMKVEVETPPEYVGDVIGDLSRRR
FT                   AMVNGQEANEFVVKIDAEVPLSEMFGYATDLRSQTQGRASYSMEPLKYAEAPKNVAEAV
FT                   IEARKK"
FT   gene            complement(201720..202190)
FT                   /locus_tag="D11S_0221"
FT   CDS_pept        complement(201720..202190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0221"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81637"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001742319.1"
FT                   /protein_id="ACX81637.1"
FT                   /translation="MPRRRSIEQRKILPDPKFGSELLAKFINVIMVDGKKSIAESIVYN
FT                   ALDTLAQRTGKEALEAFEAALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWI
FT                   VEAARKRGDKSMALRLANELSDASENKGAAVKKREDVHRMAEANKAFAHYRW"
FT   gene            complement(202343..202717)
FT                   /locus_tag="D11S_02275"
FT   CDS_pept        complement(202343..202717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02275"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02275"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A0KQ98.1"
FT                   /protein_id="ANN81526.1"
FT                   /translation="MATINQLVRKPRVKKVVKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVKDRKQGRSKYGVKRPKA"
FT   gene            complement(202945..203253)
FT                   /locus_tag="D11S_0224"
FT   CDS_pept        complement(202945..203253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0224"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81640"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548671.1"
FT                   /protein_id="ACX81640.2"
FT                   /translation="MNCLSNSAKLRAFELAEQIKEKLAFLFAKHMNDIISGEFSRVMIE
FT                   DWAKGDANLLKWREETGKTAFENAPKYGGKISEQEYFDNGELMVAMVKDMKRISLQG"
FT   gene            203885..204070
FT                   /locus_tag="D11S_0225"
FT   CDS_pept        203885..204070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0225"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81641"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548669.1"
FT                   /protein_id="ACX81641.1"
FT                   /translation="MMAPGCGLALLPDVVMKNSPLNNQISTLQLDVPIAPFELGVCALK
FT                   PALERPLVRAFWDLLE"
FT   gene            204103..204984
FT                   /locus_tag="D11S_0226"
FT   CDS_pept        204103..204984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0226"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81642"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005565484.1"
FT                   /protein_id="ACX81642.1"
FT                   /translation="MLKGIAFSLFASLLFGYMYYFSTLLLPLSGTDIFGYRIVFTLPFV
FT                   AAAVVLFKQQAALVAHLKRIQKKPHFALAFVFTGALIGFQMWLFLWAPNNGSSLSVSFG
FT                   YLLLPLVMVAAARLIFKERISRIKFLAVVIAAVGVLSNIVLKGEISWEASVICVGYTTY
FT                   FVVRRILKMTDLAAFFLEMLTLLPFCVYFSWQVDIAQVQQSNPNILTLLLILGLISGTA
FT                   LNSYILASNHLPMNLLGLLGYVEPCLMVGISLLIGEEIDAQSYPLFICLVIAMLLIIAD
FT                   GVWRTKHSPTRL"
FT   gene            complement(204979..205779)
FT                   /locus_tag="D11S_0227"
FT   CDS_pept        complement(204979..205779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0227"
FT                   /product="shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81643"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548665.1"
FT                   /protein_id="ACX81643.1"
FT                   /translation="MLYAVWGNPIVQSKSPQIHSIFAEQTTQDVQYDAMLGDEQDFERQ
FT                   LLAFFAKGAAGCNITSPFKERAFKLAQAHSERCLLAEACNTLKKRDDGSLYADNTDGAG
FT                   LVTDLQRLHWLKPNQTLLILGAGGATKGVLLPLLQAQQNIVIANRTLSKAQQLADKFAP
FT                   YGNVRAVALDKIPAQSFDVVINATSSGLHGGTVQIDDAILRMAKAVYDMQYDRQQDTPF
FT                   LARCRALGVQNRCDGFGMLLAQAAHSFYLWRGVMPNIEPLFEAL"
FT   gene            complement(205783..206334)
FT                   /locus_tag="D11S_0228"
FT   CDS_pept        complement(205783..206334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0228"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein RimN"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81644"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578430.1"
FT                   /protein_id="ACX81644.1"
FT                   /translation="MNLQDIVEQLKRQRVVAYPTEAVFGLGCNPNSQSAVENLLVLKQR
FT                   PVSKGLILIATALDFLLPFIDERPLAELHWQRLTAQYARPTTWVVPAKKTTPKFLTGDF
FT                   DSIAVRISQHPAVKLLCEQAGFALTSTSANLSGQPPCRTAQEVTRQFGADFPVLEMPVG
FT                   DAVNPSEIRDIFTNQIFRQG"
FT   gene            complement(206339..206887)
FT                   /locus_tag="D11S_0229"
FT   CDS_pept        complement(206339..206887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81645"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548661.1"
FT                   /protein_id="ACX81645.1"
FT                   /translation="MREPLFQATKQEEHCPQCGALLQIKQGKKGLFLGCSAYPQCDYLK
FT                   PLHAGNEVKILKMLEQSCPECGHLLALKQGHFGMFIGCSNYPDCHFVVHEDAEEETEEH
FT                   LPCPECKAGQLVARRGRTGKSFYACNRFPHCKFSVPSKPYAVRCPQCHGSLALLKKQQD
FT                   GQRTWQCANKACRHIFMTE"
FT   gene            207031..208644
FT                   /locus_tag="D11S_0230"
FT   CDS_pept        207031..208644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0230"
FT                   /product="recombinase RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81646"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167502.1"
FT                   /protein_id="ACX81646.2"
FT                   /translation="MFALDIDLNMLLGICAALGVLCLILLFVGARRKRDSVELQQDLNK
FT                   NIEDFNQLLAKFDAVTARKNQLEQEVVKAQTMADGLQIRLTERDEKVLYLQTELNEEQA
FT                   CHSAIAEQITALKERFGVASAQAEGLRSQLEQSQSLISRREEALANLTEKHTALSQELA
FT                   ELKTTLTEKEKHFAEQQQNFEQTKQQLNTEFQNLANRILEEKSQRFQQTNQASMDSLLK
FT                   PFREQIESFQKRVNEIHSESVKGNAGLEAEIKKVLEIGLSMSQQANNLTSALKGEKKTL
FT                   GNWGEMQLERALQSAGLLEDQHYTAQAHFKNEEGKRNYPDFILNLPDDKHLIIDSKMSL
FT                   NAYESAVSSEDEMERQAFLHEHIKALRNHIDDLSRKDYSNLIGVRSPNFVLMFVAVEPA
FT                   YIEALKMDPSLFGYGYDKNVIMVSHTTLMPILRTVANLWRVERGNAEAREISEKAGDIY
FT                   NQICLLAERLAKVGNSLSAVSSHYNSTVTALVGQQGLMGKVERFKALSAKASKTLPNIE
FT                   PLHHDFETERLLVTKENLEE"
FT   gene            208796..209317
FT                   /locus_tag="D11S_0231"
FT   CDS_pept        208796..209317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0231"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81647"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585997.1"
FT                   /protein_id="ACX81647.2"
FT                   /translation="MKPRYEPAAISKIIFASRWLQLPIYLGLIIVQGIYAYKFMKSLWH
FT                   LIVNLQEMDSNTVMLAVLNLIDVVMIANLLVMVIISGYEIFVSKLRTRGHPDQPEWLSH
FT                   VNASVLKVKLAMSIISISSIHMLQTFVNASNMDEKTMMWQLFLHLGFLASAIAMAYTDK
FT                   ILYGTSHKAH"
FT   gene            209329..209655
FT                   /locus_tag="D11S_0232"
FT   CDS_pept        209329..209655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0232"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81648"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005543206.1"
FT                   /protein_id="ACX81648.1"
FT                   /translation="MTEFIEISPQQAWEMLQQDENAVLADVRDQVRFNYSHAQGAVNLT
FT                   ELTWPDFEAEYDYEQPILVSCYHGVSSRSVAMFLLQRGYEKVYSVRGGFTGWVEANLPL
FT                   ETAY"
FT   gene            complement(209667..210032)
FT                   /locus_tag="D11S_0233"
FT   CDS_pept        complement(209667..210032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81649"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566429.1"
FT                   /protein_id="ACX81649.2"
FT                   /translation="MLHLLYSFSKNLMYGEKMRNPNLPSGFSPFSWAIAMFCLPVLLWP
FT                   LALLISPNLLKNPNLSDTQIHAMSIFLWGYPFALGIIARIFYKLHERKAALARRGLAIS
FT                   AVIFYGVLSYVAVVGFN"
FT   gene            210024..210899
FT                   /locus_tag="D11S_0234"
FT   CDS_pept        210024..210899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0234"
FT                   /product="GlpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81650"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578439.1"
FT                   /protein_id="ACX81650.1"
FT                   /translation="MQHLFGSEIPALVSHFREHIRTKYQVELVIEEKTNEQGEPIYHVF
FT                   LPQNAPHFEAIVQECDGFLQEWLKRQNAQAWQNGASPVRVRAVSASDEMPPVNRISLVT
FT                   YLQPRKITVIVTALCALIYLFMLFGFAEPIVLFSHFPDEADQYGEIWRYFSHTLVHLSN
FT                   MHILFNLTWWWIFGGAIERRLGSFKLLQIYFLAGAVGGIAQNMVSGPAFFGLSGVVYAV
FT                   LGYVFVLDKLNKHTDFDVPEGFFNMLVVGILLGFAGPLVDINIGNTAHISGLLVGVLLA
FT                   FADRNIRVKS"
FT   gene            210961..211716
FT                   /locus_tag="D11S_0235"
FT   CDS_pept        210961..211716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0235"
FT                   /product="transcriptional regulator"
FT                   /note="represses the glpD, glpFK, glpTQ, and glpACB operons
FT                   involved in glycerol-3-phosphate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81651"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005565491.1"
FT                   /protein_id="ACX81651.1"
FT                   /translation="MRQSLRHQKIVELVKQKGYLSTDELVALFDVSPQTIRRDLNELAE
FT                   ANFIRRHHGGAASPSSAENSDYHDRKHFFSQEKNRIAKQAVELIPNGASLFIDIGTTSE
FT                   AVSFALLGHQRLRIVTNNLNAAHILMQNDSFDITIASGSLRQDGGIIGESTVEFLSQFR
FT                   LDFGVLGISAIDLDGTLLDYDYHEVQVKRAIIDNSRNTLLVTDHSKFSRRAMVKLGSIT
FT                   DVEYVFTDMDVPPSIDELLKNKNVNLVVC"
FT   gene            212059..214785
FT                   /pseudo
FT                   /locus_tag="D11S_02280"
FT                   /note="TonB-dependent receptor; disrupted"
FT   gene            complement(215375..217192)
FT                   /locus_tag="D11S_0238"
FT   CDS_pept        complement(215375..217192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0238"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81654"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005595515.1"
FT                   /protein_id="ACX81654.1"
FT                   /translation="MNRTFLLSDYMMDHTQEIITSLLWIAKTLAITAVVFSFSIFLLVH
FT                   LTSWGKQFWMFAGGYLSPKRSIKPLLFFTLIVTLTLFSVRLSLVYSTWYNNLYTSLQEF
FT                   NEPVFWNQMILFGFIAGFSVLSALISYYVSQRFSINWIEWLNSEMVEKWMSNRAYYKSQ
FT                   YTGHNLDNPDQRIQQDVQAYVKTTLSLSTGVINAVTSMISYTILLWGLAGPMSVLGVKI
FT                   PHMMVFLVFAYVIFTTLIAFWLGKPLIRLNFANEKLNANYRYSLIRVKEYAESIAFYTG
FT                   EKVEKSHLYKQFRSVIGNMWGIVFRTLKFSGFNLVVSQISVVFPLLIQVGRYFEKQIKL
FT                   GDLMQTLQVFGQLHSNLSFFRNTYDNFAEYKATLDRLTGFKYSVEAAQKESKTHISDHP
FT                   SDVIFQHLSVKSPLGKTLIKDLNLTLPQGHSLLIQGQSGVGKTTLLRTVAGLWLYAQGE
FT                   VFCPQHNTLFLSQRPYLPQGDLLTALYYPSSIEKADLTEVSKVLKQVQLAHLQDRLAQE
FT                   QDWSRILSLGEQQRLAFARLLLHKPQVAFLDEATASLDEGLENAMYRLIRHTLPNTTII
FT                   SVGHRSALVPLHQQRLELQADGSWILTTG"
FT   gene            217316..218974
FT                   /locus_tag="D11S_0239"
FT   CDS_pept        217316..218974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0239"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81655"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549648.1"
FT                   /protein_id="ACX81655.1"
FT                   /translation="MSDIAITTSLLALVAVIGLWIGHWKIKGVGFGVGGVLFGGIIVAH
FT                   FTNEYGLKLDMHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRRSGLKLNGFAFLIVLLG
FT                   GLTVVVIHKFAGVPLDIILGIYSGAVTNTPSLGAGQQILSELGFADANTTMGTAYAMAY
FT                   PFGICGILLCMWLIRLAFKVKVDDEERNFQHESGQDKESLGSINVKVTNKNLDGLRLAD
FT                   IPGFESHDVVCSRLKRGDDISVPKADTEIFPDDVLHLVGETPALKKMRLVIGEELDLPI
FT                   SNISGEIRAERVVVTSEKVLGKKIKSLGIHQKYGVVISRLNRAGVELVPTANTSLQFGD
FT                   VLHMVGRTDVLNNAISVIGNAEQKLQQVQMLPVFIGIGLGVLLGSIPFYIPGFPVALKL
FT                   GLAGGPLVVALILARIGSVGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFLDTLL
FT                   NGSGLEWMGYGVIITLVPLLITGIVARLYSKLNYLSLCGVLAGSMTDPPALAFANAIKE
FT                   ESGAAALSYATVYPLAMFLRIISPQLLALLLWSFA"
FT   gene            219131..219844
FT                   /locus_tag="D11S_0241"
FT   CDS_pept        219131..219844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0241"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81657"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005702312.1"
FT                   /protein_id="ACX81657.1"
FT                   /translation="MSQPIYKRILLKLSGEALQGDEEFGIDPSILDRMALEIKELVEMD
FT                   VEVGVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSA
FT                   FQLNGICDTYNWSEAIKMLREKRVVIFSAGTGSPFFTTDSAACLRGIEIEADVVLKATK
FT                   VDGVYDCDPAKNTNAKLYKNLTYAEVIDKELKVMDLAAFTLARDHGIPIRVFNMGKPGA
FT                   LRQVILDTDVGTTIC"
FT   gene            220069..220626
FT                   /locus_tag="D11S_0243"
FT   CDS_pept        220069..220626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0243"
FT                   /product="ribosome-recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81659"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548637.1"
FT                   /protein_id="ACX81659.1"
FT                   /translation="MIKQIKQDAEDRMEKSLDALKGHIAKIRTGRAQPSLLDAIQVDYY
FT                   GSATPLRQLANVVAEDARTLAVTVFDRSLIQAVEKAILTSDLGLNPSSAGTTIRVPLPP
FT                   LTEERRRELIKIVKAEGEQGKVAIRNVRRDANDKIKALLKDKEISENDQHKAEEVIQKL
FT                   TDSFIKKVDDVLADKEKELLDF"
FT   gene            220655..221938
FT                   /locus_tag="D11S_0244"
FT   CDS_pept        220655..221938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0244"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="catalyzes the formation of 2-C-methyl-D-erythritol
FT                   4-phosphate from 1-deoxy-D-xylulose-5-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81660"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005553199.1"
FT                   /protein_id="ACX81660.1"
FT                   /translation="MAYCVFSYAGAFILLPDNSAKCGQNFMQNKQKVVILGATGSIGNS
FT                   ALSVIEHNPENYEAFALVGGSNATAMFEKCLKFRPHFVALADEYAAKVLREKLTAHQIP
FT                   TQVLAGQQAICELSAHPDADMVMAAIVGAAGLLPTLSAVKAGKKVLLANKEALVTCGQI
FT                   FIDAVKQHGAQLLPVDSEHNAIFQSLPPQAQQQIGFCPLADLGISKIVLTGSGGPFRYT
FT                   ALSEFDGITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFNVSADEMEVIIHP
FT                   QSIIHSMVRYIDGSVIAQMGNPDMRTPIAETMAYPHRTFSGVAPLDFYQLNGLTFLAPD
FT                   YQRYPCLKLAIEAFAAGQYATTAMNAANEIAVQAFLDRQIKFTDIAKLNQAVVEQIAPQ
FT                   QIKQIDDVLDVDRAARECARKQLAHWSH"
FT   gene            221960..222679
FT                   /locus_tag="D11S_0245"
FT   CDS_pept        221960..222679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0245"
FT                   /product="UDP pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81661"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589946.1"
FT                   /protein_id="ACX81661.1"
FT                   /translation="MTELDPNNIPQHVAIIMDGNGRWAKQQGKMRIFGHKNGVAAVREA
FT                   VSYARKIGVKYLTLYAFSSENWNRPEQEVSALMNLFMQALDFELKKLHKNNIRLKILGN
FT                   VARFSEGLQEKIKNAEKLTENNTALTLNIAANYGGRWDIVQAAQQLAQKVQTQQLAVTE
FT                   IDEALLQQHLVTQDDPEVDLLIRTSGEQRISNFLLWQAAYAEFYFSDVLWPDFNEAEFH
FT                   QAILSYQQRHRRFGGTE"
FT   gene            222694..223563
FT                   /locus_tag="D11S_0246"
FT   CDS_pept        222694..223563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0246"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81662"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540406.1"
FT                   /protein_id="ACX81662.1"
FT                   /translation="MLKQRVLSAIVLIAIVFATLFLFSPYYFALALGVVVVLGIWEWTQ
FT                   FFNFKQPTFWRYATTVLSAVFLFLWIYDEGNYLDAGRVFEHYAQPILLGAVIWWLVALS
FT                   FVVSYPKSSNLWAKHSVLQFFFAFFTLIPFLIGVLLLRLDNYVAQPYYGIMLLLYVFIL
FT                   VWVADSGAYFVGRKFGKQKLAPKVSPSKSWQGAIGGLVMAGIVSAIFVNVTQQSLIKDI
FT                   SPPAFIALSVVTVAISILGDLTESMFKRQSGIKDSSNLIPGHGGILDRIDSLTAAVPFF
FT                   AYFYFFVL"
FT   gene            223572..224906
FT                   /locus_tag="D11S_0247"
FT   CDS_pept        223572..224906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0247"
FT                   /product="zinc metallopeptidase RseP"
FT                   /note="catalyzes the cleavage of RseA which activates the
FT                   sigmaE-mediated stress response"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81663"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566443.1"
FT                   /protein_id="ACX81663.1"
FT                   /translation="MSFLWSTVSFLIVIAVLVAVHEYGHFWAARKCGVKVHRFSIGFGK
FT                   VIWSRTDKRGTEFAVSAIPLGGYVKMLDGRNEEIPPEFAAQAFDNKTVAQRAFIIAAGP
FT                   LANFLFAILAYFVIYSIGVPSIKPVIEEVQPHSIAAKAQVSPNTQITEVDGVVTPDWET
FT                   INLLLATKTGESKVELTLVEFGSTIEQHKILDLSNWTFNPEKESAFGSLGIVPVRTKVD
FT                   MTLSKVNNHSPAQKGGLLVGDKLYWSDGKEIVWQDFIEQVQQGKPLALKVERNGEWLEK
FT                   TITPELNDKKRWFVGISPTFYPVADEYRTELKYDMLESLQRAVEKTFQLSWLTIKVIGK
FT                   LLIGELSLNNLGGPISIAQGAGASSELGLIYYLSFMALISVNLGVMNLFPLPVLDGGHL
FT                   VFLALEALKGKPVSEQVQNISYRIGAVLLLMLMGFGLINDFLRLN"
FT   gene            224931..227336
FT                   /locus_tag="D11S_0248"
FT   CDS_pept        224931..227336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0248"
FT                   /product="outer membrane protein assembly protein YaeT"
FT                   /note="part of a complex with YfgL, YfiO, and NlpB involved
FT                   in outer membrane protein biosynthesis; involved in the
FT                   assembly of outer membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81664"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540410.1"
FT                   /protein_id="ACX81664.2"
FT                   /translation="MKKLLIASLLFSSTAALAGPFVVQDIRVDGVQAGTESNIIASLPV
FT                   RVGQKINDANIAGVVRNLFLTGQYEDVKASQQGNTLVISVVPKAIISDVVLDGNKSIPN
FT                   DALKQNLNANGFQKGDILNREKLEAFRKSLEDHYHSVGRYNAKVETIVNPLPNNRAEVK
FT                   IQIKENDVALLKGVTFVGNQVFDSDRLQDQMELQPDAWWKLFGNKFDSTQFSKDLETIQ
FT                   NYYLDRGYAKAQIVDNDVQLNDEKTEARVTINVSEGEKYTVNGARIVGDVGGMSEQLAP
FT                   LLKQIHIGEEFHRSDVQAVEDSIKSTLGERGYGSAQVNVQPDFNDDAKTVGLSFVVDAG
FT                   KRYSVRQIRFEGNTVSADSTLRQEMRQQEGSWLSTDLVELGKVRLDRTGFFETVESRTE
FT                   PVEGTGDEVDVIYKVKERNTGSINFGVGYGTESGLSYQASIKQDNFLGMGSSLSLAGSR
FT                   NDYGTSVNLGYNEPYFTKDGVSLGGNIFFENYDNSKNSTSASYARTTYGGNLTLGFPVN
FT                   ENNAYYIGLGYAYNKLKNITPEYNRALYLASLNYNEWTFKSHDYDISFGWNYNSLNRGF
FT                   LPTKGVKASIGGKVTIPGSDNKYYKLNADVQGFYPLNRDQTWVLSGRLGAAYANGFGGK
FT                   RLPFYQTYTAGGIGSLRGFAYSAIGPQAIYINPRVNGCSGSGVNVNSSCYNIVNGDIVG
FT                   GNAMATASVELIVPTPFVAEKNQNSVRTSFFVDAASVWDTHWKGEKAKFTNLKLPDYGD
FT                   PSRVRASAGLAFQWQSPIGPLVFSYAKPIKKYENDDIEQFQFSIGGSF"
FT   gene            227441..228016
FT                   /locus_tag="D11S_0249"
FT   CDS_pept        227441..228016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0249"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81665"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548625.1"
FT                   /protein_id="ACX81665.1"
FT                   /translation="MKKIVKLTALSLALAFSSLAMADENIAFISAEYLFQNHPDRKAVA
FT                   EKLEAEFKPTADKLAENKKQIDTKIADIQKKVEAKVAALQKDAPKLRSADIKKREDEIN
FT                   KYGNDQQEEINKLIAEHDQKAKEFQENYAKRENEETEKLVASIQAATNNVAKQKNYTLV
FT                   LDDRSVVYGIDGKNITEEVLKAIPAQAK"
FT   gene            228016..229038
FT                   /gene="lpxD"
FT                   /locus_tag="D11S_0250"
FT   CDS_pept        228016..229038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="D11S_0250"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="adds the O-linked and N-linked 3(R)-hydroxy fatty
FT                   acids to the glucosamine disaccharide during lipid A
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81666"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005569466.1"
FT                   /protein_id="ACX81666.1"
FT                   /translation="MRTYSLSELAQQIGATIRGNADVVVSNIAPLDKANERQLTFISNV
FT                   KFRELLVQSKAGILVVSEADVEFCSPDSNLLIVKDPYVAYAKLAQYMDTTPKAASGIAK
FT                   SAVIAEGVFLGENVSIGANAVIESGVELGDNVVIGANCFVGKNTKIGANTQLWANVSVY
FT                   HDVQIGQHCLIQSGAVIGSDGFGYANERGKWIKIPQVGQVIIGNNVEIGACTCIDRGAL
FT                   DATVIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLTVGRYCLIGGASVINGHMEI
FT                   CDQVTITGMGMVMRPITEPGVYSSGIPLQTNKEWRKTAALTLGIDGLNKRIKALEKKVK
FT                   "
FT   gene            229133..229585
FT                   /locus_tag="D11S_0251"
FT   CDS_pept        229133..229585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0251"
FT                   /product="3-hydroxyacyl-ACP dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81667"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006716879.1"
FT                   /protein_id="ACX81667.2"
FT                   /translation="MTEQNSRIIESHEIMQLLPHRYPFLLVDRVINFEEGKWLTAIKNI
FT                   SVNEPCFTGHFPDNPILPGVLILEALAQAMGILAFKTHELVGGEIFYFAGVDEARFKRP
FT                   IIPGDQMVLHVEVIKERRGITAFTATATVDGEVACEAKLMCARRVA"
FT   gene            229606..230394
FT                   /locus_tag="D11S_0252"
FT   CDS_pept        229606..230394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0252"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="catalyzes the addition of (R)-3-hydroxytetradecanoyl
FT                   to the glucosamine disaccharide in lipid A biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81668"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007242047.1"
FT                   /protein_id="ACX81668.1"
FT                   /translation="MIHPTAKIHPQAIVEEGAKIGENVVIGPFTIIGKDAKIGKGTVIH
FT                   SHVVINGNTKIGEDNEIYQFASIGEVNQDLKYQGEPTRVVIGNRNRIRESVTIHRGTAQ
FT                   GGGVTKIGDDNLLMINVHIAHDCLIKNRCILANNATLAGHVQLDDFVVVGGMSAIHQFV
FT                   VIGAHVMLGGGSMVSQDVPPYVMAQGNHAQPFGVNIEGLKRRGFDKLTMRTIRNVYKMI
FT                   YRSGKTLEEVMPEIEQIAETESAISFFVEFFKRSKRGIIR"
FT   gene            230479..231663
FT                   /gene="lpxB"
FT                   /locus_tag="D11S_0253"
FT   CDS_pept        230479..231663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="D11S_0253"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="catalyzes the formation of lipid A disaccharide from
FT                   UDP-2,3-diacylglucosamine and
FT                   2,3-diacylglucosamine-1-phosphate, lipid A disaccharide is
FT                   a precursor of lipid A that anchors LPS to the OM"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81669"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540422.1"
FT                   /protein_id="ACX81669.1"
FT                   /translation="MSDFIATKDSPLIALTAGEVSGDILGAGLIKSLKVRYPNACFIGI
FT                   GGPRMIAAGFESLFDMEELSVMGLVEVLKHLPRLLKIRRRIIQQLLALKPDVFIGIDAP
FT                   DFNLDVELKLKQNGIKTIHYVSPSVWAWRQKRVYKIGAATNLVLAFLPFEKAFYDRFNV
FT                   PCRFIGHTMADAIPLKPNRAEACRLLNLDENQHYLAILVGSRSSEVEFLAEPFLQTAQL
FT                   LRQRYPDLQFLVPLINAKRRQQFEQIKQRVAPDLDVILLDGNARAAMIAAKATLLASGT
FT                   AALEAMLCKSPMVVGYRMKPFTYFLVKCLVKIKYISLPNLLADEMLVPELIQAECNPTN
FT                   LVEKLSVYLDTDESTVKNRNILIQRFTELHKMIQCDADQQAAQSVIDLLEQKNG"
FT   gene            231656..232255
FT                   /gene="rnhB"
FT                   /locus_tag="D11S_0254"
FT   CDS_pept        231656..232255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="D11S_0254"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="RNH2; RNase HII; binds manganese; endonuclease which
FT                   specifically degrades the RNA of RNA-DNA hybrids"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81670"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548616.1"
FT                   /protein_id="ACX81670.1"
FT                   /translation="MDKFTYPQGYELIAGVDEVGRGPLVGAVVTAAVILDPKQPIEGLA
FT                   DSKTLSEKKRLLLAEEIKQKALAWALGRAEPHEIDELNILHASMLAMERAIKHLKIRPH
FT                   FVLVDGNRIPPNLMIPAQAVVKGDVLVPEISAASILAKVARDQEMIVLDKKYPHYAFAK
FT                   HKGYPTKLHLEKLREFGVLPEYRRSFAPVKKLLKSL"
FT   gene            232295..234163
FT                   /pseudo
FT                   /locus_tag="D11S_0255"
FT                   /note="citrate transporter; disrupted"
FT   gene            234174..234782
FT                   /locus_tag="D11S_0257"
FT   CDS_pept        234174..234782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0257"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81673"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540428.1"
FT                   /protein_id="ACX81673.1"
FT                   /translation="MSIYDLKPKFQNLLRPFTVKLAQHGVTANQVTLAACAVSVILGLI
FT                   LTALSAYHWLFILIPLWLFVRMALNAIDGMLAREFNQKSRLGGYLNEITDVVSDAALYL
FT                   PFALIFPFDAFQIGLIIWLSALTEFCGVLGQVQGKTRRYDGPLGKSDRAFFFGILGLFY
FT                   ALIPTLPAWLYWAAWVVVILLIMTCIKRVKSGLAEADNL"
FT   gene            234793..235425
FT                   /locus_tag="D11S_0258"
FT   CDS_pept        234793..235425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0258"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81674"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555568.1"
FT                   /protein_id="ACX81674.1"
FT                   /translation="MLAKLIDFLLCRFTSFITGVRAQKNVEQQSADKHRLYFANHNSHG
FT                   DFILLWVSLPYPVRKNTRPVAGADYWTKGPIRRFLAYKVFNMLLIDRGGDNPQAITEQI
FT                   SDALQHHSLIIFPEGTRKMEDDLPLQPFNSGLYYLAKQNPQLEMVPVWISNMHNVLPKG
FT                   FVVPIPLLCDLYMDEPLFYRDDENKAAFLTRAEQALLSLNVTEKGRA"
FT   gene            235425..236354
FT                   /locus_tag="D11S_0259"
FT   CDS_pept        235425..236354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0259"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81675"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012820828.1"
FT                   /protein_id="ACX81675.1"
FT                   /translation="MEMWKLFGGLMITLIIASSIGYGLKLKVGWSTPHVVIDNLNARIN
FT                   AWWVMILIIFAAAALGFYGIIFLFFVISFMALREFLSLLYIRRGDHLALAACFYVILPV
FT                   QYILVAIDWFSMFTIFIPVYGFLFLPILSALLGDTAHFLDRSTKVQWALMISVFCISHI
FT                   PAMLTLDIAGFEGKNLLLMIFLILVVQASDVLQYVWGKLFGKHKIAPRLSPSKTVEGFV
FT                   GGMVSASVLGGLLYWLTPFSPVQAVLMSLLICLMGFLGGLVMSAMKRSMGVKDWGNMIS
FT                   GHGGMLDRMDSLCFAAPIFFHVVRYYWT"
FT   gene            236444..237025
FT                   /gene="mogA"
FT                   /locus_tag="D11S_0260"
FT   CDS_pept        236444..237025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="D11S_0260"
FT                   /product="molybdenum cofactor biosynthesis protein MogA"
FT                   /note="forms a trimer; related to eukaryotic protein
FT                   gephyrin; functions during molybdenum cofactor
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81676"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566454.1"
FT                   /protein_id="ACX81676.1"
FT                   /translation="MTALLKIGLVSVSDRASQGIYPDQGIPELRNWLQQALADSFEVVE
FT                   RLIPDEQAEIERTLCELVDEQHCHLVLTTGGTGPAKRDVTPDATLAVADREMPGFGEQM
FT                   RQVSLHFVPTAILSRQVGVIRKESLILNLPGQPKAIKETLEGVKDKQGNVLVKGIFSAV
FT                   PYCLQLINGLYINTKPDVIVSFRPQSACRD"
FT   gene            complement(237753..237938)
FT                   /locus_tag="D11S_02285"
FT   CDS_pept        complement(237753..237938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02285"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548603.1"
FT                   /protein_id="ANN81527.1"
FT                   /translation="MAFCLIPEILSSVNMVMIFSKMRTMIDAKMTKLSHIKYIITGVSV
FT                   RVNGAIRLELLSNNGQ"
FT   gene            complement(238446..238561)
FT                   /locus_tag="D11S_02290"
FT   rRNA            complement(238446..238561)
FT                   /locus_tag="D11S_02290"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(238844..241885)
FT                   /locus_tag="D11S_02295"
FT   rRNA            complement(238844..241885)
FT                   /locus_tag="D11S_02295"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(242158..242233)
FT                   /locus_tag="D11S_0264"
FT   tRNA            complement(242158..242233)
FT                   /locus_tag="D11S_0264"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:242198..242200,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(242283..242359)
FT                   /locus_tag="D11S_0265"
FT   tRNA            complement(242283..242359)
FT                   /locus_tag="D11S_0265"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:242323..242325,aa:Ile,seq:gat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(242399..244003)
FT                   /locus_tag="D11S_0266"
FT   rRNA            complement(242399..244003)
FT                   /locus_tag="D11S_0266"
FT                   /product="16S ribosomal RNA"
FT   gene            244501..245454
FT                   /locus_tag="D11S_0267"
FT   CDS_pept        244501..245454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0267"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81678"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167508.1"
FT                   /protein_id="ACX81678.1"
FT                   /translation="MTNQLDSLRELTTVVADTGDIDAIRQYKPEDATTNPSLILSAAAL
FT                   PQYAALIDEAITYGKQKSQDKSQQLIDAEDKLAVNIGLEILKLVPGRVSTEVDARLSYD
FT                   TQATVAKAKKLIALYEAAGINKNRILIKIASTWQGIRAAEILEKEGINCNLTLLFSEAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANSDKKEYAPAEDPGVISVTKIYNYYKQYGYKTVV
FT                   MGASFRNVGEIIELAGCDRLTIAPPLLKILHETPNAVVRKLDFQGEVKAKPQPLTEAEF
FT                   YWQHNSDAMAVEKLAEGIRKFAVDQGKLEEMLLSKW"
FT   gene            245587..247584
FT                   /locus_tag="D11S_0268"
FT   CDS_pept        245587..247584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0268"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="catalyzes the formation of ribose 5-phosphate and
FT                   xylulose 5-phosphate from sedoheptulose 7-phosphate and
FT                   glyceraldehyde 3-phosphate; can transfer ketol groups
FT                   between several groups; in Escherichia coli there are two
FT                   tkt genes, tktA expressed during exponential growth and the
FT                   tktB during stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81679"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005571407.1"
FT                   /protein_id="ACX81679.2"
FT                   /translation="MSNRQQLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDFL
FT                   HHNPTNPQWANRDRFVLSNGHGSMLIYSLLHLSGYDLSIEDLKQFRQLHSKTPGHPEYG
FT                   YTPGVETTTGPLGQGISNAVGMAIAEKTLAGQFNRDGHNIVDHYTYAFLGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIAFYDDNNISIDGHVDGWFTDDTQKRFEAYGWQVIPAIDGHNPA
FT                   QIAEAIKQAQAETAKPTLIICKTIIGFGSPNKSNSHDSHGAPLGDEEIALTRKALHWDY
FT                   APFEIPADIYAQWDTKAKGAEWEKAWDEKFAAYAKAYPELAAEFTRRIAKKLPADWAKD
FT                   SQAFVEHLQANPASIASRKASQNAIEAYAKILPELLGGSADLASSNLTLWSGSKPIRAT
FT                   QNVDGNYINYGVREFGMAGIMNGIALHGGFIPYGATFLMFMEYAHNAIRMAALMKQRSL
FT                   FVFTHDSIGLGEDGPTHQPVEQTAALRLIPNLNTWRPCDQVESAIAWKAAIERTDGPSA
FT                   LIFTRQNLAQMDRTSEQLANVARGAYVLKDCAGTPELIFIATGSEVELAVKAAEQLTAE
FT                   GKKVRVVSMPSTNVFDKQDEAYRESVLPVAVTKRVAIEAGISDFWYKYVGFNGRIIGMH
FT                   SFGESAPADQLFKLFGFTVGNVVAKAKEIL"
FT   gene            complement(247656..248045)
FT                   /locus_tag="D11S_0269"
FT   CDS_pept        complement(247656..248045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0269"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="has endoribonuclease activity on mRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81680"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555759.1"
FT                   /protein_id="ACX81680.1"
FT                   /translation="MTKIIHTDKAPAAIGPYVQAVDLGNLVLTSGQIPVNPVTGEVPKE
FT                   IVAQARQSLENVKAIIEQAGLKVADIVKTTVFVKDLNDFAAVNAEYERFFKENNHPNFP
FT                   ARSCVEVARLPKDVGLEIEAIAVRA"
FT   gene            complement(248122..248580)
FT                   /locus_tag="D11S_0270"
FT   CDS_pept        complement(248122..248580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0270"
FT                   /product="recombinase RecX"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81681"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544401.1"
FT                   /protein_id="ACX81681.1"
FT                   /translation="MSSLALNYVMNLLSRREYSEFELRCKMQEKAFSENDIDQVIAHCQ
FT                   QKNWQSDVRFTESYLHSRAQRGYGANQIKQELRQLKGVESATIESVMRECEIDWSELAL
FT                   TVLRKKFPDYKAKQPPKMRQKIWQYMLSHGFHGDDFADYVGSEPDEFD"
FT   gene            complement(248662..249720)
FT                   /locus_tag="D11S_0271"
FT   CDS_pept        complement(248662..249720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0271"
FT                   /product="recombinase RecA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81682"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544399.1"
FT                   /protein_id="ACX81682.1"
FT                   /translation="MATQEEKQKALDAALGQIEKQFGKGAIMKLGDSQKLDIEAISTGS
FT                   FGLDLALGIGGLPMGRIVEIFGPESSGKTTLTLSVIAEAQKTGKTCAFIDAEHALDPIY
FT                   ASKLGVDVKELLVSQPDNGEQALEICDALVRSGAVDVIIVDSVAALTPKAEIEGDMGDS
FT                   HMGLQARLMSQALRKLTSQIKNANCLVIFINQIRMKIGVMFGNPETTTGGNALKFYASV
FT                   RLDIRRVGSIKEGDEVIGNETRVKVVKNKVAPPFRQVDFQILYGEGISKESELIELGVK
FT                   HKLISKAGAWYAYQNEKIGQGKTNAMKWLKDNPEQAKFIESTLRDELLAHPESAITAEV
FT                   ENEAGNGEGDFE"
FT   gene            complement(249868..251793)
FT                   /locus_tag="D11S_0272"
FT   CDS_pept        complement(249868..251793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0272"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81683"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564345.1"
FT                   /protein_id="ACX81683.1"
FT                   /translation="MLFFINLTLKRGLTTLLENANATINPGQKVGLVGKNGCGKSSLFA
FT                   LLKNEMSAEGGEMSFPPNWALAWVNQETPSLDCRAIDYVIQGDREYSRLQQVLQQANTA
FT                   NDGNAIAVLHNQLDAIDAWTIEARACELLHGLGFTQAELEQPVKAFSGGWRMRLNLAQA
FT                   LICRSDLLLLDEPTNHLDLDAVIWLERWLKQYPGTLILISHDRDFLDPIVGKILHIEQQ
FT                   KLNEYTGDYSSFEQQRATKLAQQNAMYRQQQLKIDHLQRYIDRFKAKATKAKQAQSRIK
FT                   ALERMEKIAPAYVDNPFHFEFREPLSLPNPLLMMENASVGYGEGEKSAVEILSKIKLNL
FT                   VPGSRIGLLGKNGAGKSTLIKLLAGEIAPTGGTIQLAKGVQLGYFAQHQLDTLRADESA
FT                   LWHLQKIAPQQTEQQLRDYLGGFAFHGDKVNQPVASFSGGEKARLVLALIVWQRPNLLL
FT                   LDEPTNHLDLDMRQALTEALVDYQGSLVLVSHDRHLLRNTVDEFYLVHDKQVEEFKGDL
FT                   GDYQKWLNEQNAQPTITKAQTAPVENENSAANRKEQKRKEAELRQQLAPLRKQATQLEN
FT                   QMEKLGAQLQHIETALADPNVYDAEMKAKLTALLNDQVQTKKQLEEVEAAWLVLQEDME
FT                   NITAQA"
FT   gene            251874..252491
FT                   /locus_tag="D11S_0273"
FT   CDS_pept        251874..252491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0273"
FT                   /product="MarC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81684"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005569162.1"
FT                   /protein_id="ACX81684.1"
FT                   /translation="MFDSLIVQFVVLWAVIDPIGSIPVYLTKTVGLSVEDRRKIALKAV
FT                   MISAGILIFFLIAGQALLEAMQIPLTAFQIAGGLVLLLFALTMIFGEGKAEQEIKLSSN
FT                   LNELAVYPLAVPSIASPGAMMAIVLLTDNHRFSLFDQTMTTLIMLSVLAITYLLLLAAN
FT                   RIQRWLGNTGAAVISRVMGLILAAVAINNMLVGIRDFFTQMS"
FT   gene            252597..255332
FT                   /locus_tag="D11S_0274"
FT   CDS_pept        252597..255332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0274"
FT                   /product="C4-dicarboxylate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81685"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005569160.1"
FT                   /protein_id="ACX81685.1"
FT                   /translation="MGKRWLFLLLLFILAGIGSLPWWITSQQLEQLANYFLAPGYTLQI
FT                   GNERSLNMDGLQVSQLRLGATQCNLVTLNNIQLNWWAPRRLEVEQATLDYACLNSLHIN
FT                   DNGKTSPKLTALFSSLPTAEVVIKHLKVLNTENVTQPLLNQLITADLSVVANYDGKRLQ
FT                   INTEATEEATKNGTLILQHRSTLTPQNGQFHWQGRTDFQPTEKQAYHLTFSTKMNNELL
FT                   RLKPRGEITLNWQNPEFVVAKGEIKWTWDGEKGQINAQDLVRSEPLLDVPFILTPNSLE
FT                   VSWGTFYWTFDGYQPVKGFLGLTLRKPQDNWFPLNIDLDVILQTFGEQGKGEIVFAGKG
FT                   GQIGGGTQQNELNFDLKTRGDLRYNNTVAQTNLDYHIGGTFSDPILQFRPGSIFKMDNL
FT                   QPDAKIHVRLPLDDVLIGRYGLEGRLQATLQGFTPQFENLNLKLDGQAHEFIAGIKTVF
FT                   ELRDEQQNLHNAEMRAANRWDWTISGSAQWKALKTAVTMQGIGFWQANYIELNQLSAHS
FT                   GNVYTGGVKMAPLSLELKDRLRWNYEKEHIRGLMQAKTDWIEFDYGGWFVKPVFGVGLN
FT                   GKSINHFTIAGELKAGSLGPLDLTARYQNQTLTGQIGWKEQSANVFQSLFPQQWEWIIH
FT                   QGTIKGASNFVINGDGVALHGELNLRGGEITMPDGEIQGLNIRFPLNYQDLALKASRNK
FT                   PIRVSANNIRKGALLMNKAVFNLFGTYPNSAKSPLTLSNARINVFDGELQIPSLSFPQQ
FT                   KIATLSFKNIDLAQVINMAQYNQISLRGRVNATLPFWLGHQECLICNGTIEQVNNLHIK
FT                   LNDEIVTGLKKGGWTENILVDLLKEMELEKSRANLNLAPDGQMKLHSSLTAFNPTKRTR
FT                   SPITLNYTHQENMFELWNMIDYGSQFEQNLQYRLYRHLEQ"
FT   gene            255329..255559
FT                   /locus_tag="D11S_0275"
FT   CDS_pept        255329..255559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81686"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005548515.1"
FT                   /protein_id="ACX81686.1"
FT                   /translation="MKKHLKKSPHFFCLTATILALAGCTPTIQLDTPKEGITINMNVIV
FT                   DHNINVKIDEKTKVTAGENSAVEANKTPAEK"
FT   gene            256697..257056
FT                   /locus_tag="D11S_0278"
FT   CDS_pept        256697..257056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0278"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81689"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546357.1"
FT                   /protein_id="ACX81689.1"
FT                   /translation="MGKHYSIEFKYHTVKLVLEEHWGIREAAQHFHIATHPSVVVRLQR
FT                   FEKYGINGLHRQHTTARKAKMPKRKETPLYDNPQNIKALLKRIEYLEAENTILKKFKEL
FT                   DEQKARQKKGISPTR"
FT   gene            257622..258293
FT                   /locus_tag="D11S_0279"
FT   CDS_pept        257622..258293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0279"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="catalyzes the formation of D-glyceraldehyde
FT                   3-phosphate and acetaldehyde from
FT                   2-deoxy-D-ribose-5-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81690"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539534.1"
FT                   /protein_id="ACX81690.1"
FT                   /translation="MNVKQIAHYIDHTALTAEKTEADILKLCDEALEHHFFSVCINSCH
FT                   IPLAKQKLAGSDVKICTVVGFPLGANLTSVKAFETKEAIAAGANEIDMVINVGWIKSGK
FT                   WDAVKADIQGVLAACYGTPLKVILETCLLTKKEIVRACEICKGLNVAFVKTSTGFNKGG
FT                   ATVEDVALMKQTVGNIGVKASGGIRDTQTALAMIEAGATRIGASAGIAIIHGLQDSGSP
FT                   Y"
FT   gene            258321..259070
FT                   /locus_tag="D11S_0280"
FT   CDS_pept        258321..259070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0280"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81691"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555740.1"
FT                   /protein_id="ACX81691.1"
FT                   /translation="MEKKQTSRVQKLEFLLKQTDKIHLRDAAQMLDVSEMTLRRDLSSD
FT                   SGNVVLLGGYIVMNPQKSGNHYQIFDQQTRHITEKMWLGKLAANLVKDGDTVFFDCGST
FT                   IPFIISQIDPQIKFTALCCSINSFMALQDKPHCEVILCGGHYSRHNSFLTSVQLHSELD
FT                   AICTTKAFISASGIDIKKGVTCFSVDEAKVKQKAMAKTQLAILVFDHHKVHKIQQAYIG
FT                   ELAQFDLLISNQPLPAGFGEVPKMLVK"
FT   gene            259226..260299
FT                   /locus_tag="D11S_0281"
FT   CDS_pept        259226..260299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0281"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81692"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005591038.1"
FT                   /protein_id="ACX81692.2"
FT                   /translation="MSLFAMISALAFNTMANTQPLAVLEPQVNYQQLLTQRQVVDDLIA
FT                   QAVKIQNSPARVSNAGFTAKLPSNMERIAAILLEAYELEPYRVDFLFGAANANIYNGNT
FT                   DKAIELYQKVLTVAPDDVKAHIYLTAWNRFKQNQGETDKYFTRLKALAPQKAAELEQVF
FT                   KIIDNAASQPISDKLANKLPADSAIITLGYALNPDGSMHDILIQRLEKTLEIAKQNPDA
FT                   LIIVTGGVPQNNRTEGALMKQWLINKGIDAKRIYADNYARSTVENALFSRYALAKHHIK
FT                   HASLISSGSHVRRGQALFEIAALESGPQNIKIETVAALDKPLDELQKVSEKDLLGIYRD
FT                   SLKTMGLPMFNSGALQD"
FT   gene            complement(260452..261822)
FT                   /gene="glmU"
FT                   /locus_tag="D11S_0282"
FT   CDS_pept        complement(260452..261822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="D11S_0282"
FT                   /product="bifunctional N-acetylglucosamine-1-phosphate
FT                   uridyltransferase/glucosamine-1-phosphate
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /note="forms a homotrimer; catalyzes the acetylation of
FT                   glucosamine-1-phosphate and uridylation of
FT                   N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
FT                   function in cell wall synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81693"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546352.1"
FT                   /protein_id="ACX81693.1"
FT                   /translation="MTTQALSVVILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTAKQ
FT                   LGARNIHLVYGHGGDLIQQRLAGEPVNWVLQTEQLGTGHAMQQAAPFFADDENILMLYG
FT                   DAPLITKDTLEKLIAAKPDNGIALLTVVLDNPTGYGRILRENGNVVGIVEQKDANVEQL
FT                   NIQEVNTGVMVSDGASFKKWLAQLDNNNAQGEYYMTDVIALANRDGCQVAAVQAVDLME
FT                   VEGANNRLQLTALEQYFQQKQARELLLAGVMLLDPNSFKLRGELSHGKDVEIDMNVILN
FT                   GKVRLGNRVKIGAGCVLTNCDIGDDVEIKPYSVLEDASVGANAAIGPFSRLRPGADLAE
FT                   NTHVGNFVEIKKAYIGKGSKVNHLTYVGDAEIGKDCNIGAGVITCNYDGANKFKTTIGD
FT                   NVFVGSDSQLVAPVTIESGATIGAGSTIRYDVKRDELVTTRVPQKHVQGWERPTKKK"
FT   gene            261908..263038
FT                   /locus_tag="D11S_0283"
FT   CDS_pept        261908..263038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0283"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81694"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167510.1"
FT                   /protein_id="ACX81694.1"
FT                   /translation="MQQEYYLGIMSGTSLDGVDVALMAFTEQPQFIAGQFTPMPTHLRQ
FT                   DLLQLVSHGTTTLQQLGELDQRLALLYANAVNRFLTTHNLPPQHIRAIGCHGQTVWHAP
FT                   QGDFPFTLQIGDMHLLAARTGIDVVGDFRRKDMAFGGQGAPLVPAFHQALFYDERWATV
FT                   VLNIGGISNISVLFPHQPIIGYDTGTGNALMDGWIDRHLGKSYDADGQWARSGKVRSAL
FT                   LAEMLKEPYFQLPPPKSTGRELFNLAWLEKTLVKTTALLGEMPPQDVQATLLEFTTQSV
FT                   VLALNQLKTELPRRLLVCGGGAKNGLLMERLQALLPNWQCRPTNDAGLDVDYVEATAFA
FT                   WLAYRRIHNLPSNLPSVTGAKSAVSLGAIFPAEKIS"
FT   gene            263035..263949
FT                   /locus_tag="D11S_0284"
FT   CDS_pept        263035..263949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0284"
FT                   /product="N-acetylmuramic acid-6-phosphate etherase"
FT                   /note="catalyzes the cleavage of the lactyl ether moiety of
FT                   N-acetylmuramic acid-6-phosphate (MurNAc-6-P) to form
FT                   N-acetylglucosamine-6-phosphate (GlcNAc-6-P) and lactate;
FT                   involved in MurNAc dissimilation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81695"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005591043.1"
FT                   /protein_id="ACX81695.1"
FT                   /translation="MSEQNLVNSLEKMLSEQRNPNTMHIDSLSPLEVVTLLNKEDKLVA
FT                   VAVEKNLPQIAQAVERIVAAFQAGGRLVYLGAGTSGRLGVLDASECPPTFGVPSGMVVG
FT                   SIAGGETALRNAVEGAEDNAAAGEQDLRHINFSAKDVLVGIAASGRTPYVIGGLNYAKQ
FT                   LGATTVSLVSNPNAVMSDIADIAITTAVGPEALTGSSRLKSGTAQKMVLNMLTTAAMIR
FT                   LGKCYQNLMVDVQATNQKLKARAIRIVMQATDCDATTAEQTLHTTNGNAKLAIMMLLSG
FT                   LDKTQAEAVLVQHKGRLQNALVG"
FT   gene            complement(264061..264537)
FT                   /locus_tag="D11S_0285"
FT   CDS_pept        complement(264061..264537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0285"
FT                   /product="(p)ppGpp synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81696"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546347.1"
FT                   /protein_id="ACX81696.2"
FT                   /translation="MKTSFKVGQGDEGIRLFLKLCSALFSYQEDTPIIEEFNNFSVVQI
FT                   CEKIKELDSKLGVIDKLKSVSAIDVEHNPSAAYYLLILDLKKHNTEIKTFNENEKFKAE
FT                   QVYSHYEQDSFKNEFLDVVLVSVDDVNQLKDAYPNYFLDTTSFINRMENLLMNR"
FT   gene            complement(265187..265630)
FT                   /locus_tag="D11S_0286"
FT   CDS_pept        complement(265187..265630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81697"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568512.1"
FT                   /protein_id="ACX81697.1"
FT                   /translation="MGYSSIAIANSFIGKANIGEISNLTPMKLQKLMFYTQSWYIKLYG
FT                   KPLFEGGVERWQFGPVLPEIYHEFKPFGSRIISSFGTDIWGKQQIIKESDKDTLLFLDK
FT                   IIEIYGKFDGPQLSWMTHQPETAWSMGRLGSVITQDELFNGKV"
FT   gene            265892..267256
FT                   /locus_tag="D11S_0287"
FT   CDS_pept        265892..267256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0287"
FT                   /product="patatin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81698"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568513.1"
FT                   /protein_id="ACX81698.1"
FT                   /translation="MKRANFPFRLTFLAAGLALLTACHSIIYQPAKTIEHIDLQSGYRL
FT                   ENVMQQALQKENLVIMTFSGGGSRAASLGYGMLEQFKNASVRPTEKGDTLLQNIDVVYG
FT                   VSGGSVLAAYFAQEGQDVIPKFNESFLKKDFQKKVINEVFSMSNVPRLTSPQFGRSDLL
FT                   QEQLNLALYKGKKFADLAQHRKGPFAVINATDMAMGQKISFTQDFFDWLCLDLNDIEIA
FT                   RAVAASSAVPLIFSPVTLNNHGGSCHIHNKKAMLTEQPGYWLLLNNFNAMEKRFARYQN
FT                   NPEKTYLHLVDGGLTDNLGLASLLDMSNLLSMHELYTELKKSNLRNIVVVNVNAQNENT
FT                   SQIDKSADVPGVKEVVNTVISVPIDKATESTLQYSQKFADQWNAYTKRKKDVKIKIYFV
FT                   NLSLRNLPEGQLKTDVLHIGTSFYLPESDVDKLREAAKILLEQSKEYQEALKALQ"
FT   gene            267381..268676
FT                   /locus_tag="D11S_0288"
FT   CDS_pept        267381..268676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0288"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81699"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568515.1"
FT                   /protein_id="ACX81699.1"
FT                   /translation="MLAFSHQEHVESYYSVTRNQHFELPSLSQKASADVCVVGAGFFGL
FT                   STALELAEQGKSVIVLEGARVGFGASGRSGGQAINGFEDGIDEYIAQVGLDTARKLWQM
FT                   SLEAIEIIDERIAKYGIQCDWKKGYATLALNERRMDDLIAIEKASHEIFGYQNMQLWDK
FT                   AKLEQHLGSKIYYGALYDSNSGHLHPLNYCLGLAKACLELGVRIYEQSPVVDLQEKATK
FT                   IEVITDQSSVIAKDVALATNAYIDALPKSIHHGIARKILPVESFIIATEPLDQATADSV
FT                   INNGMSVCDSNYLLDYYRLSADNRLLFGSDSSSEKDMIEVMRGNMLHVFPQLEQVKIDY
FT                   GWGGPIDMTINSNPHFGRISPHIYFAQGYSGHGVALTGLAGRIVAEAILGNDERLTIFS
FT                   KLKVPSVFGGKLVKNLALKIGVNYYRFLDKYR"
FT   gene            268802..269581
FT                   /locus_tag="D11S_0289"
FT   CDS_pept        268802..269581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0289"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81700"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558176.1"
FT                   /protein_id="ACX81700.1"
FT                   /translation="MKKSILAKTLLLTGLALGIATQAAAGEISDRVEKTKTLLVGTEGT
FT                   YAPFTFHDDSGKLTGFDVEIIESVAQRLGLKIQFNETQWDSMYAGLNAKRFDLIANQTS
FT                   PSPERLKKYLYTTPYNYSTAVIVTKEGDDSIKAFEDLKGKKAAQSLTSNYGKIAKANGA
FT                   ELIVVDGLAQALKLITQDRAQTVVNDQLAVLDYFKKQPNAGLKIAVKRDEKVPSGFAVL
FT                   KGEEPLVEKINQALEELRKDGTLKQISIKWFGDDITQ"
FT   gene            269565..270287
FT                   /locus_tag="D11S_0290"
FT   CDS_pept        269565..270287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0290"
FT                   /product="cysteine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81701"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167513.1"
FT                   /protein_id="ACX81701.1"
FT                   /translation="MTLLNNFLASLPFMNAERANEAISAFWPMLEAAIDKTIPLAIISF
FT                   FAGLVIALGVAVIRTMPKSSIGLLVLQLLCRIYVSIIRGTPMLVQIFIIFYGLPEVGIK
FT                   LDPFPTAIIAFSINIGAYASETIRAAILSIPKGQWEASYSIGMNYFQTFTRTIMPQALR
FT                   VSVPPLSNTFISNVKDTSLASLVLVTEMFRVAQNITAENYEFIMIYSEAALIYWCICLV
FT                   LSFAQERLEKRLSRHLQA"
FT   gene            270297..271064
FT                   /locus_tag="D11S_0291"
FT   CDS_pept        270297..271064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0291"
FT                   /product="amino acid ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81702"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558180.1"
FT                   /protein_id="ACX81702.1"
FT                   /translation="MLDVRNIHKTFNGNQVLKGIDFQIQKGEVVAILGPSGSGKTTFLR
FT                   CLNLLERAEQGTLHFTDGSLALDFAKKISKADELKLRRRSSMVFQQYNLFPHRTALENV
FT                   MEGMLVVQKKSKAEAEQRAEELLTKVGLKDKMHLYPSQLSGGQQQRVGIARALAVQPDI
FT                   ILLDEPTSALDPELVGEVLQTLKLLAQEGWTMIIVTHELQFARDVADRVILMADGNVVE
FT                   QNGAREFFENPQQERTKQFLLQAKIPVCVEYEI"
FT   gene            complement(271069..271356)
FT                   /locus_tag="D11S_0292"
FT   CDS_pept        complement(271069..271356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81703"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546333.1"
FT                   /protein_id="ACX81703.1"
FT                   /translation="MLYTFSQAHYSQAELERYLLNASAQDAVVLWQDGVLLALKQADLL
FT                   ARCKAQCMMLQEDILARNLTALLLSPTKVRLISLTDFVAISEQYSPQIAL"
FT   gene            complement(271359..271721)
FT                   /locus_tag="D11S_0293"
FT   CDS_pept        complement(271359..271721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0293"
FT                   /product="sulfur relay protein TusC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81704"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566159.1"
FT                   /protein_id="ACX81704.1"
FT                   /translation="MSKLAFIFRHAPYGSANTREGLDALLAATAFCAEEDIAVFFLDDG
FT                   VLNLQKHQQAEQILQKDTASALKLLDLYDIEQRYVCADSLQQFQLKPPDLSLDCEALPR
FT                   EQLMRILQQCEKILTF"
FT   gene            complement(271718..272095)
FT                   /locus_tag="D11S_0294"
FT   CDS_pept        complement(271718..272095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0294"
FT                   /product="sulfur transfer complex subunit TusD"
FT                   /note="in Escherichai coli the heterohexameric TusBCD
FT                   complex is involved in sulfur related that results in
FT                   thiouridation to U34 position in some tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81705"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539601.1"
FT                   /protein_id="ACX81705.1"
FT                   /translation="MDYVLVVKQPVYGSQGAFLAYQLAQVLVQKHHIRQIFFYQDGVTN
FT                   GNALVYPANDEFNLVQAWQAFSRQFNVPLHLCVAAAQRRGVVDSYSAADKSAVNLADVF
FT                   QLAGLGEFSQVLLQADRVITL"
FT   gene            complement(272099..272767)
FT                   /locus_tag="D11S_0295"
FT   CDS_pept        complement(272099..272767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81706"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539599.1"
FT                   /protein_id="ACX81706.1"
FT                   /translation="MLTDKRPFTDEDRTILNSYIAVVDGVSALIGQHCEIVLHSFEDLE
FT                   HSAIYIANGHNTNCQVGSPITDFALRSLHEMKSDSVSKPYFLHEEKNSGLMKSVTIAIR
FT                   NSTKRIIGLLCININLDVPVSQFLQNFIPIPDHQETSAVNFASSVEELVVQTVGKTIEE
FT                   ITADRMVANNNKNRQIVVSLYEKGIFDIKDAINLVAERLNISRHTVYLYIRQIKQDQDE
FT                   "
FT   gene            complement(272847..273572)
FT                   /locus_tag="D11S_0296"
FT   CDS_pept        complement(272847..273572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0296"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81707"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539597.1"
FT                   /protein_id="ACX81707.1"
FT                   /translation="MLKMKKISVPVLILSAVVSSGVLAESKTDAKFTDDSSYAVGVLFG
FT                   SDLQGLINAQKGMIDYNNAKVIAGISDVLNGKVKLEGNKEIASTLQGINAKLKAENEKR
FT                   VAAMVKKAEEEGKKFTAEFAKKDGVKKTASGLLYRVEKEGSGDAIKAADVVKVHYTGKL
FT                   PDGTVFDSSRERGTPAEFPLNQVIKGWTEGLQLVKKGGQIELVIPADLGYGEDGAGDKI
FT                   PPHSTLHFDIEVLDVTPAK"
FT   gene            273661..273882
FT                   /locus_tag="D11S_0297"
FT   CDS_pept        273661..273882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81708"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B0UWB7.1"
FT                   /protein_id="ACX81708.2"
FT                   /translation="MSMQQNLAQRITELEMKATFQETVIEELNQALVEQQFILDKIQLQ
FT                   LRYLANKIQDIQPSNIASQAEETPPLHY"
FT   gene            complement(273943..274671)
FT                   /locus_tag="D11S_0298"
FT   CDS_pept        complement(273943..274671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0298"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81709"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704871.1"
FT                   /protein_id="ACX81709.1"
FT                   /translation="MSNMEGKKVPQVTFRTRQGDQWIDVTTSELFDNKTVIVFSLPGAF
FT                   TPTCSSSHLPRYNELAPVFKKYGVDDILVISVNDTFVMNAWKEDEKSDNITFIPDGNGE
FT                   FTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLKYLA
FT                   PQHQVQESITIFTKPGCPFCAKAKQMLHEKGLSFEEIVLGHDATIVSVRAVSGRATVPQ
FT                   VFIGGKHIGGSDDLEAYFAK"
FT   gene            274830..275729
FT                   /locus_tag="D11S_0299"
FT   CDS_pept        274830..275729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0299"
FT                   /product="transcriptional regulator"
FT                   /note="Activates the expression of a regulon of hydrogen
FT                   peroxide-inducible genes such as katG, gor, ahpC, ahpF,
FT                   oxyS, dps, fur and grxA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81710"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539591.1"
FT                   /protein_id="ACX81710.1"
FT                   /translation="MNIRDLEYLVALAEHKHFRRAADSCHVSQPTLSGQIRKLEDELGI
FT                   ILLERTSRKVLFTQSGLLLVDQAKTVLREVKLLKEMASNQGKDMTGPLHIGIIPTVGPY
FT                   LMPHIVPTLQQNFPDLELFLYEAQTYRLLEQLETGRLDCAIVASVPETEAFIEVQLFNE
FT                   KMLLAVAEQHPWANENSVSMSLLKDCEILMLDDGHCLRNQALGYCFTAGARENAHFQAT
FT                   SLETLRNMVAANTGVTLMPQLAVLSEGNRSGVKYLPCDEPEPSRDITLVYRPGSPLRAR
FT                   YERVANTVSQSVKSILSS"
FT   gene            275741..276361
FT                   /locus_tag="D11S_0300"
FT   CDS_pept        275741..276361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0300"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81711"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558195.1"
FT                   /protein_id="ACX81711.1"
FT                   /translation="MVGIRAQQKEKTRRALIDAAFNQLTAEKSFSNLSLREVSREAGIA
FT                   PTSFYRHFRDMNELGLTMVDEAGLILRQLMRQARKRIANGGSVIVISVETFFEFINNSP
FT                   NIFRLLLRESSGTSQAFRTAAAREIKHFIDELSEYIAHKNHYSQYIAYVQAEGMVTIVF
FT                   TTGASALDMSKAEREQLKARLILQLRMLAKGAKYETRDKYKPG"
FT   gene            complement(276473..278131)
FT                   /locus_tag="D11S_0301"
FT   CDS_pept        complement(276473..278131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0301"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81712"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546324.1"
FT                   /protein_id="ACX81712.2"
FT                   /translation="MRKNGFVVMWQLMKLVTPLAHIMSFTIIMGTLGFLSAIFIMVLGA
FT                   MGLAELLNFHVHLNLSQILTALIVLAVARGILRYLEQMSGHYIAFKLLALLRDKVFGAL
FT                   RRLAFVKLQDKQSGQLLSLVTNDIELLEVFYAHTIAPIAIAFLTSAILLAVFAHISWWF
FT                   VLVALLAYVTIGIILPIVTTQMAREDGRKYRELVGEMNDFFLDSIRGMKEIQLFGNEQK
FT                   RLQEIHQRSEKIDQAFLKIKQQEGNVRSFTEIAVSFFNIVILLVGLTLFAYDKIDFVGL
FT                   LVAVILLMSGYGPVIALSNLSNNLLQTLASGERVLALLAEQPELKDVENGVSITDVQQI
FT                   KVENVSFAYAQEQILSDVNLHINKGEILGIHGRSGSGKSTLLKLIMRFYDPQQGSICIN
FT                   DTDLKHINTVNLRDNIAYITQQTYIFNETIYENILLANRNATKEQVIEAAKKASIHEFI
FT                   MSLREGYDTKITEMGNNLSDGEKQRIGIARAFLHNAPIILLDEPTSNLDSLNEAMILQS
FT                   LLNVKAEKLIILVSHRASTMAICDQVIPIANGRMS"
FT   gene            complement(278124..279872)
FT                   /locus_tag="D11S_0302"
FT   CDS_pept        complement(278124..279872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0302"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81713"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566164.1"
FT                   /protein_id="ACX81713.1"
FT                   /translation="MMIDKRLINTVANSKKWITINVLWNWVTLIGGIISAVVFAICLQW
FT                   AFERSLTLQSAVIFTIVLIACLALRAWAGKMAVKASYKASMQVKHKLRTLIYQKLSSMP
FT                   LNQVNQQSTSSVIQVASEGVEQLEIYFGRYLPQLFYSLLAPLTLFIFLVFFNAPTSLIL
FT                   LVCVPLIPMSIIAVNKIAKRLLAKYWSIYVGLGSSFLDNLQGLITLKIYQDDDYKAKQM
FT                   DIEAENFRTITMKVLTMQLNSVSLMDLLAYGGAALGILTALLQFQDGNLSIFGVVLFIL
FT                   LASEFFIPLRLLGSFFHVAMNGKAASEKIFTLLDTPVEENKSAVDFPAKNEVTVQINDL
FT                   HFTYSEEKPVINGLTLSIQPKQLTVFVGKSGCGKSTLVSLLMGFYQAQQGEILFNGIDI
FT                   KQINRHSLYRHISLVSHSSYIFKGSLRENMLMVLSNASDEVIYQCLEQVNLANFVRENG
FT                   GLEMPLLSRGSNLSGGQIQRLALARALLHNADVYIFDEATSNIDVESEEIILQFIQQLK
FT                   HSKTIVMISHRLANAVNADQIYVLQSGRLMESGDHASLMAENGIYAEMFNQQKNLENIR
FT                   MGANHA"
FT   gene            complement(280041..281363)
FT                   /locus_tag="D11S_0303"
FT   CDS_pept        complement(280041..281363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0303"
FT                   /product="C4-dicarboxylate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81714"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167517.1"
FT                   /protein_id="ACX81714.1"
FT                   /translation="MSAMFLFQFAIVLLCILIGARVGGIGLGVFGGLGLTILSFGFGLK
FT                   PAGLPIDVMFMIMAVVAAAAAMQAAGGLDYMIKIATNILRRNPKDITFMAPAVTWTFTL
FT                   LAGTGHVAYSVLPVIAEVSRQNGIRPERPLSMAVIASQFAIVASPIAAAVVAVVAYLEP
FT                   QGIHLGDVLIVTIPSTIIGLFLACIFVNKMGKELKDDPEYQRRLNDPKYAEAFNSTTSS
FT                   KELEISKTAKISVSLFLFGALLVVLMGAMPSLRPVFDGKPMGMAHAIEIIMLTIGALII
FT                   LTCKPDGTEITKGSVFHAGMRAVIAIFGIAWLGDTLMQAHLEEVKGMVRGLVETAPWTF
FT                   AIALFILSVLVNSQGATVATLFPLGIALGIPPAVLVGVFVAVNGYFFIPNYGPIIASID
FT                   FDTTGTTRIGKYIFNHSFMLPGLLSMAFSLALGLLFANIFL"
FT   gene            281690..282130
FT                   /locus_tag="D11S_0304"
FT   CDS_pept        281690..282130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81715"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546316.1"
FT                   /protein_id="ACX81715.2"
FT                   /translation="MQEFIPMATAFAKNHTLIVVAWVAVFLMVIYNFVKSATSKTKLID
FT                   NAEAISLMNNQNAVVIDLRSIDEFNKGHIINSLNILPSEIKKNNIRKIEQHKDIPVILA
FT                   CADFVYSRSSGEILAKQGFNHVYVLREGIGGWRAANLPLVKK"
FT   gene            282146..282658
FT                   /locus_tag="D11S_0305"
FT   CDS_pept        282146..282658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0305"
FT                   /product="preprotein translocase subunit SecB"
FT                   /note="molecular chaperone that is required for the normal
FT                   export of envelope proteins out of the cell cytoplasm; in
FT                   Escherichia coli this proteins forms a homotetramer in the
FT                   cytoplasm and delivers proteins to be exported to SecA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81716"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576670.1"
FT                   /protein_id="ACX81716.1"
FT                   /translation="MTEENKEVANQEQEVQAVLQIQRIYVKDVSFEAPNLPHIFNQEWK
FT                   PRLSFDLSTETAKLGDDLYEVCLNISVETALEDSGDVAFICEVKQAGVFTISGLEEMQM
FT                   AHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYLQRQEQQAQEAGE
FT                   QSEPTVN"
FT   gene            282736..283746
FT                   /locus_tag="D11S_0306"
FT   CDS_pept        282736..283746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0306"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81717"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574927.1"
FT                   /protein_id="ACX81717.2"
FT                   /translation="MNTTIDFPITVLGAGSFGTALAIAFSRNGHSTYLWGHNPAKMQQL
FT                   QADRQNKAFLPEIVFPSSLVIEANLSKVIQTSKDLLLAVPSHCFGEILDEIRPHLRPDH
FT                   RIIWATKGLERDTGRLLEEVIKEKLGEQYPLAVLSGPTFAKELASGLPTAITLASDNEA
FT                   FARQFQARIHCSKHFRVYINNDMLGVQLGGAIKNVIAIGAGISDGIGFGANARTALITR
FT                   GIAEISRLGAALGANPNTFMGMSGLGDLVLTCTDNQSRNRRFGIMLGQGVSAQAAMENI
FT                   GQVVEGFYNTKEAHLLAQRHDIEMPITEQIYQVLFCGKAAKDAAVNLLGRERKGE"
FT   gene            283749..284546
FT                   /locus_tag="D11S_0307"
FT   CDS_pept        283749..284546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0307"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81718"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539579.1"
FT                   /protein_id="ACX81718.1"
FT                   /translation="MSLEVWQNIRQEAKQLVDNEPMLASFFHSTILKHHNLGSALSYIL
FT                   ANKLANTIMPAIALREIIEETYQAKPGIIECAACDIMAVRQRDPAVELLSTPLLYLKGF
FT                   HALQSYRITHYLWQQNRKALAIYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGET
FT                   SVIENNVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKILGNIEIGKYAKIGSNSVV
FT                   LQPVPEYATAAGVPARIIGKDKDAKPAFDMNQNFIDLGMELNI"
FT   gene            284746..285150
FT                   /locus_tag="D11S_0309"
FT   CDS_pept        284746..285150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81720"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539578.1"
FT                   /protein_id="ACX81720.1"
FT                   /translation="MQNQSLFSNRKFLFALFISLFFVFSCGNNTDKLEDKYLGEIQTNS
FT                   EYRYVIDIDKLANGKAIETSVKIAISPENSGITVRYLFNEQANLTQNLVIIEGKPQLQG
FT                   DIYIDLQWGIYGNMSYSPKLFKKRYSLKVK"
FT   gene            complement(285188..286201)
FT                   /locus_tag="D11S_0310"
FT   CDS_pept        complement(285188..286201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0310"
FT                   /product="fructose 1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81721"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576678.1"
FT                   /protein_id="ACX81721.1"
FT                   /translation="MNRALAIEFSRVTEVAALAGFAWLGRGDKNAADDAAVKAMRYMLN
FT                   LIHMDAEIVIGEGEIDQAPMLYIGEKVGSGMGELVSIAVDPIDGTRMTAMGQSNAISVL
FT                   AAGGKNTFLKAPDMYMEKLVVGPEVKGLIDLNLPIEQNLRRVASKLGKLLSDLSVMVLD
FT                   KPRHSAVIEKMHELGVRVFTIPDGDVTASVLCCLPEAEVDMVYGIGGTPEGVVAAAAIR
FT                   ALGGDMQVRLLPRDQVKGNTPENNALAAEEVRRCQEMGVEVNSVLQLEQLVRDDNLVFA
FT                   ATGITNGDLLKGIHRKGNLATTETLLIRGKSRTIRHIQSTHYLDRKDTVLYRLINA"
FT   gene            286397..286615
FT                   /locus_tag="D11S_0311"
FT   CDS_pept        286397..286615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0311"
FT                   /product="cell division protein ZapB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81722"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558212.1"
FT                   /protein_id="ACX81722.1"
FT                   /translation="MSLEILDQLENKIKQAVETIQLLQLEVDELREKSSRAQQENDALR
FT                   GENEQLRGEHQNIQERLRSLLGITDSI"
FT   gene            286672..287115
FT                   /locus_tag="D11S_0312"
FT   CDS_pept        286672..287115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0312"
FT                   /product="mioC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81723"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562792.1"
FT                   /protein_id="ACX81723.1"
FT                   /translation="MQPKICLITGSTLGGAEYVAEHLEGILQQQGFSTALLHGPSLDEV
FT                   INEKLWLVVTSTHGAGELPDNLKPLFDELKTGDADLSELRFAVIGLGNSDYDTFCFAVD
FT                   TVEQTLQAKSAVKIIDALRIDVLTETDQEQCAEDWLPNFLHHL"
FT   gene            287558..289447
FT                   /gene="gidA"
FT                   /locus_tag="D11S_0313"
FT   CDS_pept        287558..289447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="D11S_0313"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification protein"
FT                   /note="GidA; glucose-inhibited cell division protein A;
FT                   involved in the 5-carboxymethylaminomethyl modification
FT                   (mnm(5)s(2)U) of the wobble uridine base in some tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81724"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574929.1"
FT                   /protein_id="ACX81724.1"
FT                   /translation="MFYTETYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNIDTLGQI
FT                   SCNPAIGGIGKGHLVKEIDAMGGLMATAADKAGIQFRTLNSSKGPAVRATRAQTDRVLY
FT                   RQAVRIALENQPNLDIFQQEATDILIEQDRATGVVTKMGLKFHAKAVILTAGTFLAGKI
FT                   HIGLENYTGGRAGDPASVTLAQRLRDLNLRVDRLKTGTPPRIDARTINFDVLAKQHGDA
FT                   VLPVFSFMGSVSDHPQQIPCYITHTNEQTHDVIRNNLDRSPMYTGVIEGIGPRYCPSIE
FT                   DKVMRFADRNSHQIYLEPEGLTSNEIYPNGISTSLPFDVQMGIVNSMKGLEKARIVKPG
FT                   YAIEYDYFDPRDLKPTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKD
FT                   AWFPRRDQAYIGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLI
FT                   DEARWARFNQKMENIELERQRLRSIWLHPRSEYLEEANKVLGSPLVREANGEDLLRRPE
FT                   MNYEILTSLTPYQPAMEDKEAVEQVEIAIKYQGYIEHQEEEIEKQKRHENTAIPAQFDY
FT                   AKVSGLSNEVRAKLEQHRPVSIGQASRISGITPAAISIILVNLKKQGMLKRGE"
FT   gene            complement(289719..290576)
FT                   /locus_tag="D11S_0314"
FT   CDS_pept        complement(289719..290576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0314"
FT                   /product="NmrA family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81725"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562788.1"
FT                   /protein_id="ACX81725.2"
FT                   /translation="MINKTIAITGATGQFGAIALDLLKAKSVNVIALVRSPEKISGAQA
FT                   RKFDYLKVEGQVEALRGIDTLILVSSNEIGQRFVQHNNVIESAKKAGVKRIIYISFINV
FT                   NKENNVRLLSDEYVQTEAALKASGITYTILRNGWYTENHTASIPAALENNAFYGSAKEG
FT                   RISSALRAELAEAAVNVTLGEGHDNQTYELAGSTSWTLADLAAEISKQTGKDIPYVDLP
FT                   AADYSAALIKAGLPEDFARLTAECDVDASNGALFSEDKTLEKLIGRPTTRLDVAVQQAL
FT                   QLLP"
FT   gene            290728..291090
FT                   /locus_tag="D11S_0315"
FT   CDS_pept        290728..291090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0315"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81726"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005823979.1"
FT                   /protein_id="ACX81726.1"
FT                   /translation="MENIFERGNVLASDCPSRQILQHLTNRWGVLVLVSLYSGTKRFSE
FT                   LRRAIDGVSERMLTKTLQELEADGMLVRKSYNTVPPQVDYTLTEFGSEASSKMFELVDW
FT                   LETNLTGILQQQAKNA"
FT   gene            291149..291766
FT                   /locus_tag="D11S_0316"
FT   CDS_pept        291149..291766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0316"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81727"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555008.1"
FT                   /protein_id="ACX81727.2"
FT                   /translation="MKAKLDSLLAQAKIQPNDQQKQQLIDFVNLLNKWNKAYNLTSVRD
FT                   PQDMLVKHILDSLVVSPHLQGDRFIDVGTGPGLPGLPLAIINPDKQFVLLDSLGKRISF
FT                   IRNAVRELGLTNVKPVLSRVEEYQPEEKFDGVLSRAFASLKDMTEWCWHLPKPDGMFYA
FT                   LKGIYQQEEAQNLSDQFQIENVISIEVPTLIGERHLILLTKK"
FT   gene            291878..292255
FT                   /locus_tag="D11S_0317"
FT   CDS_pept        291878..292255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0317"
FT                   /product="ATP synthase F0F1 subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81728"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568543.1"
FT                   /protein_id="ACX81728.1"
FT                   /translation="MSRVLAQARAKYKKSIYIEFFVGLVLSSIIALLANTQSAVDFCLG
FT                   FFAAFIPFFIFVYVVFYRNQDLSKKLTALYRGEAIKFVLTILLIIFSFKWLSVTYFIVF
FT                   FTGFFTALMLNNIIPFLLNRS"
FT   gene            292280..293068
FT                   /locus_tag="D11S_0318"
FT   CDS_pept        292280..293068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0318"
FT                   /product="ATP synthase F0F1 subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81729"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704855.1"
FT                   /protein_id="ACX81729.1"
FT                   /translation="MSEQTTSEYIGHHLSFLKTGDGFWNIHVDTLFFSILSAVIFLFIF
FT                   RRVAKKATPGVPGKLQCLVEILVGWVNGIVKENFHGPREVVAPIALTIFCWVFIMNAID
FT                   LIPVDFLPQLAGLFGIHYLRAVPTADISATLGMSICVFFLILFYTVKSKGVSGLVKEYT
FT                   LHPFNYWAFIPVNFILETVTLLAKPISLGFRLFGNMYAGELIFILIAVMYSANMAIAAL
FT                   GIPLHLAWAIFHILVITLQAFIFMMLTVVYLSIAYNKAEH"
FT   gene            293122..293376
FT                   /locus_tag="D11S_0319"
FT   CDS_pept        293122..293376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0319"
FT                   /product="ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81730"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539567.1"
FT                   /protein_id="ACX81730.1"
FT                   /translation="METVITATIIGASILLAFAALGTAIGFAILGGKFLESSARQPELA
FT                   SSLQTKMFIVAGLLDAIAMIAVGISLLFIFANPFIGLLQ"
FT   gene            293426..293896
FT                   /locus_tag="D11S_0320"
FT   CDS_pept        293426..293896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0320"
FT                   /product="ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81731"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A5UA07.1"
FT                   /protein_id="ACX81731.1"
FT                   /translation="MNLNATLIGQLISFALFVWFCMKFVWPPIIKAIETRQSQIANALA
FT                   SAEVAKKEQADTKALVEQEISKAKIQAQEILDDANKRRNEVLDEVKNEAEELKAKIIEQ
FT                   GYAEVEAERKRVQEELRVKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL"
FT   gene            293910..294458
FT                   /locus_tag="D11S_0321"
FT   CDS_pept        293910..294458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0321"
FT                   /product="ATP F0F1 synthase subunit delta"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane; the delta subunit is part of
FT                   the catalytic core of the ATP synthase complex"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81732"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562779.1"
FT                   /protein_id="ACX81732.1"
FT                   /translation="MSELTTIARPYAKAAFDFAVEQRSVDKSAVGKWGEMLGFLAEVVE
FT                   NDTMKDFLTSSFSAQKLADTVIAICGEQINQYGQNLIRLMAENKRLTVLPAVFKEFRHY
FT                   VEEYNAITEVQVTSAQPLSVAQQEKIAAAMEKKLARKIKLNCNIDNSLIAGVIIRTDDF
FT                   VIDGSSRGQLTRLANELQL"
FT   gene            294471..296012
FT                   /locus_tag="D11S_0322"
FT   CDS_pept        294471..296012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0322"
FT                   /product="ATP F0F1 synthase subunit alpha"
FT                   /EC_number="3.6.3.14"
FT                   /note="produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane; the alpha chain is a
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81733"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005702425.1"
FT                   /protein_id="ACX81733.1"
FT                   /translation="MQLNSTEISELIKKRIAQFNVESEARNTGTIVSVSDGIIRIHGLS
FT                   EVMQGEMIALPGNRYAMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLL
FT                   GRVVNTLGQPIDGKGEIENDGFSPIEVIAPGVIERKSVDQPVQTGYKAVDSMVPIGRGQ
FT                   RELIIGDRQTGKTALAIDTIINQRNSGIKCIYVAIGQKASTIANVVRKLEEHGALANTI
FT                   VVAASASESAALQYLAPYAGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERASRVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQ
FT                   YRELAAFAQFASDLDDATRKQLSHGEKVTELLKQKQFAPLSVAEQAVVLFAVEFGYLED
FT                   VELSKIASFETALLDYANRNYAEFMQELTKTGNYNDEIKDTLKGILDSFKANSAW"
FT   gene            296028..296897
FT                   /locus_tag="D11S_0323"
FT   CDS_pept        296028..296897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0323"
FT                   /product="ATP F0F1 synthase subunit gamma"
FT                   /EC_number="3.6.3.14"
FT                   /note="Produces ATP from ADP in the presence of a proton
FT                   gradient across the membrane. The gamma chain is a
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81734"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006995166.1"
FT                   /protein_id="ACX81734.1"
FT                   /translation="MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPY
FT                   SETIRNVISHVSKASIGYKHPFLVEREVKNVGILVISTDRGMCGGLNVNLFKATLNQIK
FT                   DWKAQNAATVLGLIGSKGISFFRSLGFNVKGQLSGLGDNPALEELIGVANAMFDAYRNG
FT                   EIDAIYIAYNKFINTMSQKPVIQQLVPLPEMENDHLSERQQAWDYIYEPDPKVLLDSLL
FT                   VRYLESQVYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNE
FT                   IVAGAAAI"
FT   gene            296914..298287
FT                   /locus_tag="D11S_0324"
FT   CDS_pept        296914..298287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0324"
FT                   /product="ATP synthase F0F1 subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81735"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574936.1"
FT                   /protein_id="ACX81735.1"
FT                   /translation="MATGKIVQIIGAVIDVEFPQDAVPKVYDALKVETGLTLEVQQQLG
FT                   GGVVRCIALGASDGLKRGLKVENTNDPIQVPVGTKTLGRIMNVLGEPIDEQGPIGEEER
FT                   WSIHRSAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRN
FT                   IAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGL
FT                   TMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERIT
FT                   STKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSR
FT                   QLDPLVVGQEHYNVARGVQGILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLS
FT                   QPFFVAEVFTGSPGKYVPLKETIRGFKGILSGEYDHIPEQAFYMVGSIDEALEKAKNM"
FT   gene            298329..298757
FT                   /gene="atpC"
FT                   /locus_tag="D11S_0325"
FT   CDS_pept        298329..298757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="D11S_0325"
FT                   /product="ATP synthase F0F1 subunit epsilon"
FT                   /EC_number="3.6.3.14"
FT                   /note="part of catalytic core of ATP synthase;
FT                   alpha(3)beta(3)gamma(1)delta(1)epsilon(1); involved in
FT                   producing ATP from ADP in the presence of the proton motive
FT                   force across the membrane"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81736"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562772.1"
FT                   /protein_id="ACX81736.1"
FT                   /translation="MATFNLTVVSAEQQIFSGNVKSVQATGIEGELGVLPGHAPLLTAI
FT                   KPGIVKLTLENDSEEVIYVSGGFLEVQPTAVIVLADIAIRGQELDSERIIAAKKRAEEN
FT                   IRQHHHDADYEVLMSKLSKELAKLRAYELTEQLVKSKR"
FT   gene            complement(298818..299864)
FT                   /locus_tag="D11S_0326"
FT   CDS_pept        complement(298818..299864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0326"
FT                   /product="spermidine/putrescine ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81737"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005571140.1"
FT                   /protein_id="ACX81737.1"
FT                   /translation="MKNLFAKTLKSLCFALTFLSITAFAQEKLYVYNWTDYVPSNLIAE
FT                   FTKETGIEVIYSTFESNEEMYAKLKLISDNAGYDLVFPSSYYVNKMVQDGMLQKLDHGK
FT                   LSNFKQIPDNLLHKDFDPNNDYSLPYVYGLTGIAVNSEDVDVSKITSWSDLWNPEYKGK
FT                   VLLTSDAREVFHVALLLDGKSPNTTNEDEIKAAYERLEKLLPNVAVFNSDSPEVPYVQG
FT                   EVALGMIWNGSAYMAHRENENIQFVYPKEGAIFWMDNYAIPKSAKNVENAYKFINFLLR
FT                   PENAKVVLERLGYSMPNNGVKALISPEMANNPTLFPPEEQVKKGIIQGDVGNAIDIYEK
FT                   YWNKLKTN"
FT   gene            300170..302311
FT                   /locus_tag="D11S_0328"
FT   CDS_pept        300170..302311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0328"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81739"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546278.1"
FT                   /protein_id="ACX81739.1"
FT                   /translation="MFQTHNENSRVKIPAVLHLMRLGYRYLSLKTATWDRQTNIFPDIF
FT                   TESLCRINAGLSEDDARRLLTDITIELDNEDLGRQFYERLISRSGIKLIDFQNFDNNRF
FT                   HVVTELPCINGDEEFRPDITLLVNGIPLIFVEVKKPNNKGGIGAERERMAKRAQNPKFR
FT                   RFINITQFMIFSNNMEYDDGATEPVQGAFYSSSAYGSPAFNYFREEHKLNLAELLNTLS
FT                   DDLENTVLQDNNLSVIKHNPEFISNKSPDTPTNRILTSLLCRDRLAFLLQYGFAYVETQ
FT                   NGIKKHIMRYPQLFAAYATEKHLTNGGKKGVIWHTQGSGKTALAYYSTRYLTRYYAKQG
FT                   IVPKFYFIVDRLDLLKQAQQEFTARDLIVHTIDSREAFAADIKSAQTLHNHSGKAEITV
FT                   VNIQKFKDDPDVVTKSDYDLSIQRVYFLDEVHRSYNPKGSFLANLNQSDVNAVKIGLTG
FT                   TPLIGVTAGSVNTRELFGDYIHKYYYNASIADSYTLRLIREAISSQYKAQLQATLAQLE
FT                   IEKGSIERKAIYAHPHFVRPMLDYILDDFAKFRKTNQDDSLGAMIICDSAEQARQMYAY
FT                   FQTTSDHKLTAALILHDVGAKDERDQWVKDFKASKTDLLFVYNMLLTGFDAPRLKKLYL
FT                   GRLIKAHNLLQTLTRVQTLPLRLRRRFRRHTKRIRQNQPRLLGRTNQRTGRRNRQLQPT
FT                   FQNRRRNRTGNRRHQSRPL"
FT   gene            302376..303158
FT                   /locus_tag="D11S_0329"
FT   CDS_pept        302376..303158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81740"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576694.1"
FT                   /protein_id="ACX81740.1"
FT                   /translation="MLTLKKALQTAKELYNILRLQGDYEFLEHLDFDKLNLLYRETAAR
FT                   IDTLNLAEKLQQGDTAHLLNEALEDIYFQFVKTGEAELKLADDLKDIMRKVREGLAGNF
FT                   DQVDPEFISLREELERIFKKKNLAEVGQDDMKTNIGILETVYAKIKELNRKNDLLRHKY
FT                   GGDAKYARTHKRLLENPVLYGDKQKVFDALNGVKTDADQKVLDMAQILDNQNYFEKQMQ
FT                   GIVLKRFRTEQKFPVQPADIQVINRLLVREYLKESGRI"
FT   gene            303207..304196
FT                   /locus_tag="D11S_0330"
FT   CDS_pept        303207..304196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0330"
FT                   /product="2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81741"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167521.1"
FT                   /protein_id="ACX81741.1"
FT                   /translation="MHDNDIIIYTTEDGLSEFTLRELDGELWLTQKEIAELYQTSKQNI
FT                   SKHIKTIFDENEMDEQATVNFQLTVQNESGREVSRKIALYPLSLIIAIGYRVRSTRGTQ
FT                   FRQWATRTLGEYISKGFVLNDDRLKNPPVGTSRAEDQFEQLLNRIRDIRSSERRMYLRV
FT                   REIFAMAADYQHSFKETNAFFKTIQNKLHYACTLHTAPEIIYQRADAEKPNMGLTHWRG
FT                   KADTTVAKNYLNEAEIDALNRIVSMWLDFAEDQATRKKQIFLQDWTEKLDAFLTFNDRR
FT                   VLQNAGTVSKTQADEKACIEYEKFAAARRLEKEREGERHIAELLNLKK"
FT   gene            304405..305358
FT                   /locus_tag="D11S_0331"
FT   CDS_pept        304405..305358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0331"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81742"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574942.1"
FT                   /protein_id="ACX81742.1"
FT                   /translation="MNELQDCILGDLVEFQRGYDLPKDAFVKGEYPVQSSNGILGYHNE
FT                   YKVKAPGITIGRSGTVGIPHLITKNFFPHNTALYVKDFKGNNVQYIYYLLKNLKLNEYK
FT                   TGSGVPTMNRNHLHPLKIRAFTNLKTQQSIAAVLSALDKKIALNKQINARLEEMAKTLY
FT                   DYWFVQFDFPDANGKPYKSSGGEMVFDETLKREIPKGWEVKSLGDWAEIKKGTLITEKT
FT                   ANTNGDIKVISAGLDFSYYHDVANRPKNTITISASGANAGFVNFWREPIFVCDCTTITN
FT                   SVIGSTLYILNFLRIVQDFIYQQARGSAQPHVSKRY"
FT   gene            305339..305533
FT                   /locus_tag="D11S_0332"
FT   CDS_pept        305339..305533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0332"
FT                   /product="restriction endonuclease subunit S"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81743"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541724.1"
FT                   /protein_id="ACX81743.1"
FT                   /translation="MYPKDIEGLKIIVPPDFLLKRFSEFVENWNLKIVNSEKQNHQLTQ
FT                   LRDFLLPMLMNGQVAVAEE"
FT   gene            305634..307238
FT                   /locus_tag="D11S_0333"
FT   CDS_pept        305634..307238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0333"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81744"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001558627.1"
FT                   /protein_id="ACX81744.1"
FT                   /translation="MTELYFTEQTKTLIDSLKTICAHYGLGNDGNEFKIISQAFLYKFL
FT                   NDKYDFEVKKILEEKPGEPMEFVDMEIQSKTAVLKPEHSIRYLSQRQNDADFAKLFDDT
FT                   LIDIAAHNAEVFAVKTEGGAKIVLFERISQYIADENRRDDFCRALISKLADFSFEAVFA
FT                   QKFDFFATIFEYLIKDYNSNSGGKYAEYYTPHAVARIMADILVPQDVRGQIRSVDVYDP
FT                   SAGSGTLLMNVAHAIGEDKCMIYTQDISQKSSNLLRLNLVLNNLVHSLNNVIQGNTILS
FT                   PYHKDKVGRLKKFDFIVSNPPFKLDFSDFRDQLDSAENRERFFAGIPKIKAKDKDKMEI
FT                   YQLFIQHILFSLKENGKASIVLPTGFITAQSGIDRKIREYLVENKMFAGVVSMPSNIFA
FT                   TTGTNVSILFIDKANKDQVVLIDASGLGEKIKDGKNQKTVLSREEEQKICQTFTDKQVV
FT                   ENFSVVVGYDEIQAKNYSLSAGQYFEVKIDYVDISADEFEQKMAGFSADLDRLFAESAE
FT                   LGREIGERLRVLRLGGK"
FT   gene            complement(307419..308255)
FT                   /locus_tag="D11S_0334"
FT   CDS_pept        complement(307419..308255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0334"
FT                   /product="PTS N-acetylgalactosamine transporter subunit
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81745"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568557.1"
FT                   /protein_id="ACX81745.2"
FT                   /translation="MTTEVRKVTKSDLNAVVMRSNLFQGSWNFERMQALGFAYSMVPVI
FT                   KRLYPVQDSQERKDAIKRHLEFFNTQPFVGAPVLGVAIAMEEQRANGKPVEDAAINGIK
FT                   VGLMGPLAGVGDPIYWGTARPVFAALGAGLALNGSILGPILFFVLFNLVRLATRYYGVI
FT                   YGYRKGLDVVSDMSGGLLQKLTEGASILGLFIMGALVQKWTSINVPLVVSTIKKQNGTV
FT                   EVTTVQSILDSLMPGLLALLLTFACMWLLRNRVNALWIIVGFFVIGIFGAWTGTLA"
FT   gene            complement(308271..309074)
FT                   /locus_tag="D11S_0335"
FT   CDS_pept        complement(308271..309074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0335"
FT                   /product="PTS mannose transporter subunit IIC"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; the IIC domain forms the PTS system
FT                   translocation channel and contains the specific
FT                   substrate-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81746"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590014.1"
FT                   /protein_id="ACX81746.1"
FT                   /translation="MEITTLQIILVFLVACICGAGSILDEWQTQRPLIACTLIGLVLGD
FT                   IQTGIIIGGTLELLALGWMNIGAAVAPDAALASVISTILVIVGKQEISTGIAVAIPLAA
FT                   AGQVLTYIVRAITVGFQHAADKSVEDGNLTRLDWLHCSALMLQAMRIAIPALIVALTAG
FT                   TDEVQSMLNAIPDVVTTGLKIAGGFIAVVGYAMVINMMRAGHLMPFFYAGFVIAAYTEF
FT                   NLVALGVLGIVMAVLYIQMHPKYNQSKQVVQVTTAAGNDLDNRLD"
FT   gene            complement(309086..310084)
FT                   /locus_tag="D11S_0336"
FT   CDS_pept        complement(309086..310084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0336"
FT                   /product="PTS mannose transporter subunit IIAB"
FT                   /note="catalyzes the phosphorylation of incoming sugar
FT                   substrates concomitant with their translocation across the
FT                   cell membrane; subunit IIA transfers a phosphoryl group to
FT                   subunit IIB; subunit IIB transfers the phosphoryl group to
FT                   the substrate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81747"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573041.1"
FT                   /protein_id="ACX81747.1"
FT                   /translation="MTIAIIIATHGVAAEQLLKTTEMLIGEQENVATIDFVPGENAETI
FT                   MEKYQAKLSGDLAHCDKVLFLVDTWGGSPFNAANRVSEGKDNMDIVTGVNVPMLVETFM
FT                   ARDDGPSLDELVAIALETGRTGVRALRYQEPETEPTAPTSEVPAQPAASQAEPQPAVVT
FT                   PNQEGHLEIGLARIDDRLIHGQVATRWTKESRVSRIAVVSDEVAKDTVRAAMLKSVAPP
FT                   GVTAHVVNVDKMVRVYNNPEYAGERMMLLFTNPTDVLRLSDAGVDFKSINVGGMAYRDG
FT                   KKMITNAVSVDDKDIAAFKALDAKGIELDVRKVSNDNRQYMMDLLKKNNLL"
FT   gene            310436..311827
FT                   /locus_tag="D11S_0337"
FT   CDS_pept        310436..311827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0337"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81748"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576709.1"
FT                   /protein_id="ACX81748.2"
FT                   /translation="MSERQHYRNLALIAAMALFMQSLDATILNTALPAISADLHESPLE
FT                   MQMTIISYSLTVALFIPLTGWIADKYGTLNVFRVAMTTFVLGSVACAVSNSLNALIWSR
FT                   VLQGLGGALMMPVARLAIIRNVPKTQLVAAWNAMAMAGLIGPVLGPIVGGWLVTHATWH
FT                   WIFLINIPIGLLGVWFAGRHMPNSTGNIGKLDWRGFVLFAGGLAGLTLGLDLLSEDRVS
FT                   QWMTALILAAGIGCFSIYYFYARRAQYPLLSLNIFAVRTFRVGIVANLFIRLSGSGIPF
FT                   LMPLMLQVVFNYGADAAGWLLAPIAVSSVLTKSFAGKVLSRFGYKTTLILTALSMTFAI
FT                   ATMSLLDQQSPIWLLVLILAWYGCSMSIIFTAVNTLTISDLNDHNASTGSTYLSVIQQV
FT                   GIGISIAVSSVILDLYRHFIGENGTQLQHAFSATFLTSALFGIALLWVLSYLKSEDGEG
FT                   NFRKG"
FT   gene            complement(311854..313026)
FT                   /locus_tag="D11S_0338"
FT   CDS_pept        complement(311854..313026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0338"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81749"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546256.1"
FT                   /protein_id="ACX81749.1"
FT                   /translation="MNNQKYYRIALLFNANKIYDREVVEGVGQYLQASQCMWDIFVEDE
FT                   FIYHKDTINNLSIDGIIADFDDAETVELLKNISIPLIAVGGSYQNPAFYPNLPYVATDN
FT                   YALVETAFLHLKQKGITSFAFYGLETEETKHWANERKDAFLALMQKYEFQSAVYLGDKT
FT                   DSQNWAQEQAKVTDWLKTLPPHTGIIAVTDARARHILQACETAGIAVPEQLCVIGIDNE
FT                   ELIQYLSRVSLSSVAQGTREIGYQAAKLLHRLLTGQKVAATPLLIPPVKVIERSSTDYR
FT                   SLRDPLVMQAMHYIRHRACQGIKAEQVLDYLRTSRSNLEARFKAEMNKTIHQVIHEEKI
FT                   TRAKQLLRRSDIPIQEISDICGYPSLQYFYSVFKKEFNQTPKEFRNREGK"
FT   gene            complement(313141..314550)
FT                   /pseudo
FT                   /locus_tag="D11S_02320"
FT                   /note="sodium:proton antiporter; disrupted"
FT   gene            complement(314537..315733)
FT                   /locus_tag="D11S_0342"
FT   CDS_pept        complement(314537..315733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0342"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81753"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576714.1"
FT                   /protein_id="ACX81753.1"
FT                   /translation="MEIKFDQWVNRIGTDSAKWDVPYSKYGSDIIPLSVADMDLPAPQE
FT                   IIELLNERNRLGIYGYTIISDDYYPLITDYFKRHYAYYASPEDIVFCPRIIQAVSIYIR
FT                   EFTTENDTICLFTPSYSPMLNAVLLNNRKLSQCPLVYYNQKYHIDFKKLEICFSHSDVF
FT                   ILISPHNPTGLVFSIQDLNRIALLAEKYHVFIISDDIHADFDFSGEKHHIISSINHYVK
FT                   EHSIICTSPSKTFNLAGLEISNLIIHNHVIRNKFNRLLQQLGIHNPNYFSIPAIKAAYR
FT                   NGDVWLRELQQYILENKQFVKRFFTAHIPELDVADTTGTYLVWVNYSRLKIDEQLLKHW
FT                   LLHLARVEMSWGSDFGEDGNRFFRMNIAVPRSCLISCLNRIKQAFLLLKKEGYCYAAQ"
FT   gene            complement(315743..316810)
FT                   /locus_tag="D11S_0343"
FT   CDS_pept        complement(315743..316810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0343"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81754"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546248.1"
FT                   /protein_id="ACX81754.1"
FT                   /translation="MSKLKSINLQVYIMLIAIVVIMAFFFVATDGAYLSARNISNLLRQ
FT                   TSITGILAIGMIFVIISAEIDLSVGSLMGLLGGFAAIADVWWGWPLPLTIITTLLIGIV
FT                   LGACTGWWVAYRKVPSFIVTLAGMLIFRGMLVGATNGTTVSPIIKDMTIIGQGYLPDTT
FT                   GIILGCVAVICFFLWGSYQRKTRKNLNLSVTGTGKETMKYGLFAIGVLGAIYLLNDYRG
FT                   IPFPVLLLAILAVIGMFIARKTAFGRHIYAIGGNIEAARLSGINVEKIKLMIFSINGLM
FT                   VAIAGLILSARLGAGAPSAGQNAELDAIAACVIGGASLAGGVGSVYGVVIGALIIALLD
FT                   NGMSMLDVPIIMLSP"
FT   gene            complement(316814..318325)
FT                   /locus_tag="D11S_0344"
FT   CDS_pept        complement(316814..318325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0344"
FT                   /product="xylose transporter"
FT                   /note="with XylFH is part of the high affinity xylose ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81755"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518409.1"
FT                   /protein_id="ACX81755.1"
FT                   /translation="MALLEMKNITKKFGDVVALNNISISLEKAEILSLCGENGSGKSTL
FT                   MKVLCGIYPFGDYEGDIYFSDEKIVAKNIKDTEEKGISIIHQELTLVKNMSILENMFLG
FT                   NEITKGGITDDNEMYLRCKKLLEQVQLDIDPHTKVGELGLGQQQLVEIAKALNKQVRLL
FT                   ILDEPTASLTEKETAILLNLVKDLRAHNIACIYISHKLNEVKEISDKICVIRDGEHIGT
FT                   RDAKTMTEDDIITMMVGREITSLYPHEAHEIGEEILRVEHITAWHPINTHIKRVSNASF
FT                   TLHKGEILGVAGLVGSGRTEMVQCIFGSYPGKHEGEIFIHNHKVKIRNCSEAIKHNIVM
FT                   VPEDRKKHGIVAIMGVGKNITLPSLRNYCFGKRVINEALEETVINQAIAQLKVKTSSPH
FT                   LAIGRLSGGNQQKAILAKSLLLKPQILILDEPTRGIDVGAKYEIYKLINQLAQEGIAII
FT                   VISSELPEVLGISDRVLVMHQGQIKADLINNHLTQEQVMEAALKE"
FT   gene            complement(318385..319383)
FT                   /gene="xylF"
FT                   /locus_tag="D11S_0345"
FT   CDS_pept        complement(318385..319383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylF"
FT                   /locus_tag="D11S_0345"
FT                   /product="D-xylose transporter subunit XylF"
FT                   /note="periplasmic substrate-binding component of the
FT                   ATP-dependent xylose transport system; high affinity"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81756"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576719.1"
FT                   /protein_id="ACX81756.1"
FT                   /translation="MKIKFALLSLAAALALCSTTGFAKDLKIGMSIDDLRLERWQKDSS
FT                   IFVKKAEALGAKVYVQSANGDDSAQISQIENMINKNIDVLVIIPHNGEVLSNVIAEAKK
FT                   EGIKVLAYDRLINNADLDFYVSFDNEKVGELQAQSVIEKKPEGNYFLMGGSPVDNNAKL
FT                   FRKGQMKVLQPLIDSGKIKVVGDQWVDSWLPEKSLQIMENTLTANKNNIDAVVASNDAT
FT                   AGGAIQALSAQGLSGKVAISGQDADLAAIKRIVEDTQTMTVYKPIALLADKAAEISVAL
FT                   AKDEKPQSNAELNNGLKNVPSYLLEPIVVDKNNIETTIIKDGFHSKDSIYK"
FT   gene            319641..320960
FT                   /locus_tag="D11S_0346"
FT   CDS_pept        319641..320960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0346"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="catalyzes the interconversion of D-xylose to
FT                   D-xylulose"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81757"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518408.1"
FT                   /protein_id="ACX81757.1"
FT                   /translation="MTNYLNNIDKVRYEGPDSTNPFAYKYYDANQVTLGKTMAEHLRLA
FT                   VCYWHTFCWNGTDMFGLGSLDRSWQKNAGTLEAAKQKADIAFEFFTKLGVPYYCFHDVD
FT                   VAPEGNSIKDYIHNFNTITDILERKQAETGVKLLWGTANCFSHPRYMSGASTNPNPEVF
FT                   AWAATQVYHAMNATKRLGGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHN
FT                   IGFNGTLLIEPKPQEPTKHQYDYDVAMVYGFLKQFGLENEIKVNIEANHAILAGHTFQH
FT                   EVATAFALDIFGSIDANRGDPQLGWDTDQFPNSVEENTLVMYEILKNGGFTTGGFNFDA
FT                   KIRRQSTDPYDLFYAHIGAIDVLALSFKRAAQILEEQRLQQIVDARYAGWRQSLGQQIL
FT                   QGNASLAQLAQAVEQQGLDPQPVSGKQEYLENLVNGYIYR"
FT   gene            321009..322481
FT                   /locus_tag="D11S_0347"
FT   CDS_pept        321009..322481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0347"
FT                   /product="xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81758"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574958.1"
FT                   /protein_id="ACX81758.1"
FT                   /translation="MYLGVDCGTQGTKVIVVDSQQHKVLGSGYAAHQLIENSDGRREQA
FT                   PDWWITAFKNAFADAIKQAEIQPHLIRGIGISGQQHGLVVLDKNNQPLYHAKLWCDTET
FT                   ASENAEILALFGGEQACFERLGIVCQTGYTASKIRWLRKYQADIYQQIDKIMLPHDYLN
FT                   YWLTGKFCTEYGDASGTGYFDVVRRCWDEEVLRLIAPEKCLENLPHLIDADQILGTVKA
FT                   DVARQLGLENDVIVSAGGGDNMMGAIGTGNIQQGIVTMSLGTSGTLYAYSDKPLPDLPP
FT                   MIADFCSSSGGWLPLVCTMNVTSANKNLMQLLEINVSEFNELVQQANIGADGVTILPFF
FT                   NGERVPALPNSKAAILGLDAGNFTRANLSRAVMESASFTLRYGLDLFEQAGLAATEIRL
FT                   IGGGAKSAVWRQMIADIMNVNVVCLMEEEAAALGAAIQAMWANKQGSLAELCRAFVQLN
FT                   EATRTAPIAENAEQYQSVYQRYRQHLNAQYSV"
FT   gene            322920..323283
FT                   /pseudo
FT                   /locus_tag="D11S_02325"
FT                   /note="transposase; disrupted"
FT   gene            323287..324093
FT                   /locus_tag="D11S_0351"
FT   CDS_pept        323287..324093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0351"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81761"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167546.1"
FT                   /protein_id="ACX81761.1"
FT                   /translation="MKPNHALNDLLRWAKMPRSTFYYQQVKHDYREIKETILLRYKRNR
FT                   KRDGYRPMTLKLRQMGFHLNHKTVLKLMNALGIHSILRKKRHGKRGKTSHIAPNVLNRD
FT                   FTATALNQKWVTDVTEFRVGEEKLYFSPLMDLANREIIAYNFAKRPKFSLVKRMPEEGL
FT                   GKLKPSECPIIHSDQGVLYGSAEWVKMLEGKAIQSMSRRGNCYDNAVIESFFAILKSEC
FT                   FYSRTYTSIAELQAEIEEYLVYYNQERIKLDLKGLSPVQYRAQYLS"
FT   gene            complement(324133..325500)
FT                   /gene="pssA"
FT                   /locus_tag="D11S_0352"
FT   CDS_pept        complement(324133..325500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="D11S_0352"
FT                   /product="phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /note="catalyzes de novo synthesis of phosphatidylserine
FT                   from CDP-diacylglycerol and L-serine which leads eventually
FT                   to the production of phosphatidylethanolamine; bounds to
FT                   the ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81762"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541259.1"
FT                   /protein_id="ACX81762.1"
FT                   /translation="MFTDKIERARKRLESLPCLPLQPEQVEFIYSPAAFKSEIIQLTRQ
FT                   AKTRIIVTALYWQNDEAGQEILDEIYRAKQDKPELEVKILIDWHRAQRNLLGAEKSATN
FT                   ADWYYETRQKYQLAEDPHMFFGVPINTREVFGVLHIKGFVFDDTVLYSGASINNVYLQK
FT                   NEKYRYDRYQKITHPVLANTMVNFVRQNLLDADVVLPLDAANPPKTKEIRGNIRAFRKN
FT                   LAAYGQYQLPSAVSFGDELTITPLFGLGGAGNILNSTIEDLFQLVEEKLTICTPYFNFP
FT                   NTLQQKIRYLLGKGKQIEIIVGNKVANDFYIPPDQPFKMAGALPYLYESNLRRFSKKFE
FT                   REITQGQLTVRTWKDGDNTYHLKGVWVDKSYILLTGNNLNPRAWRLDAENGLFIHDPKQ
FT                   QLRPQVLNELEHIRRHTTVLRHYTELEELNQYPAPVQKLLKKFAHIKADKLVKMIL"
FT   gene            325686..326762
FT                   /locus_tag="D11S_0353"
FT   CDS_pept        325686..326762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0353"
FT                   /product="rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81763"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589264.1"
FT                   /protein_id="ACX81763.1"
FT                   /translation="MNQHSNKPTFKSTNKTFQETSFNERSVGADRKKRDKNRLHFNAPN
FT                   AARPEFKKNQGKNPPFKRADSQEKTLRISESTMKKAGGAEGGVKVMVKSSQFDDKPREK
FT                   KTGPLSPRAPEKIKKNRAEEMKVYGENACLALFEQRPASIVRLWAKVQMAHKIGDICSY
FT                   LAANKKVYHIVESDELTKVSGTEHHGGICMLVKKSYPFTLQGYLDVPHQEDCLVLLDGV
FT                   NNAQNIGGILRTCAFFGVKNMVLEEAESLNSAVTLRVAEGGAEYVRVLETDDSRNALAQ
FT                   LRHAGYQIIHVSNDKNSTALDKVRLKNKTVFVLSEGSTETLAEKSDEQVRLSFGNPLKN
FT                   GLNVSVNAGILLAKWYFR"
FT   gene            complement(326828..327088)
FT                   /locus_tag="D11S_0354"
FT   CDS_pept        complement(326828..327088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0354"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81764"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_011199429.1"
FT                   /protein_id="ACX81764.2"
FT                   /translation="MALFITDKCTNCDMCLPECPNEAISIGDEIYVIDPNLCTECVGHY
FT                   DTPTCQKVCPISKCIITDPDHIETEEQLWERFVLIHHADKL"
FT   gene            327156..327851
FT                   /locus_tag="D11S_0355"
FT   CDS_pept        327156..327851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0355"
FT                   /product="ribonuclease T"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81765"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589265.1"
FT                   /protein_id="ACX81765.1"
FT                   /translation="MNEKRMLLLSFFVVAFLMFLLAGWYYFSKQKQAVGVVIDRDYDYI
FT                   MKNDPIGQNKKVRTDYYTLVLSWSPAFCERQRKQYGDDLPNSLQYQCGLTQQFGWIVHG
FT                   LWSQNEQARRVSDHPRFCQGDLPKLPQELIEQYLPEMPGANLIQGEWEKHGSCMFNNAQ
FT                   DYLEKIKNLYRTLKLPNYELSRNELFTWIKKNNPQLKGRYLGAARNELFICYGLDWQPI
FT                   DCPRNRTGY"
FT   gene            327964..329127
FT                   /locus_tag="D11S_0356"
FT   CDS_pept        327964..329127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0356"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81766"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589266.1"
FT                   /protein_id="ACX81766.1"
FT                   /translation="MSVIKMTDLDLNGKRVFIRADLNVPVKDGKITSDARIRATIPTLK
FT                   LALEKGAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLNEHLDVPVRLVRDYLDGVDVKPG
FT                   EIVVLENVRVNKGEKKNDPELGKKYAALCDVFVMDAFGTAHRAQASTYGVAEFAPIACA
FT                   GPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLEVLNSLSKIADQIIVGGGIANTFI
FT                   AAAGHNVGKSLYEADLIPVAKELAASTDIPVPVDVRVGTEFSETAPATEKSVTEVKDDE
FT                   SIFDIGDKSAEQLADIIKNAKTVLWNGPVGVFEFPNFRKGTEIISRAIANSDAFSIAGG
FT                   GDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVEILEKRAKN"
FT   gene            329192..330271
FT                   /locus_tag="D11S_0357"
FT   CDS_pept        329192..330271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0357"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="catalyzes the formation of glycerone phosphate and
FT                   glyceraldehyde 3-phosphate from fructose 1,6, bisphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81767"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005702948.1"
FT                   /protein_id="ACX81767.1"
FT                   /translation="MAKLLDIVKPGVLTGEDVQKVFAYAKEHGFAIPAVNCVGSDSVNA
FT                   VLETAARVKAPVIIQFSNGGAAFYAGKGIKPAGGARPDVLGAIAGAKHVHALAKEYGVP
FT                   VILHTDHAAKKLLPWIDGLLDAGEKHFAETGRPLFSSHMIDLSEEPMEENMAICREYLA
FT                   RMSKMGMTLEIEIGITGGEEDGVDNSDVDESRLYTQPSDVLYVYDQLHPVSPNFTVAAA
FT                   FGNVHGVYKPGNVKLKPSILGASQEFVAKERNLPAKPINFVFHGGSGSSREEIREAIGY
FT                   GAIKMNIDTDTQWASWNGILNFYKANEAYLQGQLGNPSGPDAPNKKYYDPRVWLRKMEE
FT                   SMSKRLEQSFEDLNCVDVL"
FT   gene            330479..331621
FT                   /locus_tag="D11S_0359"
FT   CDS_pept        330479..331621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0359"
FT                   /product="RfaL protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81769"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544824.1"
FT                   /protein_id="ACX81769.2"
FT                   /translation="MGVIFFIYRQLCKPKGNLTHDGNEKWFVATLLFYVLLFALSILYH
FT                   QGKIREFDNPSRILFFLTLLPLLAHYPIRFNWLLHAIPWGSLIAGITAIIHRFILNYYM
FT                   AFEYQMHIQSGDIAMSLGMFSLAISFYFFIKRQYHFGALYFVFSLMGVFASLLSTARGG
FT                   WIGIPFVLLLILFAYRRYLSKKFVAGFFIVLALIVTTVAMLPNTKIKERIAAAEYDIIA
FT                   YFQQNNGSTSVGARFDMWKSVMLMTQEKPIFGWGVQGVSEKRKLQYEQGLISQYAAAFN
FT                   HAHNQYFDDLSKRGALGLLALLGVFLVPLRFFIRHLKSVDLELKLVSLLGAVHIVSVMF
FT                   YCFSQGFFSHNSGNIFYFFPVIVFYALVKQLSAAAENRHE"
FT   gene            331614..332537
FT                   /locus_tag="D11S_0360"
FT   CDS_pept        331614..332537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0360"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81770"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570122.1"
FT                   /protein_id="ACX81770.1"
FT                   /translation="MNNTELLQFAAQFPLQYLQGERQCRLAYRHFMHHPAARKLVIMVN
FT                   GRAENLLKWTEIAQDFYHQGYDVLLFDHRGQGYSQRLLKDGEKGHLDEFRFYPQDMAKI
FT                   IENLTALYPYPQQYLIAHSLGALISAYYLANFDHRIERAVFSAPFFGVPLKKPTRDELL
FT                   LNLMMLWGQGERYVFGKSAYKPVDTAQNELSHSVARMQWMNDVNRDNPSIRLGGPTFRW
FT                   VHLCLAAIKRLPKILPRIETPVLVLEAEQEKIVNNKTLKKLTALLPHGERRKIHGAKHE
FT                   ILFESDEIRTPVLQRIYAFFNPNKHA"
FT   gene            complement(332575..333393)
FT                   /locus_tag="D11S_0361"
FT   CDS_pept        complement(332575..333393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0361"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81771"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558326.1"
FT                   /protein_id="ACX81771.1"
FT                   /translation="MQKLPYRAIVSDMDGTLLNGHHVVGDFTAQTLECLYDNKVDIILA
FT                   TGRNYFDVSSILKKTKVKEAVLITSNGAQAHNLQGELLLNNFLPESIAYEIMNLPFDDT
FT                   RVCVNSYQAEGWFINKDIPELYKYHKDSGFVYDVVDFKQHHGRDTEKVFFIGRTPADLV
FT                   ALEEQLRTRFGTLANITYSTPICLEVMGEGVSKASTLAQVVQQKDYDLQDCIAFGDGMN
FT                   DVEMLTEVGKGCVMGNADPRLKQAAPQLEVIGRHGHEAVASYLRAIYGIY"
FT   gene            333704..334564
FT                   /locus_tag="D11S_0362"
FT   CDS_pept        333704..334564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0362"
FT                   /product="acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81772"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570124.1"
FT                   /protein_id="ACX81772.2"
FT                   /translation="MSARRGKSVCIATSGTGATNLITRLGDALMDSIPIVAITGQVASL
FT                   LIGTDAFQEADVLGLSLACTKHSFIVQHIDELSEIPANAFGITQSGRPGPVLVDVPKDV
FT                   QIAPTTAKPRINPPPKATALHEEHLTQTLTLLREAQRPVIYIGGVSMAGTVPALRYFLH
FT                   STQMPSRSDLKRLGCRLRRRFLLFGHARNARTKAANYITQEADLLLVFGTRFDDRVTGK
FT                   LDTFAPHVKVIHVDIDGAELGKLSERLHNNIWIKREDRQPVNSFKLRGAYAMISSLLRS
FT                   KKRRA"
FT   gene            334638..335045
FT                   /locus_tag="D11S_0363"
FT   CDS_pept        334638..335045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0363"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81773"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544832.1"
FT                   /protein_id="ACX81773.1"
FT                   /translation="MLQNTPTIKVDAVRGFGGEVLLHDANFDEAKAKAVELAEKKHMTF
FT                   ITPFDHPLVIAGQGTLAMEMLQQVADLDYMFVQVCDGGLAAGVAILLKQFMPDIKVIGV
FT                   ESKDSACLNAALEKGEPTDLAYVGLFADGVA"
FT   gene            335096..335512
FT                   /locus_tag="D11S_0364"
FT   CDS_pept        335096..335512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0364"
FT                   /product="threonine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81774"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544833.1"
FT                   /protein_id="ACX81774.1"
FT                   /translation="MVLVDSNEVCAAMKDLFENVRAVTEFSYRYADDKRACVFIGVRTL
FT                   DEAEKANIIVDLTQNSFDVEDISDDDIAKTHVRYLMGGWVADHGERLYTFEFPEQKGAL
FT                   LKFLETLGTRWKISLFHDRAHGADCGNILAGFQL"
FT   gene            complement(335646..336581)
FT                   /locus_tag="D11S_0365"
FT   CDS_pept        complement(335646..336581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0365"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81775"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544834.1"
FT                   /protein_id="ACX81775.1"
FT                   /translation="MNSGRMRFPSGMQSAYVLRAVLADLLKRKFATLLTVLVIAVSFTI
FT                   PTVSYLLWKNIHHATTQFYPESELTVYLHKNLSEDDANLVVEKIRQQEGVESLNYISRQ
FT                   ESLNEFRHWSGFSEELDVLDDNPLPAVVMIKPTKAFNESQKRNELRATLDKIKGVQEVR
FT                   LDNDWLEKLTALTWLVAHVAIFCTVLMALAVFLVIGNSIRADVYSNQANIEVMKLLGAT
FT                   DQFILRPFLYTGMIYAVFGGLFACIFSSLTIGYFTGAVKYVTDIFAVSFNLNGLGLVEF
FT                   LFLLIVCTIMGYIGAWLSATRYIQLLDKKG"
FT   gene            complement(336590..337240)
FT                   /locus_tag="D11S_0366"
FT   CDS_pept        complement(336590..337240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0366"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81776"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570131.1"
FT                   /protein_id="ACX81776.1"
FT                   /translation="MIRFANVSKAYLGGKPALQGLSFHLPAGSMTYLVGHSGAGKSTLL
FT                   KLIMGMERANGGQIWFNRHDITRLSRHEVPFLRRQIGMVHQDYRLLPDRSVLDNVALPL
FT                   IIAGQHPKDANSRALAALDRVGLRDRANHLPAHLSGGEQQRIDIARAVVHKPQLLLADE
FT                   PTGNLDGALSLEIFNLFEEFNRLGMTVLIATHDIGIVQQKPKPCLVLEQGYLR"
FT   gene            complement(337532..338206)
FT                   /locus_tag="D11S_0367"
FT   CDS_pept        complement(337532..338206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0367"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="catalyzes the dephosphorylation of
FT                   2-phosphoglycolate to form glycolate and phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81777"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577024.1"
FT                   /protein_id="ACX81777.1"
FT                   /translation="MTGQFKLIGFDLDGTLVDSLPDLTLSVNSALAEFDLPQAPEALVL
FT                   TWIGNGAQILIARALEWATAQSGKTLTEAQIATLKERFNVFYGENICNRSRLFPNVKDT
FT                   LQKLKAKGYRLAVVTNKPTQHTRPVLKAFGIEDLFDEVLGGQSLPAIKPHPGPLFYLCG
FT                   KFGLYPKQVLFVGDSRNDIIAAHNAGCPVVGLTYGYNYNIPIAESHPDWVFEDFAELLT
FT                   MV"
FT   gene            complement(338209..338883)
FT                   /locus_tag="D11S_0368"
FT   CDS_pept        complement(338209..338883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0368"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81778"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555783.1"
FT                   /protein_id="ACX81778.1"
FT                   /translation="MKPYLIAPSILSADLARLGEDVEKVLKCGGDVIHFDVMDNHYVPN
FT                   LTFGPAVCKALRDYGITAPIDVHLMVKPVDRIIPDFAKAGASYITFHPEASEHIDRTLQ
FT                   LIRDCGCKSGLVFNPATPLSYLDYVMDKVDIILLMSVNPGFGGQSFIPATLDKLKQARK
FT                   RIDDSGFDIRLEVDGGVKVSNIAEVARAGADMFVAGSAIFDQPDYQKVIDEMRQQLATV
FT                   GK"
FT   gene            339035..339313
FT                   /locus_tag="D11S_0369"
FT   CDS_pept        339035..339313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0369"
FT                   /product="cell division protein FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81779"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544841.1"
FT                   /protein_id="ACX81779.1"
FT                   /translation="MRLFISLLIAVLLLFQYDFWFGKNGYTDYKNTTKEIAVHQQENEK
FT                   LSQRNQIIAAEIKDLKEGVDAIEERARLQHEMVKPNETFYHIVKEHK"
FT   gene            339313..340008
FT                   /locus_tag="D11S_0370"
FT   CDS_pept        339313..340008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0370"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81780"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544843.1"
FT                   /protein_id="ACX81780.1"
FT                   /translation="MTSTRKIIAVVPAAGIGSRMQADKPKQYLHIHGQPILQHTLNVLL
FT                   AYPHISRIVLAVAADDPYIDQLKLSQNPKIQLVEGGETRADSVLNGLNAVQDAGADVWV
FT                   MVHDAARPCLTHGDLEKLLEIQDDNGAILAIPATDTIKRALPSQQIAHTEDRSQLWLAQ
FT                   TPQFFRADLLRDALTRAKQQQFAVTDEASAMELAGFRPHLVAGRSDNIKVTRPEDLALA
FT                   EFYLTRKTI"
FT   gene            340005..340484
FT                   /gene="ispF"
FT                   /locus_tag="D11S_0371"
FT   CDS_pept        340005..340484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="D11S_0371"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="catalyzes the conversion of
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate into
FT                   2-C-methyl-D-erythritol 2,4-cyclodiphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81781"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566080.1"
FT                   /protein_id="ACX81781.1"
FT                   /translation="MIRIGHGFDVHAFGTNNPLIIGGVTIPFDKGFIAHSDGDVALHAL
FT                   TDALLGAAALGDIGKLFPDTDMQYKGADSRVLLREAYRQVQEKGYCVGNVDVTIIAQAP
FT                   KMRPHIDAMRALIAQDLACDIEQVNVKATTTEKLGFTGRGEGIACEAVALLVRKP"
FT   gene            340481..341491
FT                   /gene="truD"
FT                   /gene_synonym="ygbO"
FT                   /locus_tag="D11S_0372"
FT   CDS_pept        340481..341491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truD"
FT                   /gene_synonym="ygbO"
FT                   /locus_tag="D11S_0372"
FT                   /product="tRNA pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /note="catalyzes the modification of U13 in tRNA(Glu)"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81782"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577016.1"
FT                   /protein_id="ACX81782.1"
FT                   /translation="MMELAYLQKTPPKQTALLKAECADFVVKEQLGYDMSGDGEFVAVK
FT                   IRKTDCNTLFVGEQLAKFAGISARNMSYAGLKDRKAVTEQWFSLQMPGQPTPDFSQFHL
FT                   DGVDILEVTRHQRKIRIGSLQGNHFEILLRHAEETDELKVRLDFLAKNGFPNYFTEQRF
FT                   GRDGNNLTQALRWAAGEIKVKDRNKRSFYISAARSEIFNLIVAKRIELSLAQQVLNGDV
FT                   LQLNGSHSWFVADASEDLTQLQQRLAQRDILLTAPLIGEEDKSAVDFENEIFVAHQALF
FT                   HLMRQERVKAARRPILMQAQQFQWQFEPNGLRLKFYLPAGSYATALVRELVNVEN"
FT   gene            341524..342264
FT                   /locus_tag="D11S_0373"
FT   CDS_pept        341524..342264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0373"
FT                   /product="stationary phase survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81783"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555792.1"
FT                   /protein_id="ACX81783.1"
FT                   /translation="MNILLSNDDGIHAPGIRVMAEALRKIANVTIVAPDSNRSAASSSL
FT                   TLVKPLYPLHLESGDYCVNGTPADCVHIALNGFLSGRIDLVISGINAGANLGDDVLYSG
FT                   TVAAAFEGRHLGLPSIAVSLDGRQHFETAARVVCDLVPKLHAQLLGKHEILNINVPDVP
FT                   YEELKGIKVCHLGYRSSASEVIKQQSPRGEDMYWIGLSGLPEYESEGTDFHAVKNGYVS
FT                   ITPIQVDMTAHHSINALQRWLESE"
FT   gene            342292..342867
FT                   /locus_tag="D11S_0374"
FT   CDS_pept        342292..342867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0374"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81784"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518186.1"
FT                   /protein_id="ACX81784.1"
FT                   /translation="MKLFGAMYDKTMQWSKHRFAPFWLSFVSFIEAIFFPIPPDVMLIP
FT                   MSMSKPQSAVKFAMFTATASVLGGMIGYALGYYAFNLVEHYITQWGYQASWQTTIHWFE
FT                   RWGMLVVFVAGFSPIPYKVFTICAGVMQMAFIPFVITAFISRTARFLLVAKLAAWGGEK
FT                   FAAKLRKSIEFIGWSVVALAVVAYLILR"
FT   gene            342882..343073
FT                   /locus_tag="D11S_0375"
FT   CDS_pept        342882..343073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0375"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81785"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544854.1"
FT                   /protein_id="ACX81785.1"
FT                   /translation="MKKLILLLSMSLTLAACSSHDEIPKDENDLPPGIMQPVEGTGAIA
FT                   GGSWVPEIQQQSMPINMQ"
FT   gene            343090..344259
FT                   /locus_tag="D11S_0376"
FT   CDS_pept        343090..344259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0376"
FT                   /product="peptidase M23"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81786"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541855.1"
FT                   /protein_id="ACX81786.1"
FT                   /translation="MKSSFLLLPISIAVLAACTSNTPAPVENADGTLSPGLMQPVDGST
FT                   DGGNSTWEPQIQQGNVPASMNGPIAQSNNLQATGAQSTPQPNFQPMYQQSALQAQPVQQ
FT                   TQPAAQNQPQQASQDFTIPRNPTTNAPDYSQINKGFYKGETYTVRKGDTMFLIAYISGL
FT                   DVKELAALNNMSEPYSLSVGQTLKVSRGTTATVQTKAAPQMQPTVTQPATQGGEPTVTY
FT                   TPGANGTQYGSDGTITGPIKAGVGTAAPATNQPITQAGTAPAVSNVAWRWPTNGNVIQG
FT                   FSNADGGNKGIDISGSRRQAVNAAAAGRVVYAGNALRGYGNLIIIKHNDDFLSAYAHND
FT                   SILVKDQQEIKAGQQIAKMGSTGTNGVKLHFEIRYKGKSVDPLRYLPRR"
FT   gene            complement(344504..344683)
FT                   /locus_tag="D11S_0377"
FT   CDS_pept        complement(344504..344683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0377"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81787"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012820848.1"
FT                   /protein_id="ACX81787.1"
FT                   /translation="MKWLETSDFSPQAFKKLKREPALAKEEIDYLKKLVELDNQKRRQK
FT                   KKSHRKVKGKTCLK"
FT   gene            complement(344956..345717)
FT                   /locus_tag="D11S_0378"
FT   CDS_pept        complement(344956..345717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0378"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81788"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541265.1"
FT                   /protein_id="ACX81788.1"
FT                   /translation="MPTISVAMIVKNEAHHLASCLDTVKDWVDEIVILDSGSTDDTQRI
FT                   AEQYHAKFYQNTDWPGFGKQRQLAQRYVTGDYVLWLDADERVTPELRQSIQNAIAQDAP
FT                   NTAYKIPRLSEVFGSQIRHSGWYPDYVIRLYRTDFARYGDQLVHEKVELPANADIQKLN
FT                   GDLLHYTYQDIHHYLVKSAGYAKAWAEQREKSGKKTTLWQGISHAIGCFVKMYFIRLGF
FT                   LDGKAGLLLAILSAHSTFIKYADLWVRTRGK"
FT   gene            345816..347099
FT                   /locus_tag="D11S_0379"
FT   CDS_pept        345816..347099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0379"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase"
FT                   /note="catalyzes the transfer of
FT                   2-keto-3-deoxy-D-manno-octulosonic acid to lipid A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81789"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518185.1"
FT                   /protein_id="ACX81789.1"
FT                   /translation="MLRFFYTCLMYLVQPFLWLSALFRGFKAPNYRKRLGERYAFYGEL
FT                   STPKPNGVLIHAASVGEVIAAVPLIKRIQQDYPHLAITVTTMTPTGSDRVKAVFGESVT
FT                   HVYLPYDLPDAVARFIRFVQPRVVLVIETELWFNLIHHLSQRKIPFIIVNARLSARSAK
FT                   RYGWFKHQLKPLLDNITMIAPQDDVSLARYAQLGIAPERLTLMGNIKYDLNLTDDLLNN
FT                   ITALKVQWNTRRPIWIAASTHEGEDEIILKSHRTLLVHYPDLLLILVPRHPERFNSVAQ
FT                   LIEQQGFHYIRRSSHAVPQAETQVLLGDTMGELMLLYGMANVALVGGSLVAHGGHNPLE
FT                   PLAFKLPVISGKHAFNFPEVFGKLIERQGVVITEDSPQAVAEAVAQFLSSPTLGECYGN
FT                   AGYAVLNENRGALQRVMDLLKPYLDEAN"
FT   gene            347100..347594
FT                   /gene="coaD"
FT                   /locus_tag="D11S_0380"
FT   CDS_pept        347100..347594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="D11S_0380"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="Catalyzes the conversion of ATP and pantetheine
FT                   4'-phosphate to diphosphate and 3'-dephospho-coA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81790"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005560370.1"
FT                   /protein_id="ACX81790.1"
FT                   /translation="MITVIYPGTFDPLTNGHLNIIERSAVLFPRVLVAVAESPSKNPLF
FT                   SLTERVELVRQAAAHLPNVEVIGFDNLLAHTIAQYDVKAIIRGVRSTTDFEYEVQLAHL
FT                   NRLLTHGVESLFFPPVEQWSYVSSTMIREIYLHNGDMSQLVPPAVLKALQAKRELRGEG
FT                   T"
FT   gene            complement(347643..348368)
FT                   /locus_tag="D11S_0381"
FT   CDS_pept        complement(347643..348368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0381"
FT                   /product="3-deoxy-D-manno-octulosonic acid kinase"
FT                   /note="catalyzes the phosphorylation of
FT                   3-deoxy-D-manno-octulosonic acid at the 4-OH position"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81791"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541271.1"
FT                   /protein_id="ACX81791.1"
FT                   /translation="MLEFQLKNDFFLFNFDQPLANQVQFFEVAFWQQQNRVIGSAKGRG
FT                   TTWFLQTADLFGVNTALRHYYRGGLWGKINKDRYPFSELKNTRSVAEFNLLNQLYQAGL
FT                   PVPRPIGARVCKGNLGMCYQADLLSEKVENARDLTALLQTQNLESTQWRQIGALIRRLH
FT                   DLQICHTDLNAHNILCQQTDNGNPFWLIDFDKCGEKSGHFWKEANLQRLHRSFNKEAAR
FT                   MHIHFTEQNWQDLLEGYSG"
FT   gene            348457..349500
FT                   /locus_tag="D11S_0382"
FT   CDS_pept        348457..349500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0382"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81792"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541273.1"
FT                   /protein_id="ACX81792.1"
FT                   /translation="MALFTQAPKSLCILRLSAIGDVCHALAAVQHIQRYWKDTKITWII
FT                   GKTEAQLLRTVPGIEFIVYDKKCGWRGVWNLWRQLKHRRFDALLNMQTAFRASILSLGI
FT                   HADYRIGFGKQRAREGQWLFTNRRIQDPTNPHVLDGFMAFADELGVPPAPAQWDLSVTE
FT                   ADLATVLCYLDPNRKNLLISPCSSKKEKDWLAERYAEVANIAHQHDVNVILCSSPALRE
FT                   LAMIEEIKALCDFEPTDASGKLTLTKLTALIREVDLVISPDSGPAHIATTQDTPIIGLY
FT                   AYHNPLRTGPYRNLANVVSVYEQNVQQEYGKPSSQLPWATKLKGKNLMAQIDVQDVIAQ
FT                   MKALNLL"
FT   gene            complement(349597..349938)
FT                   /locus_tag="D11S_0383"
FT   CDS_pept        complement(349597..349938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81793"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567111.1"
FT                   /protein_id="ACX81793.1"
FT                   /translation="MFADWKNDVAHVKKSFGELGKNYPKMLQAYGALDAAAGEGNVLDA
FT                   KTRELIALAVAVTTRCESCIGVHAAEAVKAGATEEEVAAALAMSIALNAGAAYTYSLRA
FT                   LEAYNTQKD"
FT   gene            350042..350959
FT                   /locus_tag="D11S_0384"
FT   CDS_pept        350042..350959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0384"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81794"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541277.1"
FT                   /protein_id="ACX81794.1"
FT                   /translation="MDCLDKLIQLAQVSGEVNIRCLFQGEWQVRHDADENQYVGAFHLI
FT                   EQGDCWLTLENQQIHLQAGELFFLPQNRPHFIASKAQDNVIQTRITPSDAQEDQQDLFK
FT                   VYHIGQNSPDLKMFCGMLYYNKPSLLIDALPSYLHLSLRDTPLLPLIQVLQQEADKTRS
FT                   GAKSLIDSLVTVLFIYILRHGLQNEQLNQGVLAGFQDKRLNPVLTQLLNAPQQAWNMDT
FT                   LAALAAMSRANFMRVFQHTIGMAPGKFLTQLRLQQAALLLNKTQKSILAIALEVGYQSE
FT                   AHFSKAFKIAYGMTPSQYRKREAL"
FT   gene            351047..352891
FT                   /locus_tag="D11S_0385"
FT   CDS_pept        351047..352891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0385"
FT                   /product="multidrug ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81795"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544869.1"
FT                   /protein_id="ACX81795.1"
FT                   /translation="MFEKIFSWFENRLNPYPDQAPKTPEKGLFHFIWSGIDGMKRWILL
FT                   LAILTIGGGIMEALLFQFMGLLVDWLTAYTPATLWQEKGDLLMGMAGLLILSILLLFLA
FT                   TAVRLQTLQGVFPMRLRWNFHRLMLGQSLSFYQDEFAGRVSAKVMQTALAVRDTVLTIA
FT                   DVLVYVVVYFVTSGLVLASLDSWFLLPFIVWIVLFVTILRLLIPRLAKTAERQADARSL
FT                   MTGRITDAYSNIATVKLFSHGSREAGYAKRSMEEFMVTVHDQMRLATSLDTLTYITNVM
FT                   LILSTAVIGVLLWQQGLVGVGAIATATAMALRVHGLSRWIMWESARLFENIGTVNDGMN
FT                   TLTKQQTILDKPNCPPLKVTYGEIKFDDVSFAYDPVKPLLTHFNLTIKPGEKVGLIGRS
FT                   GAGKSTIVNLLLRFYEAQQGAITIDGQNIIDVQQESLRSQIGLVTQDTSLLHRSVRDNI
FT                   VYGRPTATEQEMLDAAERAEAADFIPYLSDAQGRHGYDAHVGERGVKLSGGQRQRIAIA
FT                   RVMLKDAPILLLDEATSALDSEVEAAIQESLDKMMENKTVIAIAHRLSTIAAMDRLIVL
FT                   DHGQIVEQGTHAELLAQNGLYAKLWQHQSGGFLSEHVD"
FT   gene            complement(352932..355370)
FT                   /locus_tag="D11S_0386"
FT   CDS_pept        complement(352932..355370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0386"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
FT                   3-phosphate by transfering the acyl moiety from acyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81796"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564534.1"
FT                   /protein_id="ACX81796.1"
FT                   /translation="MAAFLNAYRKLLELPLSILVKNNPIPHNPIEELELNTSQPIVYVL
FT                   PYTSETDFLIFRKNCLSIGLPDPLEQNEINGNFLPRFVFLDEGRRFFKSKGAKKETTAI
FT                   FNKYLELHRTSPQLDVQLIPVSVLWGRAPGREDKSGLPNLRLLNGLQKTIAALWFGRDT
FT                   FVRFSQAVSLRYMAREHGFDQKIAQKLARVAKMHFAKQRISATGPRLPNRQAMFNKLLQ
FT                   QPVILAAIEDEAKSKSISVEKARKEAEKILDEIAANVSYEGLRVADRFLRWLWNKLYQG
FT                   IEVENADRVRKLALEGHEIVYVPCHRSHIDYLLLSYVLYHQGLVPPHIAAGINLNFWPV
FT                   GGMFRRGGAFFIRRTFKGNRLYSTIFREYLAELFHRGYSVEYFIEGGRSRTGRLLAPKT
FT                   GMMSMTLQALQQQQSRSITVVPVYVGYEHVLEVDTYAKELRGAAKEKENAGLVLRVIKK
FT                   LRNLGKGYVNFGEPITLSNYLNQHFPEWKEPLEDRPQWFNKAVDAVSNQVMVNINKAAA
FT                   VNAMNLTGTALLSSRQRALSREQLLEQLSSYQQFLQNVPYSNDVVVPTEKAEIMLDHVL
FT                   SLDRVGILPEKDNFGEIVRLERSSAVLMTYYRNNIQHLFVLPSLVANIVLHYEAIQKNL
FT                   VLIAMLKIYPFLRSELFLHFTQEQLAERVEHIIAELQRQNIIKCSENMLAINKPNIRML
FT                   QLWSAGVREILQRYYITVNLLQNNPLISRANLEKESQSVAQRLSVLHGINAPEFFDKAV
FT                   FSAFTNSLKEQGYFNESGTANTEKLQELADILTHLISTEICLTINGAVTKAEEKEHEEN
FT                   "
FT   gene            355578..356201
FT                   /locus_tag="D11S_0387"
FT   CDS_pept        355578..356201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0387"
FT                   /product="LexA family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81797"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006716824.1"
FT                   /protein_id="ACX81797.1"
FT                   /translation="MKPLTARQQEVYDFLKHHLETTGMPPTRAEISKELGFRSPNAAEE
FT                   HLKALAKKGVIEIVSGTSRGIRLLLEDHSQEEAGLPLIGRVAAGEPILAEQHIEGTYHV
FT                   DPNMFKPQADFLLKVYGQSMKDVGILDGDLLAVHSTKDVRNGQIVVARIEDEVTVKRLE
FT                   RKGSVVYLHAENEEFSPIVVNLTQPTHFEIEGIAVGIIRNNAWM"
FT   gene            356353..356730
FT                   /gene="rpsF"
FT                   /locus_tag="D11S_0389"
FT   CDS_pept        356353..356730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="D11S_0389"
FT                   /product="30S ribosomal protein S6"
FT                   /note="binds cooperatively with S18 to the S15-16S complex,
FT                   allowing platform assembly to continue with S11 and S21"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81799"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q65VD4.1"
FT                   /protein_id="ACX81799.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEAPQQVIDELEKTFRYNDAVLRSLVIHTKHAVTEASPMVK
FT                   AKDDRKALTEVESNDFEDAEE"
FT   gene            356717..357043
FT                   /locus_tag="D11S_0390"
FT   CDS_pept        356717..357043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0390"
FT                   /product="primosomal replication protein N"
FT                   /note="binds single-stranded DNA at the primosome assembly
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81800"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167530.1"
FT                   /protein_id="ACX81800.1"
FT                   /translation="MLKSNLNIDNRLSIIGIVAGNLKRRRSPSGIEHCQFLLEHRSNRV
FT                   EANLTRQAWCKIPIQVSGNQLVERTQGITVGSKVLIQGFLTTHQLNNGSVQLVLHAEQI
FT                   EFID"
FT   gene            357056..357286
FT                   /gene="rpsR"
FT                   /locus_tag="D11S_0391"
FT   CDS_pept        357056..357286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="D11S_0391"
FT                   /product="30S ribosomal protein S18"
FT                   /note="binds as a heterodimer with protein S6 to the
FT                   central domain of the 16S rRNA; helps stabilize the
FT                   platform of the 30S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81801"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541294.1"
FT                   /protein_id="ACX81801.1"
FT                   /translation="MARYFRRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLALLPYSDTHHH"
FT   gene            357302..357751
FT                   /gene="rplI"
FT                   /locus_tag="D11S_0392"
FT   CDS_pept        357302..357751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="D11S_0392"
FT                   /product="50S ribosomal protein L9"
FT                   /note="in Escherichia coli this protein is wrapped around
FT                   the base of the L1 stalk"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81802"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013746286.1"
FT                   /protein_id="ACX81802.1"
FT                   /translation="MQVILLDKIAHLGKVGDQVNVKSGYARNYLIPQGKAVMATKANIE
FT                   HFEARRAELEEKAAKVLAAAVDRAERLEALGSVTIASKAGDEGRLFGSIGTRDIADAIT
FT                   AKGVEVAKSEVRLPNGLIRTLGEHEVTFQFHGEVLSHLNVIIVAE"
FT   gene            357971..359089
FT                   /locus_tag="D11S_0393"
FT   CDS_pept        357971..359089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0393"
FT                   /product="DNA repair protein Smf"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81803"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518184.1"
FT                   /protein_id="ACX81803.1"
FT                   /translation="MNKHLALLLRLLQIPKLGPTTIHKILAQINLFELQYYDAAAFTQM
FT                   GWNAQQIQAWFHPEQRYIEPALLWGEKEGNHILDYFHPDYPELLKQIESAPPVLFVKGT
FT                   TSVLSQQQIAIVGSRQCSSYGEYWAKYFATELTTNGFIITSGLALGIDGFCHQAAVDLK
FT                   QPTIAVLGSGLEEVYPAKHRKLAQNIIEHGGALVSEFFPLQPPIAENFPRRNRIISGLS
FT                   LATLIIEATERSGSLITARYALEQNREIFALPGNIQSQFSQGCHKLIKQGAMLVENVED
FT                   ILENLEPQMTWKKRPQNRPHFPAITKTTSASLPPPVTPSHPELYNLIGYNPISADNLST
FT                   TLNLSIDQILIQLLELELQDLIISENGLYRRV"
FT   gene            complement(359146..360228)
FT                   /locus_tag="D11S_0394"
FT   CDS_pept        complement(359146..360228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0394"
FT                   /product="phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81804"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005595133.1"
FT                   /protein_id="ACX81804.1"
FT                   /translation="MKLKTLTLSLIAATVLAGCSANYHKGYDMDKIIIAHRGASGYLPE
FT                   HTLEAKALAFAQHADYLEQDLAMTKDGRLVVIHDHFLDGLTDVARKFPNRHRKDGRYYV
FT                   IDFTLKEIQSLNMTENFETKDGKQVAVYPGRFPLWKSHFKIHTFEDELEFIQGLEKSTG
FT                   KKVGIYPEIKAPWFHHKNGKDIAVETLKVLKKYGYDKKTDRVYLQTFDFNELKRIKTEL
FT                   LPKMGMDLKLVQLVAYTDWHETEEKDAKGKWVNYDYDWMFKPGAMAEVVKYADGVGPGW
FT                   YMLIDKEKSKPGKIEYTPLVKELAQYKVELHPYTVRKDALPDFFTDVNQMYDALLNKSG
FT                   ATGVFTDFPDTGVQFLKKQK"
FT   gene            complement(360462..361904)
FT                   /gene="glpT"
FT                   /locus_tag="D11S_0395"
FT   CDS_pept        complement(360462..361904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="D11S_0395"
FT                   /product="sn-glycerol-3-phosphate transporter"
FT                   /note="catalyzes the uptake of glycerol-3-phosphate into
FT                   the cell with the simultaneous export of inorganic
FT                   phosphate from the cell"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81805"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576982.1"
FT                   /protein_id="ACX81805.1"
FT                   /translation="MFGPFKPAPHIAELPADKIDSTYKRLRWQVFAGIFFGYAAYYFVR
FT                   ANFDLAQPGLIQAGLYSKAELGVIGSAAGLAYGLSKFVMAGMSDRSNPRMFLPFGLLLS
FT                   GLCMTLMGLFPWATSGIAIMWVMIFLNGWFQGMGWPPCGRTMVHWWSKSERGTIVSIWN
FT                   TAHNIGGMMPGAMVLLASAIFFSTHGVEAQAKDVWQQSLYYPGIAAMICAIPVYFVMRD
FT                   TPQSCGLPSIEKWRNDYPDDYNEKTYENDLTAKEIFVTYVLKNKLLWYIAIANVFVYLI
FT                   RYGVLKWSPVYLSEVKHFNIKGTAWAYTIYELAAVPGTLLCGWVSDHVFKGKRGLTGFI
FT                   FMILTTAAVATYWMNPATPEAELANYSAWYENPYQLTDFILMTLIGFLIYGPVMLIGLH
FT                   ALELAPKKAAGTAAGFTGLFGYLGGTVSASAVIGWAAQHYGWDGGFYVMIGGGILAVIL
FT                   LFIVMIEEGKHKAKLGDTYGTK"
FT   gene            complement(362237..362974)
FT                   /locus_tag="D11S_0397"
FT   CDS_pept        complement(362237..362974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0397"
FT                   /product="23S rRNA methyltransferase"
FT                   /note="Specifically methylates the ribose of guanosine 2251
FT                   in 23S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81807"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544885.1"
FT                   /protein_id="ACX81807.1"
FT                   /translation="MSETIYGIHAVKAFVTHYPERLIEVWALKGRDDQRLQPLINEIQR
FT                   LGISVQFLNRQTLDKKAEGEVHQGIIARVHSLPELNEHDLDRLLEQQNTPLLLVLDGVT
FT                   DPHNLGACLRTADAAGVNAVIVPKDKSAQLNSTARKVACGAAENVPLIRVTNLARTLRE
FT                   LQKRHNVWVVGTAGETTETLYQTKLTGALALVMGAEGEGMRRLTREHCDQLISIPMMGS
FT                   VSSLNVSVATGVCLFEIVRQRLK"
FT   gene            complement(362971..365376)
FT                   /locus_tag="D11S_0398"
FT   CDS_pept        complement(362971..365376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0398"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81808"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589068.1"
FT                   /protein_id="ACX81808.1"
FT                   /translation="MAKKHNKSPLQDPNYAKELAKYDNPIPSREFILQIIRKQNSPMSK
FT                   EEIFAALAISDEEQQEAMRRRLRAMENDGQLVFTKRKRYALPEKLDLLKGMVIGHREGF
FT                   GFLQVEGKKEDFFIPNVQMQKVMHGDYVLAQANGFDRKGRPEVRIVRLLEANKKQIVGR
FT                   FFLEQGIGYVVPDDSRITRDILIPDEARLGARMGQVVVVELNPRTAPFFQPIGKITEIL
FT                   GDNMAKGMEVEIAIRKHDIPHAFPSAVEKQLKKWQEEVPEEAKRGRVDLRDLPLVTIDG
FT                   EDARDFDDAVFCQKQGKGWKLWVAIADVSYYVRPKSALDLEAYNRGNSVYFPNRVVPML
FT                   PEKLSNGLCSLNPQVDRLCMVCEMTLSAKGKMTDYRFYEAVMNSHARLTYNKVAKILEK
FT                   DTALYERYAPLVPHLQELHDMYRALVKARQQRGAIEFETIESKFIFNALGRIERIEPVV
FT                   RNDAHKIIEECMILANIAAANFMEKNQEPALYRIHALPGEEKLTAFRSFLAECGLTLGG
FT                   GNKPTPMDYAALLEQIQTRPDRELIQTMLLRSMSQAVYSADNIGHFGLALSEYAHFTSP
FT                   IRRYPDLTLHRSIKYLLAKKKGSKRKTTDTGGYHYQLDEMDVCGVHCSATERRADDATR
FT                   EVADWLKCEYMQNHVGEEFDGVISSVTGFGFFVRLNDLFIDGLVHISELENDYYLFDMP
FT                   KQRLIGENSGMIFRIGDVVKVRVDAVNLEQKQIDFALIDSERKPRRSGKTARTKAKKAE
FT                   TAASKKSAKKQPVEKKKTKPQKSAVKNNGVSKTNPQAAAKNKKAKNKA"
FT   gene            365626..366681
FT                   /locus_tag="D11S_0399"
FT   CDS_pept        365626..366681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0399"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="functions in MreBCD complex in some organisms"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81809"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005630272.1"
FT                   /protein_id="ACX81809.1"
FT                   /translation="MLFKKIRGLFSNDLSIDLGTANTLIYVKGQGIVLDEPSVVAIRRD
FT                   RSGSLKSIAAVGKEAKQMLGRTPKSIEAIRPMKDGVIADFFVTEKMLQYFIKQVHSGNF
FT                   MRPSPRVLICVPAGATQVERRAIKESAIGAGAREVYLIEEPMAAAIGAKLPVSTATGSM
FT                   VIDIGGGTTEVAIISLNGIVYSSSVRIGGDRFDEAIVSYIRKTFGSIIGEQTAERIKKE
FT                   IGIAYIQEDDEIKEMEIHGSNIAEGAPRSITLSSRDVLEAIRQPLSGIVAAVRTALEEC
FT                   QPEHAADIFERGMVLTGGGALLRNIDVLLAKESGVPTIVAEEPLTCVARGGGEALDMID
FT                   MHGGDIFSDEI"
FT   gene            366751..367824
FT                   /locus_tag="D11S_0400"
FT   CDS_pept        366751..367824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0400"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81810"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589066.1"
FT                   /protein_id="ACX81810.1"
FT                   /translation="MKPIFGKTPPLGLKLFFAVTASIGLILSDGQTAAMIQTRGFLETA
FT                   VGGLYYLANTPRTVLDGVSDNLVDTNKLQIENKVLKTQLREKNADLLLLDQLKVENQRL
FT                   RLLLNSPLRIDEYKKIAEVLTAEMDVYRQQVVINQGQKDGAYVGQPIIDEKGVVGQIIS
FT                   VGENTSRVLLVTDVTHAIPVQVLRNDVRLIASGTGHSDELTLDNVPRSVDIEKGDLLVT
FT                   SGLGGRFLEGYPVAVVESISRDGQNYFATVTAKPLASIDKLRYVLLLWPTNEDMRKAKS
FT                   ITPEEVRKAVQQRLENQGSEANKVKKAVVPTENNETLNTPTDTPEDLQPETAPDTSGEN
FT                   NAPAPVIPSEQPQREEN"
FT   gene            367824..368312
FT                   /locus_tag="D11S_0401"
FT   CDS_pept        367824..368312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0401"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81811"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576972.1"
FT                   /protein_id="ACX81811.1"
FT                   /translation="MEGRFIFQCFVLSTIFIIALVMEIAPWPVGFQSFKPTWIVLVFTY
FT                   WTLSIPHRVNIGQAFIIGIIWDMVLGSTLGIHALVLSVSAYLITTYHLILRNLSLWMQS
FT                   LLVVALVFAVRLSIFFIESLLHDASFNWQEIFGALISGMLWPWMFLLLRKVRYRLGID"
FT   gene            complement(368422..368772)
FT                   /locus_tag="D11S_0402"
FT   CDS_pept        complement(368422..368772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0402"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81812"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P44357.2"
FT                   /protein_id="ACX81812.1"
FT                   /translation="MSNIIKQLEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEG
FT                   VVIAVRNRGLHSAFTLRKISNGVGVERVFQTHSPAVDSIVVKRKGAVRKAKLYYLRERS
FT                   GKSARIKERLGE"
FT   gene            complement(368798..369547)
FT                   /gene="trmD"
FT                   /locus_tag="D11S_0403"
FT   CDS_pept        complement(368798..369547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="D11S_0403"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="methylates guanosine-37 in various tRNAs; uses
FT                   S-adenosyl-L-methionine to transfer methyl group to tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81813"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540793.1"
FT                   /protein_id="ACX81813.1"
FT                   /translation="MWIGVISLFPEMFKAITEYGVTGRAVKQDLLQVRCWNPRDFTHDK
FT                   HKTVDDRPYGGGPGMLMVVQPLKDAIDAAKKVAGEGAKVIYLSPQGRKLDQPGVEGLAQ
FT                   NQKLILLCGRYEGIDERLIETVVDEEWSVGDYVLTGGELPAMTLIDAVARFIPGVLGKQ
FT                   ASAEEDSFAEGLLDCPHYTRPEVLDGLAVPPVLMSGHHEEIRKWRLKQSLLRTWLRRPE
FT                   LLEGLALTDEQRKLLKQAQAEYNGKLS"
FT   gene            complement(369613..370140)
FT                   /gene="rimM"
FT                   /locus_tag="D11S_0404"
FT   CDS_pept        complement(369613..370140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="D11S_0404"
FT                   /product="16S rRNA-processing protein RimM"
FT                   /note="Essential for efficient processing of 16S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81814"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576969.1"
FT                   /protein_id="ACX81814.1"
FT                   /translation="MQQQRIETVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIK
FT                   GQWQPTEPENWRHHNHELIVKLKGVDDREAAQILANVEIGVDLSVFPQLKEGDYYWHDL
FT                   IGCTVVNLAGYAMGTVTEMMETGSNDVLVVKANVKDAFGKQERLIPFLYEQVVKRVDLA
FT                   TKTITVDWDAGF"
FT   gene            complement(370166..370414)
FT                   /gene="rpsP"
FT                   /locus_tag="D11S_0405"
FT   CDS_pept        complement(370166..370414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="D11S_0405"
FT                   /product="30S ribosomal protein S16"
FT                   /note="binds to lower part of 30S body where it stabilizes
FT                   two domains; required for efficient assembly of 30S; in
FT                   Escherichia coli this protein has nuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81815"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555856.1"
FT                   /protein_id="ACX81815.1"
FT                   /translation="MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPIAQG
FT                   KAERVRIDLDRVNHWVGQGASLSDRVASLVKEVQKAA"
FT   gene            complement(370909..372210)
FT                   /locus_tag="D11S_0408"
FT   CDS_pept        complement(370909..372210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0408"
FT                   /product="proline aminopeptidase P II"
FT                   /note="exopeptidase able to cleave the peptide bond of the
FT                   last amino acid if linked to a proline residue; substrate
FT                   can be as short as a dipeptide"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81818"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518182.1"
FT                   /protein_id="ACX81818.2"
FT                   /translation="MDLAYMAALPPEEFAQRRAKVFEQMQDNSLFLVFSDIERRRNDGC
FT                   DYPFRQDSYFWYLTGFNEPNAALLLRKHQGEQQAIIFLRPSDKLLEIWKGRRLGMENAP
FT                   QTLLVDSAYAIEDFISQFKNLAQKQTALYYAPKQQPWGDALLEQSAVEFSGVFNWKYML
FT                   GEMRLFKSENEIALMQQAGQISALAHIKAMQQTRPNRLEYEVESDILHEFNRFGARYPA
FT                   YNSIVAGGENACILHYSENNMPLRDGDLVLIDAGCEFAMYAGDITRTFPVNGKFSEAQK
FT                   AIYDIVLQAQKRAIELLVPGSSIAKVNEEVIRIKTEGLVRLGILKGDVDELIEQKAYRE
FT                   FYMHGLGHWLGLDVHDVGEYGENRSRTLEPGMVITVEPGLYLSKDADIPEQYKGIGIRI
FT                   EDDLLITNYGNKNLTSAAPKEIADIEKLMADTCA"
FT   gene            complement(372225..372773)
FT                   /locus_tag="D11S_0409"
FT   CDS_pept        complement(372225..372773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0409"
FT                   /product="hypothetical protein"
FT                   /note="the crystal structure of Haemophilus influenzae
FT                   HI0817 showed that this protein forms dimers; function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81819"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567099.1"
FT                   /protein_id="ACX81819.1"
FT                   /translation="MTTIFYQHLNQQLRQASIPLSAAELHGFLSGLICGGVQDQSWQPL
FT                   LYQFTNDNHAYPIALLQQISDIYQQIRRQLADNESFDFELCLLETENVFEQADGLAEWS
FT                   NHFLLGLGLAQPHLDKEKGDIGEAVEDLRDICQLGYDDEDDPEELAQAVEEIVEYVRTI
FT                   ATLFFTHFNQTEEKQPTLH"
FT   gene            372932..373258
FT                   /locus_tag="D11S_0410"
FT   CDS_pept        372932..373258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0410"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81820"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544904.1"
FT                   /protein_id="ACX81820.1"
FT                   /translation="MDLGQKMSSTKSIEISVLGQLLRLNCPEEQHDALRSAARELDQRV
FT                   SEMKERTGILQVDKVLSIVALNLSFELMQEQKKTHLIEDVLKNKILRPLDHSLENIGAP
FT                   KFNS"
FT   gene            373552..374127
FT                   /locus_tag="D11S_0411"
FT   CDS_pept        373552..374127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81821"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544906.1"
FT                   /protein_id="ACX81821.1"
FT                   /translation="MQAHPSTATVRQQLRQQMRKTRRKLTALQQQQVAKNITEQALALI
FT                   EQHHAQHIGLYLAFDGEISTQPLIERLWQQGKNVYLPVLHPFCRGHLLFLRYLPDTPMK
FT                   QNKFGILEPHLNVQNVLPLAQLDMIFTPLVAFDKQGNRLGMGGGFYDRTLQHRQHRFIA
FT                   VGLAHQCQQVETLPVESWDVPLEHILAG"
FT   gene            complement(374164..374952)
FT                   /locus_tag="D11S_0412"
FT   CDS_pept        complement(374164..374952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81822"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544908.1"
FT                   /protein_id="ACX81822.1"
FT                   /translation="MRKLKSFALLTAMALAVTACSSSKQDVEQAPEQTLYTTGQTYLQD
FT                   GDYSQAIRYFNAVSNRFPGSSYGEQVQLNLIYAYYKSQDYSETLLTIDRFIQRYPNSSH
FT                   LDYALYMAGLTNSALGDNFFQDFFGVDRATRENTSIKTAFANFQNLVNHFPNSPYTPDA
FT                   LARMTYIKASLARHELEIAKFYFKRDAYVATANRVVSMLKLYPDTQATLDALPLMKESY
FT                   EKMNLKHLADQTAKVIAANEGKKFDEPEKPKEPELQAPQQ"
FT   gene            375059..376033
FT                   /gene="rluD"
FT                   /locus_tag="D11S_0413"
FT   CDS_pept        375059..376033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="D11S_0413"
FT                   /product="23S rRNA pseudouridylate synthase"
FT                   /note="responsible for synthesis of pseudouridine from
FT                   uracil at positions 1911, 1915 and 1917 in 23S ribosomal
FT                   RNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81823"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589963.1"
FT                   /protein_id="ACX81823.1"
FT                   /translation="MAQITLSATVQSHQMGQRLDQTLAELFPDYSRSRLKTWIEEDLVL
FT                   VNGVVQNVPRSKVYGDEQIEITVEIEDETRFEPENIPLNIVYEDDDILVINKPKDLVVH
FT                   PGAGNPSGTVLNALLYHYPPIAEVPRAGIVHRLDKDTTGLMVVAKTIPAQTQLVRDLQK
FT                   RKIIREYEAVACGIMTKGGTVDEPMARHPTKRTHMAVHPMGKPAVTHYRIMERFRDYTR
FT                   LRLRLETGRTHQIRVHMAHIAHPLLGDQTYGGRPRPPKNASEELMSVLRNFKRQALHAV
FT                   MLRLQHPISGEMMEWYAPLPEDFVELITALKADYVLHKDELDY"
FT   gene            376035..376772
FT                   /locus_tag="D11S_0414"
FT   CDS_pept        376035..376772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0414"
FT                   /product="laccase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81824"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544912.1"
FT                   /protein_id="ACX81824.1"
FT                   /translation="MHAINPNWNAPQQIRAFTTLRHSGVSLAPYDSFNLGDHVGDDKNA
FT                   VKTNRTLLVEKFHLPQMPVFLNQIHSTKVLNLPYQGEDLNADAVYTDQQNQVCLVMTAD
FT                   CLPVLFTNQNGTEVAAAHAGWRGLCDGILEQTVARFRCPTDEILAWLGPAIGPTAFQVG
FT                   QEVIDQFVAQDPNAKQAFIADPKENGKFLGNLYQIATQRLNALGITQISGGEHCTYLEA
FT                   DKFFSYRRDNATGRMASVIWIGE"
FT   gene            complement(376942..378915)
FT                   /locus_tag="D11S_0415"
FT   CDS_pept        complement(376942..378915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81825"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576961.1"
FT                   /protein_id="ACX81825.1"
FT                   /translation="MSRQLFKTEKMHSLLYPIFFFCLLNLIVFTLSRLGLSLWQIERVN
FT                   AVHGWGELFLQGLRMDIVSLCYLFGVPALFSVLFYHDNTLGRIWKGILRVWLTVGSVFI
FT                   LFMELSTPAFINTYDYRPNRLFIEYLIYPKEVFTMLMEGHLSAVILSLVFTVIAAVVYW
FT                   KLAGRAVRDMQPMSWKWRPLVALLVIAVSFLGARSSLQHRGINPAMVAFSSDAMVNSLV
FT                   LNSGYSVIYAAQQFKDEGTSSESYGKMETAEMLDIIKKSGSRPVEAYISDEFPTLTRNQ
FT                   ATYQGKPKNIVIILEESFGAQFIGTLGGLPLSPAFDKLAQQGWLFDNLYATGTRSVRGI
FT                   EAVTAGFTPTPARAVVKLNNSQNGFFTLAQLLSQRGYDTSFIYGGEKHFDNMAGFFYGN
FT                   GFKRIIDQMDYQNPTFTGTWSVSDEDLFTKANETFTQLQKEGKPFFSLVFSSSNHDPFE
FT                   FLDGKIELYEQPKATRNNAAKYADYAIGHFFKLAKESNYWKDTIFLVIADHDSRVAGAS
FT                   LMPIKHFHIPALILGDGIAPHRDDRLVSQFDMPTTLLSLAGISGDYPMIGYDLTKPNDP
FT                   NRAIMQYDQVQALMRGNDVVLQFPKVGAKTYRYDKTTETLTEEEVPPAMVKEALAHALL
FT                   GSYLYKHRLYTTPEIKQTEGKR"
FT   gene            complement(378980..379639)
FT                   /locus_tag="D11S_0416"
FT   CDS_pept        complement(378980..379639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0416"
FT                   /product="NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81826"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576959.1"
FT                   /protein_id="ACX81826.1"
FT                   /translation="MSVTKQQVLDAFHFRCATRYYDPARKISKEDFDYILELGRLSPSS
FT                   VGSEPWQFLVIQNPELRQALKPVSWGMATQLDDASHVVVILANKKARYDSEDFRNNLLR
FT                   RGLNEEQLQNALAIYKKFQIEDINVLENDRTLFDWASKQTYIALANMMTGSALIGIDSC
FT                   PIEGFNYAEVNRILAQTGAYNADKYAVSVAATFGYRAKDIRPKARKPLNEIVHWIE"
FT   gene            complement(379756..380049)
FT                   /locus_tag="D11S_0417"
FT   CDS_pept        complement(379756..380049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81827"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544919.1"
FT                   /protein_id="ACX81827.1"
FT                   /translation="MAAVERKGAGLRLRIFLQPKAAKDQIVGLHDDELKISITAPPVDG
FT                   QANAHLLKFLSKLFKVPKSSIVLEKGELNRHKQVLIPSPKVIPPQIEPYLTP"
FT   gene            complement(380075..380635)
FT                   /locus_tag="D11S_0418"
FT   CDS_pept        complement(380075..380635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0418"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81828"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704516.1"
FT                   /protein_id="ACX81828.1"
FT                   /translation="MNSIQFLIATAISVYSFILILRTWFQLAGVDFYNPLSQALVKATQ
FT                   PVVVPLSKLAPTVKGVNTAALLACFILGLVKFPLLNLFGTIGAASLFEYAIIGVLSVVH
FT                   SIGEAIFYVLLVGAILSWFNRGAGQTQYLLYQLSEPVLRPVRKILPNTGMIDFSPMVVV
FT                   FVLYLLNRVLYDMFGGLWVAAAF"
FT   gene            complement(380651..381598)
FT                   /locus_tag="D11S_0419"
FT   CDS_pept        complement(380651..381598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0419"
FT                   /product="magnesium transporter CorA"
FT                   /note="responsible for the influx of magnesium ions"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81829"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_011609804.1"
FT                   /protein_id="ACX81829.1"
FT                   /translation="MINAFALEDARLVRIDETTEPLNTAIWIDLLEPTVEERDMLQESL
FT                   GQSLASFLELEDIEASARFFEDEDGLHLHSFFYCEDENDYADLASVAFTIRDGRLFTLR
FT                   DRELPAFRLYRMRSRNQRLIECNSYELLLDLFETKIEQLADVIENVYADLEKLSRVVLD
FT                   GTQGEAFDEALATLTEQEDTSSKVRLCLMDTQRALSFLVRKTRLPANQLEQAREILRDI
FT                   ESLQPHNESLFQKVNFLLQAAMGFINIEQNRIIKIFSVVSVIFLPPTLVASNYGMNFSD
FT                   MPELGLKFGYPMALGLMALAAFAPYWYFKRKGWL"
FT   gene            complement(382251..383051)
FT                   /locus_tag="D11S_0420"
FT   CDS_pept        complement(382251..383051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81830"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564742.1"
FT                   /protein_id="ACX81830.1"
FT                   /translation="MTIDDIDFNELYKQHLIACHHYNLPSEKWDKKATKMAENPVGKTS
FT                   RYNQQLLQTIQVQSHETVLDIGCGPGTFALPLAQQCRQVYALDYSVGMLDVLADYKQKL
FT                   QLENVTLIHRSWVEDWADVPQADVVLASRSTLVDDLDDMIDKLRTKAKKRVYLTSITQR
FT                   HFLDEGVFSAIGREDIGFPSYIYLLNRLYQKGIQANLNFIETESGRFMGETYEDLLNSV
FT                   EFSLGQLSEKEKQGLAAFYRQKQQNNEPIAHGQHKWALIWWKVE"
FT   gene            complement(383205..386303)
FT                   /locus_tag="D11S_0422"
FT   CDS_pept        complement(383205..386303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0422"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81832"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564741.1"
FT                   /protein_id="ACX81832.1"
FT                   /translation="MKFTDIFIRRPVLAVSISLLIIILGLQAISKLTVREYPKMTTTVI
FT                   QVSTVYPGADANLIQAFVTSKLEEAVAQADNVDYMSSSSSPSSSTITVKMKLNTDPNAS
FT                   LADVLAKVNSVRSELPKGIEDPTVSSSTGGSGIMYISFRSGKLDASQVTDYIERVVKPQ
FT                   FFTVEGVASVQIFGASEYALRIWLDPQKMAAQNLSATQVMSALSANNVQTAAGNDNGFY
FT                   VVYKNKVDTTTKSVYELSKLIVYSSGDKLVRLRDIADIELNKSSDTARAVANGADSVVL
FT                   AINPTSSANPLTVAEKILPLYENIKNNLPDAIQTDILYDRTIAINNSIDEVVKTIIEAT
FT                   IIVLVVITMFIGSFRAILIPVITIPISLIGVIMMLQTLDFSINLMTLLALILAIGLVVD
FT                   DAIVVLENVDRHIKLGETPFRAAIIGTREIAVPVISMTIALIAVYSPMALMGGITGTLF
FT                   KEFALTLAGAVFISGIVALTLSPMMTSKLLKAHDQPSKLEERVNRTLTRVNNIYAYILD
FT                   LVMQNRKCMLVFAAIIFATLPVLFKSLSSELTPAEDKGAFLAIGSAPSNVNVDYVQAAM
FT                   APYQEILTNTPEVQFAMTISGVPSSNQSLNVVTLKDWSERSKSQAQVLEELNNKAKSIP
FT                   EVSVSGFAFPEINTGEQGPPIGFIISTSQGYNDLASVAGKFLEAMQKSGKFVYTNLDLK
FT                   FDTAQMHIKIDREKAGTYGITMQQISATLGSFLSAATVERVDIDGRAYKIISQVKRENR
FT                   LSPESWKNYYVSAANGKSVPLSSLVTMSLEPQPSSLPRFSQLNSAVISAVPMPGSSIGD
FT                   AIQWLQDNAQELLPQGYNYDFKGEARQLVQEGNALAVTFVLAVVIIFLVLAIQFESIRD
FT                   PLVIMISVPLAISGALLALNFFGFIGVAGSTLNIYSQVGLITLVGLITKHGILMCEVAK
FT                   EEQLNHGKTRIEAITEAAKVRLRPILMTTAAMIAGLIPLLYATGAGAVSRFSIGIVIVA
FT                   GLAIGTLFTLFVLPVIYSYIASEHKPLPEFDENIKPIEGEINH"
FT   gene            complement(386317..387507)
FT                   /locus_tag="D11S_0423"
FT   CDS_pept        complement(386317..387507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0423"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81833"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544926.1"
FT                   /protein_id="ACX81833.1"
FT                   /translation="MSSAQINRPKRSHVFFLKLALGVFVLLFAAMIVMNYMKSKGIADF
FT                   LANQGESPSPVTAMTVTSQQWTPVIETTGLVRPNQGAILSAQSAGTISKVLVENGQNVK
FT                   KGDVLVELDSSVERAGLRAAEAQVISLRQTYQRYANLAKSGGVSRQELDNAKAAYDAQV
FT                   ANVESLKATVERRQILAPFDGKAGIVKVNVGQYVSNGTEIVRVEDRSSMKVDFSIAQNL
FT                   LDELRLGQKVTATADARLGETFAAKVTAIEPAISSSTGLVDVQATFEPEDGVKLLSGMF
FT                   TRLNVALQTEYDQIVVPQVAVSYNMYGESLYILTALSDEEKFASKGDVNKMYRAHQITV
FT                   FTKDRQGIYSQLKGDEVKIGDKIITGGQQSLSNGSLVIVVDKQGVGTTQPASKTNL"
FT   gene            complement(387533..388099)
FT                   /locus_tag="D11S_0424"
FT   CDS_pept        complement(387533..388099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0424"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81834"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576946.1"
FT                   /protein_id="ACX81834.1"
FT                   /translation="MNQSETDMIERIFTATDALMATVGLPNLSMHKIAREAKISPGTIY
FT                   IYFKNKEELLTQFARYIFQNFQDVLKEGYDERQPFFQQYRKMWWNIWHFLEAEPTIMAN
FT                   MGQYESLPGFSDICQKWESDSIWYHFCVKAKAAGELADVPPPILFAISLESAFNIAFKC
FT                   RHFCAQVSMEMLEAVIERTWLAIKN"
FT   gene            complement(388299..389111)
FT                   /locus_tag="D11S_0425"
FT   CDS_pept        complement(388299..389111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0425"
FT                   /product="cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81835"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518178.1"
FT                   /protein_id="ACX81835.1"
FT                   /translation="MAQRDYAARNGAKKKKKQKKSNKPLLFVIAGVIVAAFAFGLYLLK
FT                   EKAPEPVVQPVETTEKTQPKSVLPNRPEEVWSYIKALETRTVPIDDNPKSLDKNMRLTE
FT                   EQRKILQAMEKEQKQAELAKTKAAEAQQQAAQQSGQFTAQQPPQQQPKPQPQVVEAKKA
FT                   TPPREEKKAEQTVKAESTKKPEPQPAPPQTPASNGGERKYGLQCGAFKNKGQAENLQAR
FT                   LAILGLPARVNESADWNRVVVGPAGDRNAAVKMQEKAKSVISCVVIGM"
FT   gene            complement(389221..391590)
FT                   /locus_tag="D11S_0426"
FT   CDS_pept        complement(389221..391590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0426"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81836"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564737.1"
FT                   /protein_id="ACX81836.2"
FT                   /translation="MLFHSSRTHFLLLKFDGILSLIQVKLNPKQQSYSPPNRQQSPKML
FT                   YSEPILFTEFPSMSFARIALPVPLHRYFDYILPTSLNVVVGARVWVPFGTQKRVGVVVE
FT                   VAEQSDVSMEQLKPVQAYLDEVSLFSPQSWQFLQWAAGYYHAPLGEVLSQALPVKLRQG
FT                   ESAVEKPSVFWKPTALGEQALTQGLLKRAKKQLEALQAANDLPEKGNNPFSAAIWSALK
FT                   AKDYVTEVILETEIQTWQQQLGDKPLVNKADRLTLNKPQALVFSQLKFTQGFVPWLLDG
FT                   VTGSGKTEIYLQFIEDILQQGKQVLVLVPEIGLTPQTVRRFQARFNVVIDVLHSNLNDT
FT                   QRLQVWQRARNGQSAVVIGTRSALFTQFAELGAIIIDEEHDASFKQQDGWRYHARDLAI
FT                   VYAKQLNIPILMGSATPSLESLNNVQSGKYRHLSLSEKANNSTALKQQIIDLKRQPIHN
FT                   GLSDVLLKRMQAHLEKGNQVLLFLNRRGFAPVLLCHECGWMAECRHCDKPYTYHQQHHV
FT                   LRCHHCASQKPIPRQCGNCGSTQLITTGLGTEQLEATLKEAFPNYGIARIDRDTTARKG
FT                   KLEDYLEDINQGKSQILIGTQMLAKGHHFPNVTLVALVNVDSALFSLDFRAEERLAQLY
FT                   MQVAGRAGRGSQQGEVLLQTHYPEHPLLQSLLQKGYSQFAQNALALRKSIGLPPFGSQA
FT                   LFKAQSRYSEEAEQLLAQFVEYLQQIKRNTAPELQILGPMPAPFSKKAGQYRWQLLLQH
FT                   PSRAALQQVLTEFWRYQGDQPTKVRWILDVDPLDLS"
FT   gene            391646..392509
FT                   /locus_tag="D11S_0427"
FT   CDS_pept        391646..392509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81837"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542853.1"
FT                   /protein_id="ACX81837.1"
FT                   /translation="MKNHNENQSITIVTAFFDIGRGNLQSKEEFPSYLTRTNDTYFEYF
FT                   TKLATLDNPMVVFTSYEHIERVKNIRGTKPTTIIPFDINKFRKTLDSIKNIQKSESFTS
FT                   KINPEVIKNLEYWLPEYVLINNLKPYFLYKAIKSKLVKTELVAWVDFGYVRNDETLNNI
FT                   KEWQYNFELNKVNFFTIRKNYKLKSKEDVYHAMFNNIIYVIGSVIVSSREQWKIFFKDI
FT                   LSTQKRLLRTQIVDDDQGVYLMCIFNKKDNYKLNYLGKDNWFHIFRKYDKTSKISLKEK
FT                   IKDIFI"
FT   gene            complement(392516..393520)
FT                   /locus_tag="D11S_0428"
FT   CDS_pept        complement(392516..393520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0428"
FT                   /product="capsular biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81838"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012820859.1"
FT                   /protein_id="ACX81838.1"
FT                   /translation="MKKEYSSLSTLFSSNATFFNVIHRISNKPYKIFYTGLIPKPIRRW
FT                   LAKKANLSQQNHVANCWKEVISLYLNGELDEIMVKPKKDLGNKKIIWQYWGQGWESEEL
FT                   PDIVKICRRSVQENKGDYEVIYLDDKNLIEYIEFPDFVSEKRKNPNFRHAFFSDLLRLA
FT                   LLECYGGIWVDATILFTAPITKQLGSSDFFMFSRSPKATNKAMWKNLNREYFLWDKESR
FT                   VNILNSFIISKKGNVTIHILLQLLLFFWKTQENIPHYFFFQILFDKLKKENLIEEFELV
FT                   DDTLPHLLFSELNNPFDRNKLDKITAKCNQHKLTYLAKCETGSFYAYLKNKYQ"
FT   gene            complement(393529..394377)
FT                   /locus_tag="D11S_0429"
FT   CDS_pept        complement(393529..394377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0429"
FT                   /product="lipooligosaccharide biosynthesis protein lex-1"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81839"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566799.1"
FT                   /protein_id="ACX81839.1"
FT                   /translation="MNSTENKNFVISISTAEQRRNHIIEQFTHQNIPFEFFDAFTPSDK
FT                   LTDHLQRYLPNVANAAQLTMGEKGCLMSHFMLWKKCIDENLDYVTLFEDDILLGENANK
FT                   FLAEDEWLKVRFNFQEIFVLRLETFLMPVQLEKQAQIPPFQQRDIDILTSKHFGTAGYV
FT                   ISQGAAKYLIALFEKLTTEEIKPIDEIMFNQQINATDYRVYQLNPAICVQELQLNQEAS
FT                   LLVSNLEQERKNKPKIRKKKTLKQRLSRIKENIIRAINKEKWKEQQRIREILGKEIVRF
FT                   M"
FT   gene            394634..394846
FT                   /gene="rpmE"
FT                   /locus_tag="D11S_0431"
FT   CDS_pept        394634..394846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="D11S_0431"
FT                   /product="50S ribosomal protein L31"
FT                   /note="RpmE; there appears to be two types of ribosomal
FT                   proteins L31 in bacterial genomes; some contain a CxxC
FT                   motif while others do not; Bacillus subtilis has both
FT                   types; the proteins in this cluster have the CXXC motif;
FT                   RpmE is found in exponentially growing Bacilli while YtiA
FT                   was found after exponential growth; expression of ytiA is
FT                   controlled by a zinc-specific transcriptional repressor;
FT                   RpmE contains one zinc ion and a CxxC motif is responsible
FT                   for this binding; forms an RNP particle along with proteins
FT                   L5, L18, and L25 and 5S rRNA; found crosslinked to L2 and
FT                   L25 and EF-G; may be near the peptidyltransferase site of
FT                   the 50S ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81841"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006716752.1"
FT                   /protein_id="ACX81841.1"
FT                   /translation="MKQGIHPEYKEVTATCSCGNVIKTRSTLGKDINLDVCGKCHPFYT
FT                   GKQRVVDTGGRVERFNSRFKIPGTK"
FT   gene            394909..395601
FT                   /locus_tag="D11S_0432"
FT   CDS_pept        394909..395601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0432"
FT                   /product="beta-1,4-galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81842"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542843.1"
FT                   /protein_id="ACX81842.1"
FT                   /translation="MDSAYNLPPIFVISLKNSHRREFIAKRLNGLGLQFEFFYAVYGKA
FT                   LSEEELTKVDYQYYQDFDNKRLTLGEIGCALSHIQVYEHIKKNNIAEAIILEDDAIVST
FT                   HFKAILQAAIEKLPSRYEILFFDHGKAKSYPLIKKCLPEGYKLVRYRYPSKNSRRSIMK
FT                   ATAYMVNLAGVEKLLKYAYPLRMPADFVTGFIQKTRIHAYGVEPSCVFEGLAVESEINS
FT                   IEDRYKKA"
FT   gene            395602..396624
FT                   /locus_tag="D11S_0433"
FT   CDS_pept        395602..396624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0433"
FT                   /product="heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81843"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576932.1"
FT                   /protein_id="ACX81843.1"
FT                   /translation="MKALLRKIRLALGKMLLDKNVQGQALPANPKIIVLQQDGKIGDYI
FT                   VSSFIFRELKRHNPKMQVDVVCSPKNVNLFEQNPSIDHCFILNRKEHCAYSRMGKQLSH
FT                   EHYDVLINLPVLLRNRDLWLTRLIHAKNNIGYKKQNYKLFNLNVTQDQLHFSKVYAEAI
FT                   KLCGVKDINLEYDIPNHSDKKEDIANFIQKNHLVDCIAINFFGAAGTRKFTEQNIYRFM
FT                   EKFKAENKKALLLTYPEVTPLLKTIAEKYTNAFIYENTENIFDTITLLHYTSLVISPDT
FT                   SIIHIAAGLNKKIIGFYKLADKENFTHWNPNCKNKTYILNFIENVNEISPDEIKSEWLK
FT                   "
FT   gene            396634..397686
FT                   /locus_tag="D11S_0434"
FT   CDS_pept        396634..397686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0434"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81844"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544945.1"
FT                   /protein_id="ACX81844.1"
FT                   /translation="MSITKKLVAKLAGKRKAENIDLIMIKSVLLKPIGDAIGDAVAHTA
FT                   HLKQLKLASPELVIGVIVTERNRDIFAYSDLVDVLLEDKPLTYISQCRKWDLYLDFQPT
FT                   YTTKSIILEKLLSPRYIIVFNKKHKENYNLDTIKNYNFACPQNDTTHISEYLNDSAISA
FT                   YLDPKAVEYALINQETIRFEVLWGDKVRILLAPEGSTRKIPASEFAELLNSLSPTIVEN
FT                   VLFVLTNTKESATYFEELISLCDNKIQIKLSPKTTIQEYIQLVSSADLIISVDSGTVHL
FT                   ATALQKKVLAFYARNIANFCRWQPKGKAEVPYKAIMSKTESDSNNHTCDFPMDEAADWV
FT                   NHLFQTLPKH"
FT   gene            complement(397689..398504)
FT                   /locus_tag="D11S_0435"
FT   CDS_pept        complement(397689..398504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0435"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="Involved in base excision repair of DNA damaged by
FT                   oxidation or by mutagenic agents. Acts as DNA glycosylase
FT                   that recognizes and removes damaged bases"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81845"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544946.1"
FT                   /protein_id="ACX81845.2"
FT                   /translation="MPELPEVETAVRGVSPYLKDYVIEKIVVRQPKLRWAVSPELAELH
FT                   HVKILDLTRRAKYLVIHTEQGYIIGHLGMSGTVRIVFHGSPIDKHDHLDIVVNNGKLLR
FT                   YNDPRRFGAWLWTEKLDEFHLFLKLGPEPLSEEFNAEYLFKKLHKKTTALKTVLMDNTV
FT                   VVGIGNIYANESLFLCGLHPLKLAANLTRKQCERLVDTIKSVLAKAIEQGGTTLKDFLQ
FT                   PDGRPGYFAQELLVYGNKGKPCPKCGTKIESLVIGQRNSFYCPTCQKKG"
FT   gene            complement(398586..398756)
FT                   /gene="rpmG"
FT                   /locus_tag="D11S_0436"
FT   CDS_pept        complement(398586..398756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="D11S_0436"
FT                   /product="50S ribosomal protein L33"
FT                   /note="in Escherichia coli BM108, a mutation that results
FT                   in lack of L33 synthesis had no effect on ribosome
FT                   synthesis or function; there are paralogous genes in
FT                   several bacterial genomes, and a CXXC motif for zinc
FT                   binding and an upstream regulation region of the paralog
FT                   lacking this motif that are regulated by zinc similar to
FT                   other ribosomal proteins like L31; the proteins in this
FT                   group lack the CXXC motif"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81846"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:B8F859.1"
FT                   /protein_id="ACX81846.1"
FT                   /translation="MAAKGAREKIRLVSTAETGHFYTTTKNKRNMPEKMEIKKFDPVVR
FT                   KHVVYKEAKIK"
FT   gene            complement(398768..399004)
FT                   /gene="rpmB"
FT                   /locus_tag="D11S_0437"
FT   CDS_pept        complement(398768..399004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="D11S_0437"
FT                   /product="50S ribosomal protein L28"
FT                   /note="required for 70S ribosome assembly"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81847"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018347033.1"
FT                   /protein_id="ACX81847.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVDSENR
FT                   FVTLRLTAKGMRIIDKKGIDAVLAEIRARGEKI"
FT   gene            complement(399213..399872)
FT                   /locus_tag="D11S_0438"
FT   CDS_pept        complement(399213..399872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81848"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005586252.1"
FT                   /protein_id="ACX81848.1"
FT                   /translation="MNEALMPREKLLKYGAAALTDDELLAIFLRTGIKDCPVMQLSKNV
FT                   LQHFGSLRELIRADQKQFCAVKGIGVTQFIQLQACTEMTRRYLFAELKETHCFTSTDIV
FT                   KMYLQTELANIEREIFMVLFLDNQHRLIKQERLFLGTINKAMVYPREIIKEALACNAAA
FT                   IILAHNHPSGVAEPSISDKQITDTIRQAADLVDIRVLDHFVIGNGRYFSFAEQNLL"
FT   gene            400050..401249
FT                   /locus_tag="D11S_0440"
FT   CDS_pept        400050..401249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0440"
FT                   /product="bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="catalyzes the conjugation of cysteine to
FT                   4'-phosphopantothenate to form
FT                   4-phosphopantothenoylcysteine, which is then decarboxylated
FT                   to form 4'-phosphopantotheine"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81850"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540229.1"
FT                   /protein_id="ACX81850.1"
FT                   /translation="MINIENKRIVVGITGGIAAYKTIELIRLLRKANAQVRVVLTPAAA
FT                   EFVTPLTLQAISGNAVAQSLLDPQAELAMGHIELAKWADAVLIAPASADFIARLTVGMA
FT                   NDLLSTLCLATNTPILLAPAMNQQMYRQAITQQNLTALLSRGVQLIGPNSGEQACGDVG
FT                   AGRMSEPSEIFTALCDHFAIQQDLAGINVAITAGPTREAIDPVRYISNHSSGKMGFAIA
FT                   EAFAKRGANVTLIAGPVNLATPKNASRIDVTSAQQMWQTALECAVKSHIFIGCAAVSDY
FT                   RVADIAEQKIKKSGEEMTLKLIKNPDIIADVAYLAENRPFVVGFAAETQHVADYAKDKL
FT                   QRKNLDMICANDVSGGQVFGADQNALQLFWKGGEKVLPLADKNKLAEILVDEIVTRYGK
FT                   "
FT   gene            401318..401773
FT                   /locus_tag="D11S_0441"
FT   CDS_pept        401318..401773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0441"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="catalyzes the formation of dUMP from dUTP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81851"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006716724.1"
FT                   /protein_id="ACX81851.1"
FT                   /translation="MKKIDVKILDQRIGKEFPLPTYATEGSAGLDLRALIDESIAIQPG
FT                   ETTLIPTGLSIYIADPNLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSVWNRG
FT                   AEPFKIEVGDRIAQLVFVPVVQAEFNIVSEFNATERGEGGFGHSGKH"
FT   gene            401773..402372
FT                   /gene="slmA"
FT                   /gene_synonym="ttk"
FT                   /locus_tag="D11S_0442"
FT   CDS_pept        401773..402372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slmA"
FT                   /gene_synonym="ttk"
FT                   /locus_tag="D11S_0442"
FT                   /product="division inhibitor protein"
FT                   /note="FtsZ binding protein; synthetically lethal with a
FT                   defect in the Min system; this protein is the first
FT                   identified nucleoid occlusion factor which works along with
FT                   the Min system to properly position the FtsZ ring assembly"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81852"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540234.1"
FT                   /protein_id="ACX81852.1"
FT                   /translation="MEQANKRSIKERRQQVLTVLTHMLHSERGMERMTTARLAAEVGVS
FT                   EAALYRYYPSKTKIFEALIENIESTLLNRISQSIKHETNTMQRVKDIMQMILDFARKNP
FT                   GLTRVLTGHALMFEDAKLQARVATFFDRLELQFVNILQMRKLREGRGFNVDERIIAAHL
FT                   VTLCEGQFMRYVRSNFRHMPNQGFNQQWQLMESLFA"
FT   gene            402392..402610
FT                   /locus_tag="D11S_0443"
FT   CDS_pept        402392..402610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81853"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549318.1"
FT                   /protein_id="ACX81853.1"
FT                   /translation="MIIPWQELAEETLVNIVESVILREGTGYGSHEQTFEQKKKALLNR
FT                   IRQGSAVIVWSELHESIDIKDKTEFFR"
FT   gene            402648..403292
FT                   /locus_tag="D11S_0444"
FT   CDS_pept        402648..403292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0444"
FT                   /product="cyclic AMP receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81854"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564726.1"
FT                   /protein_id="ACX81854.1"
FT                   /translation="MQEQNAQATQSMDPTLEWFLSHCHIHKYPSKSTLINAGEKAETLY
FT                   YLIQGSVSVLVKDEDGKEMILTYLSQGDFFGEAGLFEEGQRRSAWIKAKSSCEVAEISY
FT                   RKFRQLIQVNPEILMYLTAQLAYRLQNTSRQVSNLAFLDVTGRIAQTLLNLAKMPEAMT
FT                   HPDGMQIKITRQEIGQMVGCSRETVGRILKMLEDQHLISAHGKTIVVYGTR"
FT   gene            complement(403425..404795)
FT                   /locus_tag="D11S_0445"
FT   CDS_pept        complement(403425..404795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0445"
FT                   /product="glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="catalyzes the reduction of 2 glutathione to
FT                   glutathione disulfide; maintains high levels of reduced
FT                   glutathione in the cytosol; involved in redox regulation
FT                   and oxidative defense"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81855"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702361.1"
FT                   /protein_id="ACX81855.1"
FT                   /translation="MSRHYDYLAIGGGSGGIASINRAASYGKKCAIIEAKHLGGTCVNV
FT                   GCVPKKVMFYGAQIAEAINHYALDYGFDVEVKKFDFAKLVESRQAYIDRIHTSYNNVLA
FT                   KNNVDVIHGFAKFVNKNTVEVTLADGSTEQVTADHILIATGGRPSHPPVKGVEYGIDSD
FT                   RVFALNALPKRVAIIGAGYIAVELAGVFNSLGSDTHLVVRRHAPMRNQDPLIVETLVEV
FT                   LEQDGIHLHKHTTVQEVIKNADGSLTVKFDHDREIIVDCLVWTIGRDPATDKIGLENIG
FT                   VETNDRGFIKVDKYQNTNVPGIYAVGDIIDGGIELTPVAVAAGRRLSERLFNNKPNEYL
FT                   DYNLVPTVVFSHPPIGTVGLTEPQAIEQYGAENVKVYKSSFTPMYSAVTQRRQPCRMKL
FT                   VCAGKEEKIVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR"
FT   gene            complement(404890..405735)
FT                   /locus_tag="D11S_0446"
FT   CDS_pept        complement(404890..405735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0446"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81856"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005715907.1"
FT                   /protein_id="ACX81856.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHIVLMLIIESLQQKEKGFYYLDTHSGA
FT                   GRYRLLSAEAEKTAEYVDGIGRLWAREDLPAEVARYVALIKKLNYGGKELRYYAGSPLL
FT                   AANLLRPQDRALLVELHPSEFPLLRNNFKEFDNVTVKIGDGFQQVKVTLPPKERRGLVL
FT                   IDPPYELKEDYDLVVKAVEEGYKRFATGIYVIWYPVVLRQQTKRIVKGLEATGIRKILQ
FT                   IELAVRPDSDQRGMTASGMIVVNPPWTLEQQMKSILPYLTTALIPQGTGSWSVNWITPE
FT                   "
FT   gene            complement(405830..408397)
FT                   /locus_tag="D11S_0447"
FT   CDS_pept        complement(405830..408397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0447"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81857"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555443.1"
FT                   /protein_id="ACX81857.1"
FT                   /translation="MRIAKLILSSLLTLFILGGIVAGMFYIQLKSDLPDVETLKTVELQ
FT                   QPMQIYTSDGKLIGEVGEQRRIPVKLADIPEKLIQAVLATEDSRFYEHHGLDPIGIGRA
FT                   LMVAVTKGGASQGASTITQQLARNFFLTPEKSLIRKAKEAILAIDIENALDKNEILELY
FT                   LNKIYLGYRSYGVAAAAKTYFGKELNQLTLSEMAVIAGLPKAPSTMNPLFSPKRALERR
FT                   NVVLGRMLDQKYISKEEYDAALKAPIVASYHGAQMDFRADYVTEMVRQEMVRRFGEENA
FT                   YTKGYKVYTTVLSKDQETAQKAVRDNLIAYDMRHGYRGGAPLWKKDEAPWDNDTIIGFL
FT                   KKLPNSEPFIPAAAVGVAKSGAELLLASGDKITLPSSAMRWTGQANPVKVGDQIWIRKN
FT                   DKGGWMLGQIPQANSALVSLNSDNGAIEAIVGGFSFEQSKFNRATQSLVQVGSSIKPFI
FT                   YAAALEKGLTLSSVLQDMPIVLKKSGQKEWRPKNSPDRYDGPLRLRVGLGQSKNMIAIR
FT                   SMQMAGIDFVADFLQRFGFKRDQYFASEALALGAASFTPLEMARGYAVFDNGGYLVDPY
FT                   IINKILDNSGKEIFVANPKVACPTCDNIPVIYGETEKLDGFKNTDLTPADEFARTDEST
FT                   NGEEVDQGESVPDIPELQPRVDVVKEENLNLMADAKTNGSEVQYAPRVISGELAFLIRS
FT                   ALSTAIYGEQGLGWKGTSWRMANDIKRKDIGGKTGTTNNSKVAWYAGFGANLTTAVYIG
FT                   FDDNRFNLGRGEAGAKSAMPAWIAYMKPILQDIPERALPMPANIVEKHIDLRSGLLAND
FT                   GRVEYFIKGTEPTRAYVEERGYYVPSELLDGDSSPGGQPEELF"
FT   gene            408531..409340
FT                   /locus_tag="D11S_0448"
FT   CDS_pept        408531..409340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0448"
FT                   /product="competence protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81858"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562051.1"
FT                   /protein_id="ACX81858.1"
FT                   /translation="MFIRHIPTLQVGLWCRGETIDAAWIDPQNQPHFLRLGELELMELT
FT                   SHLNRRFNHPRKKLAYKFITAIMPHQIWQKTLILPHNLNLQECEQQCHFSLTNELPIPT
FT                   EEVWYDYAATPLKQGFRLDIFAIRQQIATEYLQQLMPLQIDVLDNAAKAMLRAAEYFLG
FT                   HALPNNAVFLYQDETGLLAVQHKLQQTQTLFQTQGNLTALLAQYCQRYAEEPMQVFYYQ
FT                   TEKDAQAIPQSWHAIETELPFIALGNALWQRETPLKSTALFDADHNI"
FT   gene            409351..409869
FT                   /locus_tag="D11S_0449"
FT   CDS_pept        409351..409869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0449"
FT                   /product="competence protein ComB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81859"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544973.1"
FT                   /protein_id="ACX81859.1"
FT                   /translation="MKKDINLLPWRIQLQRQQNKALLHQLILCALICTSGWLILGSLAE
FT                   SHAETAETIQTELTKIQPEQQLTQRHIQQLRSTQTDSEELHPVSKETVFSLLNQLTELP
FT                   LTQGELTELSLKTAQLTLTGYSHSQEEFSRLNQFLTQQPLFAEVTLAEFKPNADELQFQ
FT                   FNLTLRDTP"
FT   gene            409866..410390
FT                   /locus_tag="D11S_0450"
FT   CDS_pept        409866..410390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0450"
FT                   /product="competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81860"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518174.1"
FT                   /protein_id="ACX81860.1"
FT                   /translation="MKFNGINGFLQHWHRLTSWQQRALLIFVCLLALYFPTWDYWQQRS
FT                   QAEAISQQLQIQQEKLAHQQKILAALKEKAAKQLLTPELAGKLPPINQQIQQFASKLHI
FT                   AHSQWDFHQKPLLKLQLHGQFTDLREFLTALFSANDELELLEWHIIKNADTNDGHSIHS
FT                   ELLFQLHTKEK"
FT   gene            410390..410782
FT                   /locus_tag="D11S_0451"
FT   CDS_pept        410390..410782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0451"
FT                   /product="competence protein ComD"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81861"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549304.1"
FT                   /protein_id="ACX81861.1"
FT                   /translation="MLHPLFVFFIGVLFSLSVTANDPFDKTQRGTTASNASLKDTTSVI
FT                   QCYKGTEAIFPSTAFNQIRIVGVLQHQKDWQLLLLADNQVNLAQQGDFVAAENLKIEHI
FT                   GKQEIRFLRWDNPQNCELSTTLNIKF"
FT   gene            410802..412211
FT                   /locus_tag="D11S_0452"
FT   CDS_pept        410802..412211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0452"
FT                   /product="secretin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81862"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544978.1"
FT                   /protein_id="ACX81862.1"
FT                   /translation="MKSILSRRLKCGLFFGCFLSLAVQAEQNPVFSIRLKQAPLVPTLQ
FT                   QLALAHNTNLIIDDELQGTVSLQLENVDLDQLFRSVAKIKQLDLWQENGIYYFTKGDTN
FT                   TKFAGKMEEPFPLSLPMAEEPAQLTTATIKLHFAKASEVMKSLTGGSGSLLSPNGSITF
FT                   DDRSNLLLIQDEPRSVRNIKKLIKELDKPIEQIAIEARIVTINDESLKELGVRWGIFSP
FT                   TDNAHRIGGSLAGNGFDNLVNQLNVNFPTTTTPAGSVALQVAKINGRLLDLELTALERE
FT                   NNVEIIASPRLLTTNKKSASIKQGTELPYILVNEKSGSQSVEFREAVLGLEVTPHISQD
FT                   KQILLDLIVSQNSPGSRVAYGLGEVVSIDKQEINTQVFAKDGETIVLGGVFSDTITKGT
FT                   DKVPVLGDIPGIKHLFSKESERHQKRELVIFVTPHILRKGETPDAFKQKRIGVNEQIMA
FT                   KGENKKDLNRK"
FT   gene            412425..412952
FT                   /gene="aroK"
FT                   /locus_tag="D11S_0453"
FT   CDS_pept        412425..412952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="D11S_0453"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="type I enzyme similar to type II but differentially
FT                   regulated; major shikimate kinase in fully repressed cells;
FT                   catalyzes the formation of shikimate 3-phosphate from
FT                   shikimate in aromatic amino acid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81863"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555432.1"
FT                   /protein_id="ACX81863.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQLLNMDFVDTDAEIEERAGA
FT                   DIGWIFDVEGEAGFRKREERIINELTQRQGIVLSTGGGAVLSKDNRNQLAARGIVIYLE
FT                   TTVEKQYQRTQRDKKRPLLQDVADPRQVLEDLAKIRNPLYEDVADITLPTDDQSAKVMA
FT                   TQIIDLIDNYNG"
FT   gene            412976..414064
FT                   /locus_tag="D11S_0454"
FT   CDS_pept        412976..414064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0454"
FT                   /product="3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81864"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564710.1"
FT                   /protein_id="ACX81864.1"
FT                   /translation="MLCVSVELKERSYPIHIGAGLLTDPHCYPLKPGNKVMIVTNPTVA
FT                   QYYLAIVTDMLEKIGCLVERVLLPDGEQYKTLDSLNLIFTALLQANHGRDTTIVALGGG
FT                   VIGDVAGYAAASYQRGVRFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPNAVI
FT                   VDTLTLNTLPKREVNAGLAEVIKYGVILDFPFFEWLEQHIDEVVALDQSALRQCIARCC
FT                   QLKADIVARDETEKGDRALLNLGHTFGHAIEAHLGYGNWLHGESIAAGCMMAAVLSERL
FT                   GDLTKADVARLEKLLASANLPTVSPDGMTAQDYLPLMMRDKKVLNGKLRLVLLKSLGRA
FT                   YVATDINQDLVIDAIHRCSQFD"
FT   gene            414067..414921
FT                   /locus_tag="D11S_0455"
FT   CDS_pept        414067..414921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0455"
FT                   /product="DNA adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81865"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005554455.1"
FT                   /protein_id="ACX81865.1"
FT                   /translation="MPEPAKPATPAKSRPFLKWAGGKYRLMDEINRLLPKRKQCLVEPF
FT                   VGAGAVFLNSNFKRYILADINPDLINLFNIVKLDVERYIQACKPIFFHPEANTEIYYYG
FT                   KRKEFNQSTDVFQRAVLFLYLNRFGFNGLCRYNSKNEFNVPFGDYKTHYFPEEELRFFA
FT                   AKAQSAVFICADFQQTFEMADENSVIYCDPPYAPLSQDSNFTNYAGNEFSIAHQRDLAN
FT                   LAKHTMEQRNIQVLISNHDTPFTREIYQGAKIRRLKVQRSISQAPHKRIKVRELIAMFK
FT                   QGK"
FT   gene            complement(415027..415506)
FT                   /locus_tag="D11S_0456"
FT   CDS_pept        complement(415027..415506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0456"
FT                   /product="single-stranded DNA-binding protein"
FT                   /note="binds to single stranded DNA and may facilitate the
FT                   binding and interaction of other proteins to DNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81866"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167545.1"
FT                   /protein_id="ACX81866.1"
FT                   /translation="MAGVNKVIIVGNLGNDPEVRTMPNGEAVANITVATSESWNDKNTG
FT                   ERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEGRLRTRKWQDQNGQDRYTTEIQGDV
FT                   LQMLDSRADRQSGGNYTPTSQPSYPNQQQSAPRSAPASKPAAEAPMDNFDDDIPF"
FT   gene            415677..418508
FT                   /locus_tag="D11S_0457"
FT   CDS_pept        415677..418508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0457"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81867"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585980.1"
FT                   /protein_id="ACX81867.1"
FT                   /translation="MDTIDIRGARTHNLKNINLTIPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPHHHVPLTAQTISQMVDKVLSLPQDSKMMLLAPVVKERKGEHV
FT                   KLLQQISAQGYIRARIDGEICDLSDPPKLELQKKHTIEVVVDRFKVRSDLATRLAESFE
FT                   TTLELSGGTAMVAYMDDPKAEELVFSANFACPHCGYSVPELEPRLFSFNNPAGACPTCD
FT                   GLGVQQYFDEKRVVQNPNISLANGAIKGWDRRNFYYYQMLTSLSKHYHFDIETPFEALP
FT                   KKIQQIILNGSGKEEIEFQYMNDRGDVVLRRHAFEGILNNMARRYKETESMSVREELAK
FT                   HISNRSCADCGGSRLRPEARNVYIEQTNLPEVSEKSIGEALDFFGNLQLSGQKAQIAEK
FT                   ILKEIKERLQFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLNTLIHLRNLGNTVIVVEHDEDAILSADHIIDIGPGAGVHGGSVIAEGT
FT                   AQQIMQNPNSLTGKFLSGTEKIEIPKKRTALDKKKMLKLFGASGNNLKNVNLDIPVGLF
FT                   TCITGVSGSGKSTLINDTLFPIAQNALNRAENAEVSPYKSIKGLEFFDKVIDINQSPIG
FT                   RTPRSNPATYTGVFTPIRELFAGVPEARARGYNPGRFSFNVRGGRCEACQGDGVIKVEM
FT                   HFLPDVYVPCDQCKGKRYNRETLEIRYKGKTIHQVLDMTVEDAREFFDAIPMIARKLQT
FT                   LIDVGLSYIRLGQSSTTLSGGEAQRVKLATELSKRDTGKTLYILDEPTTGLHFADIKQL
FT                   LSVLHRLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGQIIATGTPEQVAKMEGS
FT                   HTARFLKDILAKG"
FT   gene            complement(418577..418987)
FT                   /locus_tag="D11S_0458"
FT   CDS_pept        complement(418577..418987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0458"
FT                   /product="SoxR protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81868"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544990.1"
FT                   /protein_id="ACX81868.2"
FT                   /translation="MKIGKLAKAVGCSVEAIRFYEQKGLMPRPPRSAGGFRLYTDEHLQ
FT                   RLSFICYCRSLDMSLKEIKLLLSLESASEQQKAEINQLLDRHIQDIAKHIHRLQHLRMN
FT                   LIQLKQQCGEVNQQQNLLRILQYSQVKFRPLK"
FT   gene            complement(419096..419407)
FT                   /locus_tag="D11S_0459"
FT   CDS_pept        complement(419096..419407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81869"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544590.1"
FT                   /protein_id="ACX81869.1"
FT                   /translation="MRYQKPVNIQTLLQDSPLAKIVQKGIRLNELNQQVNGFFPPEFKD
FT                   LYRIANIEQNSLRIEVANAMVRQSFLFRQQELLRLIQQHLPEITQLTFYINPEFRRGA"
FT   gene            419499..419816
FT                   /locus_tag="D11S_0460"
FT   CDS_pept        419499..419816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81870"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561253.1"
FT                   /protein_id="ACX81870.1"
FT                   /translation="MIISHKSKHHFWSQLLLGMLAIFVLPVGQELNYSSSVGSENYQNA
FT                   QQQNAPQILTTVALLQQTSQQQHQPQHAPLEAENLPQNEPHFARSPFVPNAPIRAGPQF
FT                   I"
FT   gene            419889..422588
FT                   /gene="secA"
FT                   /gene_synonym="azi"
FT                   /gene_synonym="div"
FT                   /locus_tag="D11S_0461"
FT   CDS_pept        419889..422588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /gene_synonym="azi"
FT                   /gene_synonym="div"
FT                   /locus_tag="D11S_0461"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="functions in protein export; can interact with
FT                   acidic membrane phospholipids and the SecYEG protein
FT                   complex; binds to preproteins; binds to ATP and undergoes a
FT                   conformational change to promote membrane insertion of
FT                   SecA/bound preprotein; ATP hydrolysis appears to drive
FT                   release of the preprotein from SecA and deinsertion of SecA
FT                   from the membrane; additional proteins SecD/F/YajC aid SecA
FT                   recycling; exists in an equilibrium between monomers and
FT                   dimers; may possibly form higher order oligomers; proteins
FT                   in this cluster correspond SecA1; SecA2 is not essential
FT                   and seems to play a role in secretion of a subset of
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81871"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167592.1"
FT                   /protein_id="ACX81871.2"
FT                   /translation="MLRTIATKIFGSRNDRILRRLNKIVVKINKLEPEFEALSDEQLKA
FT                   KTAEFRERLGKGETLESLMPEAFATVREASKRVLGMRHFDVQLIGGMVLNDRCIAEMRT
FT                   GEGKTLTATLSCYLNALPGKAVHVVTVNDYLARRDAETNRPLFEFLGMTVGVNIPGLSP
FT                   EEKRAAYAADITYATNSELGFDYLRDNLAHSPQERFQKDLYYALVDEVDSILIDEARTP
FT                   LIISGQAEDSSELYIAIDKLIPNLIKQDKEDTEEYQGTGDYTLDLKTKQAHLTERGQEK
FT                   CEQWLIQQGFMKDTESLYSPSKITLLHHVMAALRAHTLFERDVDYIVKDGEIVIVDEHT
FT                   GRTMAGRRWSDGLHQAIEAKEGVRIQSENQTVASITYQNYFRLYEKLAGMTGTADTEAF
FT                   EFQKIYGLETVVIPTNRPMIRDDRTDVMFETEEYKFNAIIDDIKDCVARQQPVLVGTIS
FT                   IEKSELLSNALDKAGIKHNVLNAKFHAQEAEIVANAGYPGAVTIATNMAGRGTDIVLGG
FT                   NWKAEVDKLENPTAEQIEAIKAAWQERHDIVKNAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSLEDALMRIYLNEGKLNMMRKAFSNTAEAMESKLLAKVIASAQAKVE
FT                   AHNFDGRKNLLEFDDVANDQRHAIYEQRNELLENDDISETIDVIRRDVFNSVIDQYIPP
FT                   QSLEEQWDIPALEQRLKQDFALDLPIRKWLDEDNHLHEETLRERIIQSAVDEYKRKEEL
FT                   AGEQTMRNFEKGVMLQTLDELWKEHLSAMDHLRRGIHLRGYAQKDPKQEYKKESFQMFT
FT                   EMLDALKLSVVTTLSRVQVRTSEEMEEAERLRQELAQREAAAMQYNNDESQGAQQGTEE
FT                   HHKIGRNEPCPCGSGKKYKHCHGSRARH"
FT   gene            422665..423069
FT                   /locus_tag="D11S_0462"
FT   CDS_pept        422665..423069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0462"
FT                   /product="8-oxo-dGTP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81872"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005648100.1"
FT                   /protein_id="ACX81872.1"
FT                   /translation="MSKQLVQVAAGIIRNEFGQIYLTQRLEGQDFAQALEFPGGKVDKG
FT                   ETPEQALKRELEEEIGIVVLNAQLLERFEFEYPTKVITFFFYLAEEWVGEPFGREGQDG
FT                   FWLAQNELDAGQFPPANAKLIQRLLAESGD"
FT   gene            complement(423561..424595)
FT                   /locus_tag="D11S_0463"
FT   CDS_pept        complement(423561..424595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0463"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81873"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545003.1"
FT                   /protein_id="ACX81873.1"
FT                   /translation="MNRLFPEQLASSLERHLARVYFLVGEDPLLLNESAEGIYQAALQQ
FT                   GFDEKVELDINASTDWNDLFERVQSMGLFFNKQLIILDLPENATALLQKNLSEFISLLQ
FT                   PDVLAIFRLAKLTKAAEKQAWFMAANQYEPQAVLVNCQTPNAEQLPRWVANRAKMLGLS
FT                   IEQEAVQLLCYSYENNLLALKQTLQLLDLLYPDRKLTFARVNSVVEQSSVFTPFQWVDA
FT                   ILGGKGNRARRILTGLKDEDVQPIILLRTLQRDLMTLLEISKPEQPQSLDSPLPTDQLR
FT                   EQFDRLKVWQNRRSLFTQAVQRLTYRKLYLFFQQLADVERCAKQEFSDDIWQQLEDLSV
FT                   RFTG"
FT   gene            complement(424595..425098)
FT                   /locus_tag="D11S_0464"
FT   CDS_pept        complement(424595..425098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81874"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545005.1"
FT                   /protein_id="ACX81874.1"
FT                   /translation="MLKHVKTLLLAAAVFGLSACGFHFQNGELIPKELQTLRLESSDPY
FT                   SDMARVMRRQLQLNNVTLVEDQTNVPVLRLNGIFTKDQVVSIFKQGREAEKQLILEVDA
FT                   SVKLPNQDSFPISTRVNRTFFDNSRAALAKSAEKDVIWQDMREQAARQLINKMVALQHQ
FT                   IKDK"
FT   gene            complement(425240..427828)
FT                   /gene="leuS"
FT                   /locus_tag="D11S_0466"
FT   CDS_pept        complement(425240..427828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="D11S_0466"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number="6.1.1.4"
FT                   /note="leucine--tRNA ligase; LeuRS; class-I aminoacyl-tRNA
FT                   synthetase; charges leucine by linking carboxyl group to
FT                   alpha-phosphate of ATP and then transfers
FT                   aminoacyl-adenylate to its tRNA; due to the large number of
FT                   codons that tRNA(Leu) recognizes, the leucyl-tRNA
FT                   synthetase does not recognize the anticodon loop of the
FT                   tRNA, but instead recognition is dependent on a conserved
FT                   discriminator base A37 and a long arm; an editing domain
FT                   hydrolyzes misformed products; in Methanothermobacter
FT                   thermautotrophicus this enzyme associates with prolyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81876"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540005.1"
FT                   /protein_id="ACX81876.1"
FT                   /translation="MQEQYRPDLLEPEVQKFWQDNKTFKAVQDNNKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVVSRYQRMIGKNVLQPMGWDAFGLPAEGAAVKNNTAPAKWTYEN
FT                   IAYMKNQLQLLGFSYDWDREVTTCRPEYYKWEQWFFTELYKKGLVYKKTSTVNWCPNDK
FT                   TVLANEQVHEGCCWRCDTPVEQKEIPQWFIKITDYAEQLLNCLDELPQWPETVKTMQRN
FT                   WIGRSEGVEITFDIKDTNEKLAVYTTRPDTFYGVSYVAVAAAHPLATLAAQNNPALAQF
FT                   IQEAKNTKVAEADIATMEKKGMATGLYAVHPLTGELLPVWVANFVLMHYGTGAVMAVPA
FT                   HDQRDYEFAQKYGLPIKQVIEPIHGEEIDLTKQAFTEHGKLIHSAEFDGLEFGAAFSGI
FT                   ADKLEQLGMGKRQVNYRLRDWGVSRQRYWGAPIPMLTLENGDVVPAPMKDLPIILPEDV
FT                   VMNGVNSPIKADPEWAKTTYQGKLALKETDTFDTFMESSWYYARYTCPEYQQGMLNSEE
FT                   ANYWLPVDQYIGGIEHATMHLLYFRFFHKLLRDAGFVTSDEPANKLLCQGMVLADAFYY
FT                   TSPTNERIWVSPTNVTLERDDKGRIVKATDDEGHELVHAGMTKMSKSKNNGIDPQEMVE
FT                   KYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFLARLWNLVFEYNKNPAKTPLNPTVL
FT                   SAAQKALRRDVHKTIAKVSDDIGRRQTFNTAIAAIMELMNKLTRAPLDDEQDRAMMAEA
FT                   LSAVVRMLYPITPHICFHLWQELGNQDIIDFAPWVEADAEAMIEDEKLIVVQVNGKVRG
FT                   KVTVAADTDEDRVKAVAFADENVKRFTDGMQIVKVIYVAGKLLNVVVKPQ"
FT   gene            complement(427949..428590)
FT                   /locus_tag="D11S_0468"
FT   CDS_pept        complement(427949..428590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0468"
FT                   /product="diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81878"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545009.1"
FT                   /protein_id="ACX81878.2"
FT                   /translation="MILVNLINANACDLFNIPFFQFAQMKKFCPEEIPRIKADYKAHWD
FT                   NWKATILQVSAALGSPFAKPHIESWTNGWQVRGHFFAYFKYEYHLNSAAILSVLLNRRR
FT                   LSVSLDWHCYCADRSQINVQQYNQWLENFDFARFADFDIWRGDESEYDDVRQVNQFTQQ
FT                   DLTLRSDKDFWCIGHNAEKADLDKLDATQFIVESIRDLLPLYEACHQLKP"
FT   gene            complement(428609..428902)
FT                   /locus_tag="D11S_0469"
FT   CDS_pept        complement(428609..428902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81879"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561270.1"
FT                   /protein_id="ACX81879.1"
FT                   /translation="MLTITEQELQIVKAILQQHIPNHSAWAFGSRVKGNAKTYSDLDLA
FT                   IIGESPLSLETLANLTEAFSESDLPWKVDIVDWAVTNDAFKQVILQCFEVIQ"
FT   gene            complement(428886..429293)
FT                   /locus_tag="D11S_0470"
FT   CDS_pept        complement(428886..429293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0470"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81880"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545013.1"
FT                   /protein_id="ACX81880.2"
FT                   /translation="MTELDLTPLTNAINRLAEGLVRYQSDITDIQIRDGLIQRFEFTYE
FT                   ISHKMLKRFLEYTEANPEQIDTMTFQDLIRTGNERGLLLGNWQNWKQYREMRSRTSHTY
FT                   DEETAILVVSGIPDFLREAQFLQKRLHAHHH"
FT   gene            complement(429384..430211)
FT                   /gene="apaH"
FT                   /locus_tag="D11S_0471"
FT   CDS_pept        complement(429384..430211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="D11S_0471"
FT                   /product="diadenosine tetraphosphatase"
FT                   /EC_number="3.6.1.41"
FT                   /note="hydrolyzes P(1),P(4)-bis(5'-adenosyl) tetraphosphate
FT                   to form 2 ADP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81881"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576888.1"
FT                   /protein_id="ACX81881.1"
FT                   /translation="MATYLIGDLHGCYDEFQMLLERVRFDPAQDTLYLTGDLLARGDNS
FT                   LACLRLVKSLGNAARTVLGNHDLHFISTALGVKKIKPRDRVDAIFAAEDFFELVNWLRC
FT                   QPLLIHNPAQNFVLVHAGISPDWDLTAAKVCANEVENVLRHGNYRYLVENMYAEQPDRW
FT                   SPHLQGLDRLRYSINVLTRMRFCYLDHRLDFACKLSIKDAPKALAPWFALDNPLYQTGN
FT                   IVFGHWASLVDETTPPNIYALDTGCVWGNRLTMLRWEDKQYFTQSAVKKSNAF"
FT   gene            complement(430227..431090)
FT                   /locus_tag="D11S_0472"
FT   CDS_pept        complement(430227..431090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0472"
FT                   /product="ribosomal RNA small subunit methyltransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81882"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518171.1"
FT                   /protein_id="ACX81882.1"
FT                   /translation="MNSKKHLGHTARKRFGQNFLHDNNVIQNIVAAIYPQPNQFLVEIG
FT                   PGLGALTEPVAEQVEHLTVLELDRDLAERLRHHPFLNQKFTVIETDAMQFDFSALYEQE
FT                   QLAEKGQKLRVFGNLPYNISTPLMFHLFHYHHIIQDMHFMLQKEVVKRLCAAPNSKAYG
FT                   RLTIMAQYFCQVMPVLEVPPSAFKPVPKVDSAVVRLIPHATLPHPVKDLYWLNRVCSQA
FT                   FNQRRKTLRNAFSGLFSAGNLTALGIDLNARAENLSIADYARLANWLADNPPADVNKED
FT                   VTDSDE"
FT   gene            complement(431169..432095)
FT                   /locus_tag="D11S_0473"
FT   CDS_pept        complement(431169..432095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0473"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81883"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561276.1"
FT                   /protein_id="ACX81883.2"
FT                   /translation="MNLKSVLFAAIGFFVLAAHVHAEEKVVATVNGIPILESQVQSAIN
FT                   KKTNDRQAALNKVIDDILVDQAVKESDVKVNNAQIDQIIEGIAAQNGLTFGQLLDALDY
FT                   QGISYRAYRQQIAQQVMMSEVRNHAISQSVDVSREQVEVLAKKMLDEAKAKGSVAQISD
FT                   TQYEVRHILLKLNPLLNDAQAKAQLEQIRADIIVGKTTFADAALKYSKDYLSGANGGSL
FT                   GYAFPEMYVGPFNQAVRTTKPGVISAPFKTEFGWHILEVTNTRQADRTEDAYRQKAYEQ
FT                   IVNQQLQDSALDWVQALRKRADIKYIN"
FT   gene            complement(432168..432704)
FT                   /locus_tag="D11S_0474"
FT   CDS_pept        complement(432168..432704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0474"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81884"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555386.1"
FT                   /protein_id="ACX81884.1"
FT                   /translation="MEKIIIDENQFLRTISRISHEIIEKHQYLDNLVIVGIKRRGAEIA
FT                   ELIKNKIKLLTQTDIPAFDLDITFYRDDLEHVQEDQVPVYSGASDFINIQHKEVILVDD
FT                   VLFTGRTIRAALDALVDFGRAAKVELVIFVDRGHRELPIRADYVGKNVPTSRSENIQVR
FT                   TMKFDQCYEVALLSK"
FT   gene            complement(432843..433253)
FT                   /locus_tag="D11S_0475"
FT   CDS_pept        complement(432843..433253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0475"
FT                   /product="molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81885"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539982.1"
FT                   /protein_id="ACX81885.1"
FT                   /translation="MQAILKTPLILTALLPFCVSAKISVENATVFATQSPDEPSAIFMN
FT                   LHNDGREPVNLAFAQSPRAARLELHGTQHGKMLTLSGIEIPANGNVQLKRGGLHIMVFE
FT                   AAKTLQAGEKFPLELMFDNGERVVVEANVVGH"
FT   gene            433366..433977
FT                   /locus_tag="D11S_0476"
FT   CDS_pept        433366..433977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0476"
FT                   /product="lysogenization regulator"
FT                   /note="HflD; UPF0274; in Escherichia coli this protein is
FT                   peripherally associated with the membrane and appears to
FT                   act with lambda CII protein; in Haemophilus influenzae a
FT                   knockout of the HI0638 gene affected paracytosis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81886"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575059.1"
FT                   /protein_id="ACX81886.1"
FT                   /translation="MANYYDITLALAGVCQAAKLAQQLALNGEADQQALEISLNSLLQT
FT                   APQTTLDVFGGAENHLKPGLTTLCEQLNGSEPELGRYWLSLLALAGKLNKTPEAKQELA
FT                   RRVQYLPTQLEHYHLLDEQMLSNFAGIYVDVISPLGRRIQVTGVTQYLQQVGTQNRIRA
FT                   ALLAGIRAAILWQQVGGTKWQLLFFRGKIAATAQQILSSL"
FT   gene            434001..435368
FT                   /locus_tag="D11S_0477"
FT   CDS_pept        434001..435368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0477"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Catalyzes two discrete reactions in the de novo
FT                   synthesis of purines: the cleavage of adenylosuccinate and
FT                   succinylaminoimidazole carboxamide ribotide"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81887"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561281.1"
FT                   /protein_id="ACX81887.1"
FT                   /translation="MQLSALTALSPIDGRYQDKTAELRSIFSEFGLLKFRVTVEVRWLQ
FT                   KLAATAQITEVPSLSQEANDYLDSIVENFSIIDAQRIKDIEKTTNHDVKAVEYFLKEKS
FT                   AALPELAAISEFIHFACTSEDINNLSHALMLSTARDNVLLPAWLNLIEKITALAEQYKR
FT                   IPLLSRTHGQPASPTTVGKEMANVVYRLRRQYKQLQTLEILGKINGAVGNYNAHLSAYP
FT                   NIDWHKLSEEFVTSLGVTWNPYTTQIEPHDYIAELFDCVARFNTIIIDFDRDLWGYIAL
FT                   NHFKQRTLAGEIGSSTMPHKVNPIDFENSEGNLGLANAVMAHLGSKLPISRWQRDLTDS
FT                   TVLRNLGVGLGYCLIAYAATQKGISKLEVNEAHLREELDQNWEVLAEPIQTVMRRYGIE
FT                   KPYEKLKELTRGKRVDAQAMFDFIEKLAIPAEEKARLQQLTPAGYIGAAVELVEKL"
FT   gene            435590..436339
FT                   /locus_tag="D11S_0479"
FT   CDS_pept        435590..436339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0479"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81889"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539977.1"
FT                   /protein_id="ACX81889.1"
FT                   /translation="MNNIKGKVVIITGASSGIGEATAYKLAENGAKLVLGARREAKLQA
FT                   IVDNITAKGGEAIYRVTDVVKAEDNAALVELAKATFGKVDAIFLNAGLMPNSPLSALET
FT                   NNWNAMVDVNIKGVLNGSAAVLPTFEAQKSGHILAVSSVAGLKVYPGASVYCGTKWAVK
FT                   AIMEGLRMESAQAGTNVRTATIYPAAVQSELVDHITNEDTSKGYRELYDTFEIPAERVA
FT                   NVVAFALSQPADTNISEFTLGPTTQPW"
FT   gene            complement(436453..436860)
FT                   /locus_tag="D11S_0480"
FT   CDS_pept        complement(436453..436860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0480"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81890"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539975.1"
FT                   /protein_id="ACX81890.1"
FT                   /translation="MSYTTAQAAQKMGISAHTLRFYDKEGLLPNVGRDEHGNRRFTDND
FT                   LQWLSLLQCLKNTGMSLKDIKRFTKCTTIGNSTIEERLALFENQTQNVKQQISELKRYL
FT                   SLLEYKVAFYQQAKALGSVQAVAKMMPEIPK"
FT   gene            436999..438123
FT                   /locus_tag="D11S_0481"
FT   CDS_pept        436999..438123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0481"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /EC_number="1.1.1.284"
FT                   /note="catalyzes the formation of S-formylglutathione from
FT                   S-(hydroxymethyl)glutathione; also catalyzes the formation
FT                   of aldehyde or ketone from alcohols"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81891"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576868.1"
FT                   /protein_id="ACX81891.1"
FT                   /translation="MEIKSIKSRAAVAFAPNQPLQIVEIDVEMPRKGEVLIRNTHTGVC
FT                   HTDAFTLSGQDPEGVFPVVLGHEGAGVVVAVGEGVTSVKEGDHVIPLYTAECGECEFCR
FT                   SGKTNLCVAVRDTQGRGFMPDGTTRFSYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPE
FT                   ANHEHVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGAIGLAVVQGASQAKAGRIIAI
FT                   DTNPAKFELAKQFGATDCLNPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRQALES
FT                   SHRGWGQSIIIGVAGAGQEISTRPFQLVTGRVWKGSAFGGVKGRTQLPKMVDDSMKGEI
FT                   DLKPFVTHTMTLDQINKAFDLMHEGKSIRTVIHY"
FT   gene            438138..438968
FT                   /locus_tag="D11S_0482"
FT   CDS_pept        438138..438968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0482"
FT                   /product="S-formylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81892"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545034.1"
FT                   /protein_id="ACX81892.1"
FT                   /translation="MEKIEQHQSFGGEQQVWTHFAQTLQCEMKVAVYLPPNPENRPLGV
FT                   IYWLSGLTCTEQNFITKSGFQRYAAEHQVIVVAPDTSPRGKEVPNDAAYDLGQGAGFYL
FT                   NATQSTWQTHYHMYDYILNELPSLIEQHFPTNGKQAIMGHSMGGHGSLVLALRNPERYQ
FT                   SVSAFSPILAPSLVPWGEKAFSAYLGEDRKKWQQYDANSLIKQGFKLKEMRIDQGLDDE
FT                   FLATQLRTEEFIETCRKANQPVDVRFHKGYDHSYYFIASFIGEHIAYHAQCLAD"
FT   gene            complement(439589..440968)
FT                   /locus_tag="D11S_0484"
FT   CDS_pept        complement(439589..440968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0484"
FT                   /product="signal recognition particle"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81894"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012771755.1"
FT                   /protein_id="ACX81894.1"
FT                   /translation="MFENLSDRLSKTLRNISGRGRLTEDNIKDTLREVRMALLEADVAL
FT                   PVVRDFINKVKERAIGVEVNKSLTPGQEFVKIVQAELEAAMGEANESLNLAAQPPAVIL
FT                   MAGLQGAGKTTSVGKLAKFLRERHKKKVLVVSADVYRPAAIKQLETLAQAVNADFFPSD
FT                   VKQNPVEIAKAALAEAKLKFYDVLIVDTAGRLHVDGEMMDEIKQVHAALNPVETLFTVD
FT                   AMTGQDAANTAKAFNEALPLTGVILTKVDGDARGGAALSIRQITGKPIKFLGVGEKTDA
FT                   LEPFHPDRVASRILGMGDVLSLIEDLERSVDREKAEKMAQKFKKGDDFTLEDFREQLRE
FT                   MKKMGGMMSMLEKLPGAKNLPDHVKNQVDDKMFNKLEAIINSMTLKERANPDIIKGSRR
FT                   RRIALGSGTQVQDVNKLLKQFDEMQRMMKKMRKGGMAKMMRGMQGLMGGGLGGLGGMFR
FT                   R"
FT   gene            441122..441916
FT                   /locus_tag="D11S_0485"
FT   CDS_pept        441122..441916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0485"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81895"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538533.1"
FT                   /protein_id="ACX81895.1"
FT                   /translation="MWIAVLSIIFYLISVLFITPMLLTSQVNGGQTQPKKTPFFLTALF
FT                   AIICHVFTTFPLLNDLANGQAFTLMEVASLMSVIIASLATLAMLRVNSMWFVLPIVYCF
FT                   SMVNLVCATFIPSHIIQLLNQNGSMLFHIGLSIFAYAVCCIATLYAIQLGWIDRRLKAK
FT                   KMHFSPMVPPLMTVERHFFRLLVSGEILLTLTLISGSYHLMHAMTPDNLHKGGFSLLGW
FT                   IVFGIAILGHKKYRWRGKKMIIYAISGMILLTIAYFGSRLIV"
FT   gene            441991..443253
FT                   /locus_tag="D11S_0486"
FT   CDS_pept        441991..443253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81896"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555371.1"
FT                   /protein_id="ACX81896.1"
FT                   /translation="MDSIPLSTLFIILIVCLVLSAYFSGSETGLLSLNKYRLRFLSEQG
FT                   NKGAKKAEKLLAKPDNLLSFILIFNNLVNVSASAIATVIGMRLYGDAGVAIATGLLTFV
FT                   MLIFSEIFPKTVAAMHPEKVGLTTSHLLIPLIKIFSPLAWVMNLFTKTLMRLVGLKPAL
FT                   KKQVISREELRSIVSEAGEATPDEQHPQMLLSILDMDTVTVDDIMVPRNEIGSIDIDDD
FT                   WKAIMRQLNHAAHNRVVLYKGSMDENVLGILRVREAFRLLLEKNEFTKETLIRAADKVY
FT                   FIPEGTPLKAQLANFRQRKERIGLVVDEYGDIKGLVTLEDILEEIVGEFTTSNAPTIDE
FT                   EVTQQSDGSIIIDGSANLRDLNKMFHWNLDTDEARTFNGLILEHLEEIPHEGTVCELNG
FT                   LQVTVLEVSENMIKRARVIKL"
FT   gene            443428..443898
FT                   /locus_tag="D11S_0487"
FT   CDS_pept        443428..443898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0487"
FT                   /product="energy transducer TonB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81897"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538526.1"
FT                   /protein_id="ACX81897.1"
FT                   /translation="MPQIFEFLQNYSDYIIIGLLLFMSVLMLTMVIERFFFLSRVKVSQ
FT                   YSTIYALEIDLNRNLTIVSTVGANAPYVGLLGTVIGILLTFYQIGQSGGEVDAGEIMLH
FT                   LSLALKATALGILVAIPSMIFYNALGRKVEVNRLKWKVLNSQQHKKEEQDKE"
FT   gene            443902..444348
FT                   /locus_tag="D11S_0488"
FT   CDS_pept        443902..444348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0488"
FT                   /product="biopolymer transporter ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81898"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005550148.1"
FT                   /protein_id="ACX81898.1"
FT                   /translation="MKKFDEINIIPFIDIMLVLLAIVLITASFISQGKIQVNVPKASSS
FT                   VAFKSNELAKLLTVTAKGELYFNDKPTNLESLESEIAGWDKKQKVTLKIDSEASFQDFV
FT                   SVTDLLAKNEIKDVAIVATKDNGADKPKPAYEQSTKPAEQPVSN"
FT   gene            444358..445062
FT                   /locus_tag="D11S_0489"
FT   CDS_pept        444358..445062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0489"
FT                   /product="energy transducer TonB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81899"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561306.1"
FT                   /protein_id="ACX81899.1"
FT                   /translation="MQTAKRSLLSLLLSLLIHAVIVYLLFWSHVKKSDFSANSVVGELS
FT                   TSISMEMLMAQVEAEPPPVEEKAPEPEKQETVDDPTVKPEPPKVEKPKEKPKQKPRTDV
FT                   PVGDKTVDSNASVNSKATSTGPVTTNNPNLAGSGASSDERNAYLSAIRREIEKHKRYPT
FT                   RAKMMRKQGIVTVSFSIGADGSISGASIVKSSGAEDLDNAALSAVNSARSIGPRPAGIS
FT                   SSISVPISFKIN"
FT   gene            447956..450376
FT                   /locus_tag="D11S_0493"
FT   CDS_pept        447956..450376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0493"
FT                   /product="dimethyl sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81903"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545056.1"
FT                   /protein_id="ACX81903.1"
FT                   /translation="MNNFNQLSRRDFIKSSLAGAAIIAADIVLPFNVMATNTLKKEQES
FT                   VEKVVWSACTVNCGSRCPLRMHVKDNRITYVETDNTGTETYNVDHQVRACLRGRSMRRR
FT                   VYNPDRLKYPMKRVGKRGEGKFKRISWDEALTEIADALKRNIAKYGNESIYLNYGTGTL
FT                   GGTMTKSWPPASTMVARFMNCIGGYLNHYGDYSTAQIAVGLDYTYGGGWALGNGMADIE
FT                   NTKLIVLFGNNPAETRMSGGGLTYCIEQAKQRSNAKMILIDPRYTDTGVGREDEWIPIR
FT                   PGTDAALVSALAYVMITEDLVDQPFLDKYCVGYDEKTLPEGAPQNGHYKAYILGQGDDG
FT                   IAKTPEWASKITGIPVDRIIKLAREIGSTKPAFISQGWGPQRRSNGELISRAIAMLPIL
FT                   TGNVGIHGGNTGARESAYSIPFVRMPTLKNPVKASIPMFMWTDAIIRGPEMTALTDGIR
FT                   GVDKLSAPIKVIWNYSSNCLINQHAQINRTHDILQDDSQCEMVITIDNHMTSTAKYSDI
FT                   LLPDCTTSEQMDFALDAFVSNMAYVIFADQVVKPSFECRTIYDMLSDLADKMGVKDKFT
FT                   EGRTQEEWLRYIYAQSREKLPELPTFEEFRQQGIFKKVDPNGFKVAYKDFRDDPEAHPL
FT                   KTPSGKIEIYSSRLAEIAKTWKLAEDEVIHPLPVHAQSFEHYGDPLMEKYPLQLSGFHY
FT                   KARTHSTYGNVDVLKAANPQEVWMNPIDAQPRGIQNGDLIRIFNDRGEVRINVKVTPRI
FT                   IPGVVALSEGAWYAPDKDRIDHSGCINVLTTQRPSPLAKGNPQHSNLVQVERL"
FT   gene            450387..451010
FT                   /locus_tag="D11S_0494"
FT   CDS_pept        450387..451010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0494"
FT                   /product="dimethyl sulfoxide reductase"
FT                   /note="oxidoreductase, Fe-S subunit; terminal electron
FT                   transfer protein for the reduction of DMSO"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81904"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545058.1"
FT                   /protein_id="ACX81904.1"
FT                   /translation="MEQYGFYFDSDRCTGCKTCELACKDYKDLGTEVNFRRIYEYTGGN
FT                   WSQQPDGCWLQNVFAYYMSISCNHCADPACTKVCPTGAMQKNADGFVIVNEEICIGCRY
FT                   CHMACPYDAPQFDAEKGHMTKCDGCYSRIKAGQKPICVDACPLRALDFAPIKELRARYG
FT                   EQVSIAPLPPAEVTHPNLVVKPNKNARLRLSGDTNGFLGNPGEV"
FT   gene            451012..451851
FT                   /locus_tag="D11S_0495"
FT   CDS_pept        451012..451851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0495"
FT                   /product="dimethyl sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81905"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589356.1"
FT                   /protein_id="ACX81905.1"
FT                   /translation="MNIVIHELPLVVFTVLAQSAVGSWLVFSFVLCTNLNAQSRRYVHK
FT                   VMFVILALLGIGFTASVLHLGTPIRAFNSLNRVGESMMSNEIASGALFFAMAGMYWLLA
FT                   IMRKMPLALDKLWLVISSLIGLVFMVIMDQVYHIPSVPTWNTPMTSCLFFGTVALGGIA
FT                   LSSALIMANPQRTYQLSALPWLFALAVLFAAIVAVYQGFSLPQIHSAIQNAAALVPDYA
FT                   AFSALRFCCLALAALFIFRSKNIGVLALAAILTLFAEMLGRNLFYAAHMTLGMAVGG"
FT   gene            451899..452513
FT                   /locus_tag="D11S_0496"
FT   CDS_pept        451899..452513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81906"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576841.1"
FT                   /protein_id="ACX81906.1"
FT                   /translation="MDNGLMQWISTTGRLLGAAFYYAPDDARVASVLCFFERENWQQEW
FT                   APFVDEKTLEKTTALFAEGLQQPLAEQYQALFIGPNALPAPPWGSVYLDPESVIFGSSL
FT                   LELRAFLQRHQIAFQSHQNEPEDHLGLMLMLAAYLAENQPHLMREFLNRHFLTWAPHCL
FT                   QLLAALEDFLFYRGLALLTLATLKQWQQALNLEVPTVRFYR"
FT   gene            452527..452688
FT                   /locus_tag="D11S_0497"
FT   CDS_pept        452527..452688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0497"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81907"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545066.1"
FT                   /protein_id="ACX81907.1"
FT                   /translation="MPKKETYYQAYLSHNAISRRGLFRGIFGAVEHPPVENQRAANHPP
FT                   FAAREDLF"
FT   gene            452880..453785
FT                   /locus_tag="D11S_0498"
FT   CDS_pept        452880..453785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0498"
FT                   /product="glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81908"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545068.1"
FT                   /protein_id="ACX81908.1"
FT                   /translation="MTTFNVKTFQGMILALQEYWANQGCTVVQPFDMEVGAGTSHPMTA
FT                   LRALGPEPMAFAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLDSLKM
FT                   LGFDPTQNDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADTDFLFYC
FT                   FDQYEKEAQSLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALTK
FT                   GVAEAYYASREALGFPGCKK"
FT   gene            453835..454095
FT                   /locus_tag="D11S_0499"
FT   CDS_pept        453835..454095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81909"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167580.1"
FT                   /protein_id="ACX81909.1"
FT                   /translation="MKPILYYAEKCPDTAPFVAELKRLSVEYDEVEVMSSIPNLKQWLR
FT                   LRDNNAAFDTVKAKGNAGFPALLLEDGRVILTESELREIFA"
FT   gene            454262..454438
FT                   /locus_tag="D11S_0500"
FT   CDS_pept        454262..454438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0500"
FT                   /product="DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81910"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545073.1"
FT                   /protein_id="ACX81910.1"
FT                   /translation="MKPSQKLRLNREKVKALSVRFHFSNSRVFGSVLTQQDTEQSDLDL
FT                   LVEPSVKTTLFDY"
FT   gene            454643..455347
FT                   /locus_tag="D11S_0501"
FT   CDS_pept        454643..455347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81911"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545076.1"
FT                   /protein_id="ACX81911.1"
FT                   /translation="MQNDDLDENNTDKLISLTNSILGEFPGGSIVSGIINKLVSNQRQD
FT                   RITKYIRELEKRISNLECLIGSEAEKLSKYIALFEDGLFYAFRAASEKRLEHIASIVAN
FT                   GLNKEQVQISQSIHLLNLLSDLNDEEIIWLRFYLHPTLGGDEEFRDKHKSTLTLARNYI
FT                   GASEEEANKSAIQESYKEHLERLGLIKTKFNIDRNTNMPIYDKSSGKPKGSRYITHLGK
FT                   MLLKEIGFSEVP"
FT   gene            455429..457510
FT                   /locus_tag="D11S_0502"
FT   CDS_pept        455429..457510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0502"
FT                   /product="glycine-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81912"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568626.1"
FT                   /protein_id="ACX81912.1"
FT                   /translation="MTTQNFLVEIGTEELPPKALKTLATAFADNVQAELNQAGLAFDKI
FT                   EWFAAPRRLAVKVLALATQQPGKEIEKRGPAVSAAFDAEGNPTKAAEGWARGCGITVDQ
FT                   AERLATDKGEWLVHRAKIEGQPTKNLLADIVANALAKLPIPKPMRWADKTVQFIRPVHT
FT                   VTMLLGDELIEGEILGVASGRTIRGHRFLGEREFEIQHADQYPQLLREKGSVVADFNER
FT                   KAEILAKSQAKATALGGVADIEESLLEEVTSLVEYPNVLAAKFEERFLAVPAEALVYTM
FT                   KGDQKYFPLYKKTEGDKDGKLLPHFIFVSNINPDDPSAIIEGNEKVVRPRLTDAEFFFK
FT                   TDLKQKLVDRLPRLETVLFQQQLGTLRDKTDRIEQLAGAIAKQIGADEAKAKRAGLLSK
FT                   CDLMTNMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVASAVA
FT                   LADKFDTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVQKSAALFG
FT                   DKLTNKNVVADVVDFMLGRFRAWYQDEGIAVDVIQAVLARRPTRPADFDARVRAVSHFR
FT                   TLDSAEALAAANKRVANILAKADVAIGEINLIACVESAEKNLAEAVLVLQTEVQPLIAK
FT                   GEYTAVLDKLANLRTPVDNFFDNVMVNAEDPTLRQNRLAILNTLQGLFLQVADISLLQ"
FT   gene            complement(457722..458744)
FT                   /locus_tag="D11S_0503"
FT   CDS_pept        complement(457722..458744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0503"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="catalyzes the formation of porphobilinogen from
FT                   5-aminolevulinate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81913"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704658.1"
FT                   /protein_id="ACX81913.1"
FT                   /translation="MTQQIFTGFPTRRLRRMRKQDFSRRLMAEHKLTVDDLIYPVFIIE
FT                   GENHREAVPSMPNVERLTLDQLLIEAGLLVKYGVPVIALFPVVEQTKKSLMAEEAYNPN
FT                   GLVQRAVRALKAAYPELGVLTDVALDPYTVHGQDGIIDEDSYVLNDITTEVLIKQALSH
FT                   AEAGADVVAPSDMMDGRIGRIRHALEENGFINTLIMAYSAKYASNYYGPFRDAVGSSGN
FT                   LKGGDKKTYQLDPANSDEGLQEVALDLEEGADMVMVKPGMPYLDLVYRVKQQFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLKEKECIMESLLCFKRAGADGILTYFAKQVAEWLYLEGKNK
FT                   "
FT   gene            complement(458763..459527)
FT                   /locus_tag="D11S_0504"
FT   CDS_pept        complement(458763..459527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0504"
FT                   /product="twin-arginine protein translocation system
FT                   subunit TatC"
FT                   /note="with TatABE forms the twin-arginine translocation
FT                   complex which is involved in the transport of proteins
FT                   across the cytoplasmic membrane"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81914"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545082.1"
FT                   /protein_id="ACX81914.1"
FT                   /translation="MTSVDDTQPLITHLVELRTRLLRSIIFVAVVFVALVYFSNEIYNF
FT                   VAAPLTANLPNGSSMIATNIATPFFTPIKLTGVVAVFISVPYLLYQIWAFVAPALYQHE
FT                   KRLIYPLLFSSTVLFYLGVAFAYYVVFPLVFSFLTKTAPEGVAIATDISSYLDFVLTLF
FT                   LAFGVCFEVPVAIILLCWTGVTTPEDLRSKRPYIIVAAFFIGMLLTPPDVFSQTLLAAP
FT                   MCLLFEVGVLCARFYRPREDDETQNESDSAKQ"
FT   gene            complement(459565..460227)
FT                   /locus_tag="D11S_0505"
FT   CDS_pept        complement(459565..460227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0505"
FT                   /product="preprotein translocase subunit TatB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81915"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590620.1"
FT                   /protein_id="ACX81915.1"
FT                   /translation="MFDIGFSEIVLVCIVGLVVLGPQRLPVAIRTVMSWVRTIRGLAAN
FT                   VQNELKQELKLQELQESIKKAESLNLKALSPELGNTVEELKASADKLRAELEQKDNDTN
FT                   TTFQDQVVQLKQAQATKSAVENGGENDNLHPGTDQYNPMANYDILDVEDYAEPQTEALA
FT                   ATKTTEKTTALSPAELAEQEEIELDEKLAHYINQYDPDNPLPANTASAHLAKVSEKS"
FT   gene            complement(460231..460455)
FT                   /locus_tag="D11S_0506"
FT   CDS_pept        complement(460231..460455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0506"
FT                   /product="preprotein translocase subunit TatA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81916"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545087.1"
FT                   /protein_id="ACX81916.1"
FT                   /translation="MGGISIWQLAILVLIIVLLFGTKKLRTLGTDLGESVKGFKKAMNE
FT                   ENKPEDATFSKVEQNAQPEQEKNKEKEQA"
FT   gene            complement(460858..461730)
FT                   /gene="hslO"
FT                   /locus_tag="D11S_0507"
FT   CDS_pept        complement(460858..461730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="D11S_0507"
FT                   /product="Hsp33-like chaperonin"
FT                   /note="becomes active under oxidative stress; four
FT                   conserved cysteines bind a zinc atom when they are in the
FT                   reduced state and the enzyme is inactive; oxidative stress
FT                   results in oxidized cysteines, release of zinc, and binding
FT                   of Hsp33 to aggregation-prone proteins; forms dimers and
FT                   higher order oligomers"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81917"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564566.1"
FT                   /protein_id="ACX81917.1"
FT                   /translation="MTNYTQGNDQLYRYLFKDRAVRGEWVRLNQTFNDTLNTHHYPQAV
FT                   RNLLGEMMVATALLTAILKFNGDITVQIQGDGPLKLALVNGNNQQQIRALARLQGDIDN
FT                   SMSLHQMIGKGVLVITIARKEGERYQGIVPLDKPTISECLEDYFMRSEQLQTQLIIRTG
FT                   EYDGRPVSAGVLLQIVPDGSGSPEDFEHLATLTATIKEEEIFGLTAEELLYRLYHEESV
FT                   ELFPPQAVSFHCGCSQERSGAALLLISEGEIEQILAEHQGTIDMQCECCGTHYLFNKEA
FT                   IEKLKQSAS"
FT   gene            complement(461798..462214)
FT                   /locus_tag="D11S_0508"
FT   CDS_pept        complement(461798..462214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0508"
FT                   /product="ribosome-associated heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81918"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555311.1"
FT                   /protein_id="ACX81918.1"
FT                   /translation="MAKHQQTTDEKDAVRLDKWLWAARFYKTRTLAKEMIDGGKVHYNG
FT                   QRSKPNKIVEVGATLKLRQGSEEREITVLALSTQRRGAAEAQLLYRETEQSVANREKLA
FT                   MARKMNALSMPHPDRRPDKKERRDLLKFKHRNQE"
FT   gene            complement(462227..462886)
FT                   /locus_tag="D11S_0509"
FT   CDS_pept        complement(462227..462886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0509"
FT                   /product="HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81919"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545094.1"
FT                   /protein_id="ACX81919.1"
FT                   /translation="MNKQKFNWQAIETVILDLDGTLIDLYFDHRFWKNIVPQAYADKFK
FT                   VSVEQSRELIHRRYQQLKFSMQWYCIDFWAENLDLPLRELLQQQRDYIKVRSDVYPFLQ
FT                   AAHERRKKLILLTDSHPFSLQEKLKHCDLAPHFDLLLSSHQFNAPKVEQSLWHRLQQFT
FT                   PFDPGRTLFIDDTEPVLDSAKQFGIAYTIGVENPDSTLADKSFARHFSIKNYRTLL"
FT   gene            462967..463515
FT                   /locus_tag="D11S_0510"
FT   CDS_pept        462967..463515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0510"
FT                   /product="ADP-ribose diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81920"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541212.1"
FT                   /protein_id="ACX81920.2"
FT                   /translation="MTTLQKPQILNIKTVAKSTIFEIQSVDLKFANGEHRTYERFRPGK
FT                   YAAVMVVAIDGEDLLLVREYAVGTERYELGFVKGRMDAGETPEQSANRELQEEIGLAAK
FT                   SWVHLRTINMSVGFMNNPMRILLAQDFYPSKLEGDEPEPLEMVRIPLAKIDDLLADPEF
FT                   NEAKNLTALYLVRDYLQRK"
FT   gene            complement(463520..464401)
FT                   /locus_tag="D11S_0511"
FT   CDS_pept        complement(463520..464401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0511"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81921"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541214.1"
FT                   /protein_id="ACX81921.1"
FT                   /translation="MDYLDQLIRLSGIEGEINILCRFRGDWLIHHKQEPNLIGKFHIVS
FT                   RGECQIRLKNQTCHLKPGDVIFLPYGEEHSLYHGAGTESPITETTQGAFTLHRNSTSES
FT                   DDFEMFCGYFRYLNLAQNLLFNLPHWYLSSNNIAIMALLELLRKETEENLGSKVVVNAL
FT                   CNILFTYLIRDYLQHHQVNQGILGALQDKRLKNAVNAMVETPKKSWSMEALAESCAMSR
FT                   ANFIRAFKQKIGIPPGKFLTIIRMNIAGVLLKNTQKPISVIASEVGYQSDTHFTKVFKS
FT                   YYGISPGKYRAM"
FT   gene            complement(464472..465098)
FT                   /locus_tag="D11S_0512"
FT   CDS_pept        complement(464472..465098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0512"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81922"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167575.1"
FT                   /protein_id="ACX81922.1"
FT                   /translation="MNAFIELLAKIVAPMQRQFINFVRIAICIVMVWIGGLKVCQYEAD
FT                   GIAHFVSNSPFLSFLYKNGSNLVQNDKGELVKEYTLYKNPEGKMVVKNIEWHKANGTYT
FT                   ASYIIGAMIVTIGLLTLAGIRSPTLGLFGGLLTFGMSIVTLSFLIFTPETWVPNLGGDL
FT                   PTPNYGFPYLSAAGRLVIKDIIMMAGGLVAAAECANRWLKAKQSV"
FT   gene            465506..467473
FT                   /locus_tag="D11S_0513"
FT   CDS_pept        465506..467473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0513"
FT                   /product="oligopeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81923"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P44016.2"
FT                   /protein_id="ACX81923.2"
FT                   /translation="MLLGALITVLFTASNVYLGLKVGVTFASSIPAAVISMAVLKFYKD
FT                   SSILENNMVQTQASSAGTLSSVIFVLPGLLMMGYWQDFPFWQTMLICAAGGTLGVLFTI
FT                   PLRRAMVVNSDLPYPEGVAAAEILKAGNHTDGDSGVKDIFYGGVLASIVAFLTNGLRVM
FT                   ADSASGWFTGFGGKAVFQVPMGFSLALLGAGYLIGIVGGIAILLGTLFAWGFAVPFFTM
FT                   SGDMPADATIAGYAMDAWKTKVRFIGVGTIGIAAIWTLLILLKPMVQGMAHSFRMLKGH
FT                   QAEYEHRIDIDLSPKTMIYILIATVILIVISLHHFIAAAPISPELTLLLVVVCTFLAVF
FT                   IGFFIAAASGYMAGLVGASSSPISGIGIISVIAISLVLVSIGNASGLFETTDGQKFLTA
FT                   LTLFTASIVLTTATISNDNLQDLKTGLLVEATPWRQQVALIIGCFVGALVIAPVLEILY
FT                   HAYGFTGALPRPDMDPSQALSAPQATLMTTISQGIFSNKLEWTYILTGVGLGAVLIIID
FT                   SFLKKVSNKTFALPVLAVGIGIYLPPSINMPVVCGAVLAWLINRHINRYAARTGDKEPG
FT                   KRAERFGTLFSAGLIVGESLMGVVLAFIIAASVTSGGSEAPLALNLENWDTIAEVLGLI
FT                   VFVLGIVIFTSRVLRAKKSA"
FT   gene            467535..467963
FT                   /locus_tag="D11S_0514"
FT   CDS_pept        467535..467963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81924"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545105.1"
FT                   /protein_id="ACX81924.1"
FT                   /translation="MSPNYPYIKTLVIFPLLAQLIGTIISICVDDNTDSLLGTADVILF
FT                   SLLSTFIVATVPAFLIALWTKIYRYTRYNMMAIVLISLIIAFCYGNVASFIYMTFSQPN
FT                   MTFGIWLRSGGIDMAFLLSFGMALYSVLVLPLLLPQTR"
FT   gene            468001..468810
FT                   /locus_tag="D11S_0515"
FT   CDS_pept        468001..468810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0515"
FT                   /product="3'-5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81925"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P70714.1"
FT                   /protein_id="ACX81925.1"
FT                   /translation="MPILTTHLLQDVIEIAQQAGEHLRCFYQRSVTVRMKEDNTPVTEA
FT                   DLFVSQFLTEKLTALTPQIPILSEENCHIPLTERQTWRSYWLIDPLDGTQQFINRTGQF
FT                   SVLVSLVKDHQPVLGVIHAPMLGSTYYAMQGFGAYKHHDGQHLKLAFHDIQADNALRIA
FT                   VGSAAAAEKVRSILNKNLAYEFHICGSSGLKSTLVADGVCDCYIRLGCTGEWDTAASEI
FT                   LLAEMGGIIFDLNYQPLTYNKRESFVNPNFVMGITQDFPWDKIFHSN"
FT   gene            468908..470392
FT                   /locus_tag="D11S_0516"
FT   CDS_pept        468908..470392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0516"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81926"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564557.1"
FT                   /protein_id="ACX81926.2"
FT                   /translation="MKAENCCIVIFGASGDLTYRKLIPALYNLYKIDRLGEDFSVLGVA
FT                   RTELNDKSFREKMRQTLIKNEGAKGECLEQFCSHLYYQAVNTADKADYAKLVPRLDELH
FT                   DTYRTEGNTLYYLSTPPSLYGVIPECLGEHGLNKEDRGWKRLIVEKPFGYDRETAEALD
FT                   IQIHRFFEEHQIYRIDHYLGKETVQNLLVLRFSNGWFEPLWNRNFIDYIEITGAESIGV
FT                   EERGGYYDGSGAMRDMFQNHLLQVLAMVAMEPPAIINANSMRDEVAKVLHCLRPLTQED
FT                   VEHNLVLGQYVAGEVDGEWVKGYLEEKGVPPYSTTETYMALRCEIENWRWAGVPFYVRT
FT                   GKRLPARVTEIVIHFKTTPHPVFSQNAPENKLIIRIQPDEGISMRFGLKKPGAGFEAKE
FT                   VSMDFRYADLAGATVMTAYERLLLDAMKGDATLFARTDAVHAAWKFVQPILNYKAQGGR
FT                   LYDYEAGTWGPTAADKLIAKSGRVWRRPSGLMKKKV"
FT   gene            470645..471343
FT                   /locus_tag="D11S_0517"
FT   CDS_pept        470645..471343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0517"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81927"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P70715.2"
FT                   /protein_id="ACX81927.1"
FT                   /translation="MNYITFPTAQHAVEKIAQEFVIYSQLNHPAHISLSGGSTPKLLFK
FT                   TLAQSPYAEQINWRNLHFWWGDDRMVSPSDPESNYGEVQKLLFDHIQIPAENIHRIRGE
FT                   NEPHFELKRFQAELSAVISDGVFDWIILGMGADGHTSSLFPHQTNFDDENLAVIAKHPE
FT                   SGQIRISKTAKLIEQAKRITYLVTGEGKAEILKEIQSTPAENLPYPAAKIHAKNGVTEW
FT                   YLDKDAAKLL"
FT   gene            471670..472098
FT                   /locus_tag="D11S_0519"
FT   CDS_pept        471670..472098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81929"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167574.1"
FT                   /protein_id="ACX81929.1"
FT                   /translation="MKHNLFILYGAANTGKTTTFNELLKNACDQFLDKLVYFERSENCA
FT                   DFLAVFQNKNVKVDLYSSGNNECVSHNLYALHHQNCNFIFGTSRTRGGSCQAVNNYADL
FT                   FYSGDDSIKWHEKESATDRDNNKMAKELFSTLKKLLIK"
FT   gene            472213..472905
FT                   /locus_tag="D11S_0520"
FT   CDS_pept        472213..472905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0520"
FT                   /product="racemase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81930"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167573.1"
FT                   /protein_id="ACX81930.1"
FT                   /translation="MKTLGILGGMSPESTVSYYLIINRAVNQALGGNASAPLLMSSVNF
FT                   EEIVQCQKSGNWAKAGEILAEQARLLESIGAEGILIGANTMHKVADAVQNVISVPLLHI
FT                   LDVVADSIKVQGLCKVALLGTHYVMADNFYVDGLRERGVEPIVPNDKDKLEIHRIIFEE
FT                   LCTGKIKPESKAFYLKKIEKLTALGAEGVILGCTEIGLLINQIDSDLPFFDTALLHSQM
FT                   AIDFILEK"
FT   gene            472918..473172
FT                   /locus_tag="D11S_0521"
FT   CDS_pept        472918..473172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81931"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555288.1"
FT                   /protein_id="ACX81931.1"
FT                   /translation="MKPILYFALWCPDTESFVAELQRLNIAYEAKDIAGDRLNFKAFLK
FT                   LRDTHSAFDDAKANGYIGIPALVLENGEVILDKEALKNV"
FT   gene            473252..473710
FT                   /locus_tag="D11S_0522"
FT   CDS_pept        473252..473710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0522"
FT                   /product="virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81932"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541228.1"
FT                   /protein_id="ACX81932.1"
FT                   /translation="MDRTLIVFDMDTHCLEENYHNPSWRNAYADIQRILKKHGFTNIQG
FT                   TVYLSDIGIKQAHGTLALQEVAARFEWFYHCASNIQFYELKDDFNAQFIVEGVQRAREA
FT                   FNRSLNSLRQELLQAGLSADKVEEIVRKRQFSLQQIPEKELLQNNQEN"
FT   gene            474266..475720
FT                   /locus_tag="D11S_0524"
FT   CDS_pept        474266..475720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0524"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="catalyzes the formation of D-ribulose 5-phosphate
FT                   from 6-phospho-D-gluconate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81934"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585799.1"
FT                   /protein_id="ACX81934.1"
FT                   /translation="MSVKGDIGVIGLAVMGQNLILNMNDHGFKVVAYNRTTSKVDEFLE
FT                   GAAKGTNIIGAYSLEDLANKLEKPRKVMLMVRAGEVVDHFIDALLPHLEAGDIIIDGGN
FT                   SNYPDTNRRVAALREKGIRFIGTGVSGGEEGARHGPSIMPGGNEEAWQFVKPVLQAISA
FT                   KTEQGEPCCDWVGKDGAGHFVKMVHNGIEYGDMQLICEAYQFLKEGVGLSDDELQATFN
FT                   EWRNTELDSYLIDITADILGYKDADGSRLVDKVLDTAGQKGTGKWTGINALDFGIPLTL
FT                   ITESVFARCVSAFKDQRVAASKLFHKTIGKVEGDKKVWIEAVRKALLASKIISYAQGFM
FT                   LIREASEHFNWNINYGNTALLWREGCIIRSRFLGNIRDAYEANPDLIFLGSDSYFKGIL
FT                   ENAMSDWRKVVAKSIEVGIPMPCMASAITFLDGYTSARLPANLLQAQRDYFGAHTYERT
FT                   DKPRGEFFHTNWTGRGGNTASTTYDV"
FT   gene            complement(476131..477375)
FT                   /locus_tag="D11S_0525"
FT   CDS_pept        complement(476131..477375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0525"
FT                   /product="3-oxoacyl-ACP synthase"
FT                   /EC_number="2.3.1.41"
FT                   /note="FabB; beta-ketoacyl-ACP synthase I, KASI; catalyzes
FT                   a condensation reaction in fatty acid biosynthesis:
FT                   addition of an acyl acceptor of two carbons from
FT                   malonyl-ACP; required for the elongation of short-chain
FT                   unsaturated acyl-ACP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81935"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167571.1"
FT                   /protein_id="ACX81935.1"
FT                   /translation="MKRVVITGIGAVTAFGKTWQEIKTAFQRKQNAVQAKADWAERYPE
FT                   LEARLGAEIHGYQPPSHWNRKQLRSLGRVSQFAVEAAERALANADLLDENGDILAYLKD
FT                   GRMGVACGSSTGSTNDIKDAAELLMTGKSDGFNANTYVRMMPHTTTANIGIFFGLTGRI
FT                   IPTSSACSSGSQGIGYAYESIKYGLIPMMLAGGAEEFCPSEVYVFDSLYAASRNVNNPS
FT                   KTPRPYDNDRDGLVIGEGAGIFVLEELEHALARGANIIAEVVGYGANSDGAHVTRPQKD
FT                   TMQRCMELALKDAHLSAQKIGYVNGHGTATEQGDIAETLATEAVFGKVPLSSQKSYLGH
FT                   TLGACGALESWFSIEMMRDGWFAPTINLDNIDERCGKLDYIQGDGRHIETDYVMNNNFA
FT                   FGGVNTSLIFKRWQA"
FT   gene            complement(477395..478123)
FT                   /gene="fabG"
FT                   /locus_tag="D11S_0526"
FT   CDS_pept        complement(477395..478123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="D11S_0526"
FT                   /product="3-ketoacyl-ACP reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Catalyzes the first of the two reduction steps in
FT                   the elongation cycle of fatty acid synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81936"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576792.1"
FT                   /protein_id="ACX81936.1"
FT                   /translation="MSETILITGSSRGIGKAIALRLAQAGFDIVVHCRSRIEEAEAVAQ
FT                   AVRELGQNARVLQFDVSCRSEAADKLTADVEAHGAYYGVVLNAGLTRDNAFPALTDEDW
FT                   DRVLRTNLDGFYNVLHPIMMPMIRRRKAGRIVCITSVSGLIGNRGQVNYSASKAGIIGA
FT                   AKALAVELAKRKITVNCVAPGLIDTDILDENVPIDEILKMIPAGRMGDPEEVAHAVNFL
FT                   MGEKAAYVTRQVIAVNGGLC"
FT   gene            complement(478173..478616)
FT                   /locus_tag="D11S_0527"
FT   CDS_pept        complement(478173..478616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0527"
FT                   /product="dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81937"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557532.1"
FT                   /protein_id="ACX81937.1"
FT                   /translation="MLDLTCPITDIAPLVPHSGKMILLDRVTDFGDDFLIAEAEVRPDN
FT                   LLVKDNKLPGFLGAEIMAQGVAAWAGCKCVRAGKPITLGYWIGSRKLCIHQPDIAIGSK
FT                   LRIQIKLSIEDATGFGVFDCQLIDSANQRVIVEGALNVFRPQV"
FT   gene            complement(478609..479832)
FT                   /locus_tag="D11S_0528"
FT   CDS_pept        complement(478609..479832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0528"
FT                   /product="3-oxoacyl-ACP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81938"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545128.1"
FT                   /protein_id="ACX81938.1"
FT                   /translation="MTVLYLSKPAILSSLGDGIETHIARLLAAEDSPLAFSDSAFKLYH
FT                   TEGKARVFGEVNVPLRPFAESLPAIHQSRNNQLLWHCLAQIEPQIEQAIARFGRQRIAV
FT                   IIGTSTTGVDENVPVFKYAVSHNDWSGAEFKQQQQYFSAPSDFVAYQYGLQGLSYGIST
FT                   ACTSGAKALISAARLLNAGLCDAVICGGVDELSPLTISGFGSLSVLSDKRSNPLSVNRD
FT                   GINLGEGAAVFVMSQEKLDDTAIQLLGYGASSDAYHMSSPHPEGEGAISAFRAALASSE
FT                   LSADAIGWINLHGTGTVHNDQMESLAVHRVFGDDTPCTTTKPYTGHTLGAAGAVEAAIL
FT                   WGIIDRKLNPQGKLPAQLWDKQADPALPKIAITDEHSHWRSEPRIGASSSFAFGGNNTV
FT                   LILGERDA"
FT   gene            complement(479841..480320)
FT                   /locus_tag="D11S_0529"
FT   CDS_pept        complement(479841..480320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81939"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005593752.1"
FT                   /protein_id="ACX81939.2"
FT                   /translation="MKYFALLFCFWLTACSSLPQVERLPPQQQAVRVFKVEQLNAQHQL
FT                   QQASLLTLQTEPQQWRWVQTDPLGAPLARVILTPQGWQNDGFIMPNQQARRLFSALATA
FT                   LNPQHPLFTFSRIEPVAQGNYYFIQHNKVWRIALRPPQIEIHLADDSRWRIEELN"
FT   gene            complement(480450..482723)
FT                   /locus_tag="D11S_0530"
FT   CDS_pept        complement(480450..482723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0530"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81940"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702407.1"
FT                   /protein_id="ACX81940.1"
FT                   /translation="MKKSTALSVLYALFLTATLLLFGYAVKKGAWLETDLRALLPQEQG
FT                   WTTVQVRADEQQEARLNQQLISLIGHSSPQKAFQLAEQVAQQWQKSGLFARMDAKTQPD
FT                   LEALRAEIARLRLATLPPSVRHQLLHTPQDYFQHYAEQIMNPFAQTNLLPLDQDWLGFG
FT                   RFVLPQAQLQGQIQWYAENGMLYVTDKDKTWALLRGVLQQGDLMDPSLNLTALLTQNRQ
FT                   AVEAAQGDMLATGAALFAIDAKVKAERESTLMSALGVSLTLLLLLLVFRTARVLWLFLP
FT                   ILTGMLCGVTATIFVFGHIHILTIVIGTSLIGVLIDFPLHWLASSLFHQPWHAAQAMQK
FT                   LRFTFLISLLVTLLGYGLLGFTALPVLKQTALFSAIALISAMFATLLFLPALFRRYQNK
FT                   PRTPNPKVRWILDAFFTRRMGVVSILLGGIFIVGGLYRSEWRDDIRQWVSMPQVMLDEA
FT                   KQIADLTGVDLGNRYFLVLADNDDALLEKERALTTKLDEQHIPYRALSQWMMSEAQQRQ
FT                   FIVELQAKLKPQDYAVLDEIGVPSERLQQALRELNTQPPLSLQQALQSTVGQAWLPLYL
FT                   GKLAENQVAGIVQVSGHSAVSLAHLANQQDIFWQDKRAHLNQAFQQTRDQAAWLKMLSF
FT                   VFAGVLLWRLFGVKRTFTMLLPPLCAIVITVAIFGWVCLPISLFTMFGLLLVSAIGIDY
FT                   TAYMQTANEPLYGKYIAVLLAAMTTLISFVLLGLSSTPAVASFGLSVSLGVLLSVILTF
FT                   KLLR"
FT   gene            complement(482730..483314)
FT                   /locus_tag="D11S_0531"
FT   CDS_pept        complement(482730..483314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0531"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81941"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545134.1"
FT                   /protein_id="ACX81941.1"
FT                   /translation="MKKFFVLCCLLFSPLTFAFSEAELITLLQTPQNVQGNFTQQRFLK
FT                   SLAKPITTQGKFTLLAKKGLLWQMEKPFTNQLRVKTDGIMQWDGKQWVANGNMGQAQQI
FT                   SLFLGLLSGDISGLKAQFEVALSGEAKNWQLTLTPSSLLMKQIFTDIQIQGDEVVKAIV
FT                   LNEKQGDKTHIQFDHIQQNQPLAAFAQSALE"
FT   gene            complement(483311..483757)
FT                   /locus_tag="D11S_0532"
FT   CDS_pept        complement(483311..483757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0532"
FT                   /product="thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81942"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575742.1"
FT                   /protein_id="ACX81942.1"
FT                   /translation="MKKHIYCHHASEYEIQFFDVDSMNIMWHGHYVKYLEMARCAFLEE
FT                   IHCTYDVMKEKGYGWPVVKLNLKYVQPTLFRQKIRVELVLVEYESCIRIDYVIRDAATN
FT                   QKLTSGSTTQVAVEIKSGEMQLQTPPCWRSAVENHRTFQAENAS"
FT   gene            complement(483754..484680)
FT                   /locus_tag="D11S_0533"
FT   CDS_pept        complement(483754..484680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0533"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81943"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702408.1"
FT                   /protein_id="ACX81943.1"
FT                   /translation="MTSQHWAQQHERGSKFFLNLTRLIVQYCPLWVIRIVTFVVVSYFF
FT                   LTSTKARRHIRRYHQRLQRTFPHLTLPRYALFRHFLAFGEAIADRFAVWQKKIRYPDLI
FT                   LDDSDNVYRDIRSEGRGQILICSHFANIEICRALVDSGHHGNFRLNILVHNRHAQAFNE
FT                   TLEKAGATSLPLIQVEELDAQKMLELNERIERGEWIAIAADRIPVRGNKTEQVDFLGSP
FT                   ATFPQGPWLLASLLKTPINTVFCVKKRSEYYLKLRHFSPPIEGRGKQRNESIKRAMQQY
FT                   ADILAKECEENPLYWFNFYDFWDDYSK"
FT   gene            complement(484677..485399)
FT                   /locus_tag="D11S_0534"
FT   CDS_pept        complement(484677..485399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0534"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81944"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544269.1"
FT                   /protein_id="ACX81944.1"
FT                   /translation="MQKVIVIIPHYNHSATVGEVVRQLHALDLPVLIVDDGSAENHLRV
FT                   LRTLQQQPEVFVHYCPTNGGKGAAMKTGFRLAADMGFSHAVQVDADGQHHLPDVLKMIA
FT                   EMQKNPTALICGRPLYSDDAPKARLYGRKITDFWNAIHTLSLDIKDGMCGFRLYPLASI
FT                   LSLMQQESLGNRMDFDIDILVKAHWHQIPLVWVDTPVRYEPGGISHFRGFADNCEISKL
FT                   HTRLFFGMLWRICTGRKV"
FT   gene            complement(485399..486760)
FT                   /locus_tag="D11S_0535"
FT   CDS_pept        complement(485399..486760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0535"
FT                   /product="AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81945"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167569.1"
FT                   /protein_id="ACX81945.1"
FT                   /translation="MINNLHFFNIPDLWHDQGDETALIARNPDWQWVDFRTRARQIAEQ
FT                   LTQDNVKSVAFWFDDAALFACAMLACFHAGVRILLPPNLLAENQQWSKENADFLLDDAL
FT                   FAEYGITQHASQKHPAKRPHFTSHQQTEIWLKTSGSSGQPKILVKTAAQMWLESEAIRQ
FT                   SLPFSADNDIHLVSSVSAQHHYGLSYRIILPLTMGWSIARKQLPYPEYLIEESLLAPKT
FT                   VWISSPALLTRLNLADTKLKQCAFAGVISSGGVLPADVGNAIRERLGVKLIECYGSTET
FT                   GAIAFRADDGLWQPTPLTTVGLNEEGALWVESEWFNQREQTADAAELIDGKFNLLGRLD
FT                   RIVKFGDKRISLVKIEQDLLRHPWVTDCYVAQHPQHLRPAAWVALNEAGIAAYRQQGRH
FT                   EFVNELRAFLMQTQERAGLPRFWRFTTELPRNSQSKLSKEAFYQVFLTEKEEHF"
FT   gene            complement(486757..487302)
FT                   /locus_tag="D11S_0536"
FT   CDS_pept        complement(486757..487302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0536"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81946"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545144.1"
FT                   /protein_id="ACX81946.1"
FT                   /translation="MMKVLINVLLSLTGVAYPIIWLFAEDQTPLFYLPWIMALLWAAKG
FT                   FFQQQGQRYFAWAMALILAVVGITRSVETMFWYPIIINGLMLSLFGGSLWSEQTVVERL
FT                   ARLQTPDLSEAGVRYTRKVTQLWCAVFVINIVITASAIWLKYYDFWALYTGVLSYCFIG
FT                   VIMAGEWLVRQKVKKQQT"
FT   gene            complement(487328..488995)
FT                   /locus_tag="D11S_0537"
FT   CDS_pept        complement(487328..488995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0537"
FT                   /product="AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81947"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568659.1"
FT                   /protein_id="ACX81947.1"
FT                   /translation="MFAKYTDNNLIASHPEWRYADFAQKALQISAELQQRQIQAITVWL
FT                   EDGAKLACTLLAAWHANVRVLFPPNFTPESIQWVNENADLWLTDSDINQPTAEWFDRFG
FT                   ESRHIEKHPQNPPLFDYTNQTEIWLKTSGSTGEAKTIVKTVEQMWLGAEALATALPFNA
FT                   DNTVTALSTVSIQHIYGLTVHIMMSLVNGWQIGRKQQFYPECIISEAQKSTQTVVVSSP
FT                   TMLSRIDWQNTKMPQTIAGVISSGGALAEDISEQMRQVLQQPVIEIYGSTETGPIAIRD
FT                   DIHLWQTLPNSRLGSDEQGDLWIEGCWLSAREQTADMVEFLADGFRLLGRSDRIVKIGD
FT                   KRTSLAGIEGKLLQHDWVDDCYIARHPEVPRLAAWVGLHAQGVEILREKGRRYLIEQFK
FT                   DYLAETQDKTAIPRFWRFIDKLPRNSQSKINKLEFNRTCVEAQHDPIWFTQEKDERHYQ
FT                   ATGKVPLDLLYLKDHFANFPLVPGVIELQWISEKVNAFLGREVTFSRVDKLKFQKFLRP
FT                   NDTFILQLNANESLDKITFQLKVDNEICCSGVAILAQA"
FT   gene            complement(488995..489246)
FT                   /locus_tag="D11S_0538"
FT   CDS_pept        complement(488995..489246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0538"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81948"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557505.1"
FT                   /protein_id="ACX81948.1"
FT                   /translation="MTEQEIRDLLSEALEYLFEIEPERIKPDTNLYEDLEIDSIDAIDL
FT                   IDHIKRKTGHKLQAEDFRNVRTVDDVVKAVLKLSQNAQ"
FT   gene            complement(489249..489512)
FT                   /locus_tag="D11S_0539"
FT   CDS_pept        complement(489249..489512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0539"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81949"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545151.1"
FT                   /protein_id="ACX81949.1"
FT                   /translation="MELEQQLKQLIIDSLALEDIGIENIDNDTVLFSDSGLGLDSVDAL
FT                   ELGLAVQKTFGLQLDSEQTQLRDHFASVATLAQFIRSQKGEV"
FT   gene            complement(489490..490278)
FT                   /locus_tag="D11S_0540"
FT   CDS_pept        complement(489490..490278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0540"
FT                   /product="acyl-phosphate glycerol 3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81950"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545153.1"
FT                   /protein_id="ACX81950.1"
FT                   /translation="MAEKLDWLRRFVFTTIGFLFWGVAGTLLQLVLYPYARKHKHGDLQ
FT                   TQLKVRRFVGGSWYYFIRYLSCAGVLEVSYKGFEKLGRTGQLILPNHPSLLDVVLILGK
FT                   TPTLNCIVKKELLDNPTMRNQILACGFLPNTESVELLEQSHEVLQQQALLLFAEGTRTG
FT                   WNGEVKLNRGAVSIGLRSAKVITPVVIRMNPLSLKKGHPWYKIPRKRIHYELIVGDDID
FT                   PQDWLKEQSIPMASRRLTKYLENYFNTHIKDNENGTGTTA"
FT   gene            complement(490263..491006)
FT                   /locus_tag="D11S_0541"
FT   CDS_pept        complement(490263..491006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81951"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545155.1"
FT                   /protein_id="ACX81951.1"
FT                   /translation="MTQTICQFSFNIADWKIVCNKQLSTEDWKSGYAHWQQNQANFADF
FT                   SPKLAFLPPLKRRRLSDSARLFFEAAWDLVEEQSNLPVVYASANSEINRNFTLWYSLLT
FT                   EGDVSPTSFSLSVHNALIGQWSEFRQVKAETTALTANKDNLEVALLEAYLLLKEGAKKV
FT                   LVVIAESPLELRYNVQPVVRRPFIYALALVVEAGGQYQLSLTNQAPKADDVPDTALEWV
FT                   KNQHLDCTQWRTPSSAGGAWLWQKS"
FT   gene            complement(491036..491359)
FT                   /locus_tag="D11S_0542"
FT   CDS_pept        complement(491036..491359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81952"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545157.1"
FT                   /protein_id="ACX81952.1"
FT                   /translation="MKTVRKYSIFIDNEYMVLAVRQLLSNRSLGKIDPVFIFTILVEPV
FT                   KEKGNCDRILFFTVKGNSRIIAGAKPDLRDVAVKQLRFFYLINVVAMKTIVLIRSAYKV
FT                   KQT"
FT   gene            491387..491812
FT                   /locus_tag="D11S_0543"
FT   CDS_pept        491387..491812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0543"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81953"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557497.1"
FT                   /protein_id="ACX81953.1"
FT                   /translation="MKLMTKLTLAVATVFIAACAPRDTTHHYDIQSVLNSPEAQRFLNP
FT                   NVKLYFGKPAPGKVVVDNAVTNKKTNAANKSDEKACKRAFLSAVKQLQDKAQSSGATKV
FT                   GNIVSYYKKNVYKSTTQYECHAGHLIAGVALKGDIVK"
FT   gene            complement(491913..492626)
FT                   /locus_tag="D11S_0544"
FT   CDS_pept        complement(491913..492626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0544"
FT                   /product="HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81954"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545162.1"
FT                   /protein_id="ACX81954.1"
FT                   /translation="MKFYRTLMPFQVISFDLDDTLYDNSHVITTAEQKFVTFVQQHCHM
FT                   ADFSLEMWAAYKRATAQHNPLMAEDVTLWRLRSLQVLLAERGKSAVEIAGVSQTAMDYF
FT                   LHWRHQIDVPPQSFAVLQQLKPRYKLVAITNGNVDPVRIGFDQFDLVLRGGKHGRAKPH
FT                   KDLFLQTAHYFNILPEQILHVGDNLGTDVQGAIQAGCQSVWLNLSGKDITEFSEVHILP
FT                   TVEMNELTDLLQLYG"
FT   gene            complement(492640..493530)
FT                   /gene="xerC"
FT                   /locus_tag="D11S_0545"
FT   CDS_pept        complement(492640..493530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="D11S_0545"
FT                   /product="site-specific tyrosine recombinase XerC"
FT                   /note="site-specific tyrosine recombinase which cuts and
FT                   rejoins DNA molecules; binds cooperatively to specific DNA
FT                   consensus sites; forms a heterotetrameric complex with
FT                   XerC; XerCD exhibit similar sequences; essential to convert
FT                   chromosome dimers to monomers during cell division and
FT                   functions during plasmid segregation; cell division protein
FT                   FtsK may regulate the XerCD complex; enzyme from
FT                   Streptococcus group has unusual active site motifs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81955"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518154.1"
FT                   /protein_id="ACX81955.1"
FT                   /translation="MQNALQHYFTYLRVERQVSPHTLSNYQRQLARVTAILQGAGITQW
FT                   QQVTASVVRYVVAQSSKQDGLKEKSLALRLSALRRFLTYLVQQGELKVNPATGISAPKQ
FT                   AKHLPKNIDTDQVQLLLANDSKEPIDIRDRAIIELLYSSGLRLSELQGLNLNSIHLRSR
FT                   EVRVIGKGNKERVVPFGRYASHAIQQWLKVRLLFNPKDNALFVSQLGNRMSHRAIQMRL
FT                   ETWGIRQGLNSHLNPHKLRHSFATHMLEASSDLRAVQELLGHSNLSTTQIYTHLNFQHL
FT                   AAVYDAAHPRAKRKK"
FT   gene            complement(493540..494364)
FT                   /gene="dapF"
FT                   /locus_tag="D11S_0546"
FT   CDS_pept        complement(493540..494364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="D11S_0546"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="involved in lysine biosynthesis; DAP epimerase;
FT                   produces DL-diaminopimelate from LL-diaminopimelate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81956"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518153.1"
FT                   /protein_id="ACX81956.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNIYFPTETIKRLADRHRGVGFDQL
FT                   LVVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTQNGKM
FT                   LLTVKEDGNVRVNMGEPIWEPNKIPFTANKFEKNYILRTEIQTVLCSAVSMGNPHCVVQ
FT                   VEDIQTANVEQLGPLLENHERFPERVNAGFMQVVNRHHIKLRVYERGTGETQACGSGAC
FT                   AAVAVGIMQGVLDNEVQVDLPGGSLTIEWQGEGHPLYMTGSATHVYDGVVCL"
FT   gene            complement(494443..494622)
FT                   /locus_tag="D11S_0547"
FT   CDS_pept        complement(494443..494622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0547"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81957"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544245.1"
FT                   /protein_id="ACX81957.1"
FT                   /translation="MKKIVVLLPKREPICKRIDACKSSFINAEIVGVFSNNADAFGLQQ
FT                   AKSAVKNDRTFSSY"
FT   gene            complement(494622..495650)
FT                   /locus_tag="D11S_0548"
FT   CDS_pept        complement(494622..495650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0548"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /note="catalyzes the formation of
FT                   1-(5-phosphoribosyl)-5-aminoimidazole from
FT                   2-(formamido)-N1-(5-phosphoribosyl)acetamidine and ATP in
FT                   purine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81958"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544243.1"
FT                   /protein_id="ACX81958.1"
FT                   /translation="MSKQSLSYKDAGVDISAGNDLVERIKSDVKRTTRPEVMSGFNALC
FT                   AIPAKYKEPILVSGTGGVGTKLRLAIDLKRHDTIGVDLVAMCVNDLVVQGAEPLFFLDY
FT                   YATGKLEVDVAASVIKGIANGCEQSGCALVGGETAEMPGMYHQGDYNLAGFCVGVVEKS
FT                   EIIDGSEVKVGDALIALGSSGPHSNGYSLIRKVVDLSGVNPAEAQVGDRPLADHLLAPT
FT                   KIYVKSILQLIKHVDVHAIAHLTGGGFWENIPRVLPPSVKAVINENSWQWPAVFSWLQQ
FT                   QGNITDHEMYRTFNCGVGMIVALPQEDVETALGLLHQAGENAWVIGEVQHLGNDEAQVI
FT                   IR"
FT   gene            495833..496333
FT                   /locus_tag="D11S_0549"
FT   CDS_pept        495833..496333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0549"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81959"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545169.1"
FT                   /protein_id="ACX81959.1"
FT                   /translation="MKKTIVILTALLLAACTNPPATQTASAKNADIPPQQEVPITPPKD
FT                   TKNGFLQLMPGIFYYVDMDSIWVDNQDKRLIHFDSVINLDKGLYVFKEYPALFAKSMRQ
FT                   YKILNCENFYFTHVRSDFYADFWGDGIRTAPKRQSQHTITLQPQSSLYILGQVMCANMY
FT                   RRK"
FT   gene            complement(496435..499005)
FT                   /locus_tag="D11S_0551"
FT   CDS_pept        complement(496435..499005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0551"
FT                   /product="protein disaggregation chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81961"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167565.1"
FT                   /protein_id="ACX81961.1"
FT                   /translation="MNIEKFTTKFQQALAEAQSLAVGKDNQFIEPVHLLSALLNQQDGS
FT                   IAPILTTGGVNVALLRNEINNELAKLPQVSGNGGNVQISRQLLNILNLCDKLAQQRQDK
FT                   FISSEIFLLAALEEKGTLSEILKKCGAKKEQILQAIEQIRGGQKVNDQNAEESRQALEK
FT                   YTIDLTARAESGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKNKRVLSLDMGALIAGAKYRGEFEERLKAVLNELAKEEGRVILFIDEIH
FT                   TMVGAGKTDGAMDAGNLLKPSLARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVGE
FT                   PSVEDTIAILRGLKERYEIHHHVQITDPAIVAAATLSHRYISDRQLPDKAIDLIDEAAS
FT                   SIRMEIDSKPQPLDRLDRRIIQLKLEQQALQKEDDDASRKRLEMLEKELAEKEREYAEL
FT                   EEVWKSEKAALSGTQHIKAELENARTQMEQARRAGDLSKMSELQYGKIPDLEKQLAQAE
FT                   GAEGKEMSLLRYRVTDEEIAEVLSRATGIPVAKMMEGEKEKLLHMEEFLHKRVIGQNEA
FT                   VDAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKALASFLFDSEDAMMRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHHDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQDHAQEGYDTVKSMVMEVVGRYFRPEFI
FT                   NRIDETVMFHPLNKENIRQIADIQLRRLTRRMETHGYVLNFTDATLDFISDIGYDPIFG
FT                   ARPLKRAIQQEIENPLAQQILSGALLPDKVIDVDYVDGQIVAKQ"
FT   gene            499270..499851
FT                   /locus_tag="D11S_0552"
FT   CDS_pept        499270..499851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0552"
FT                   /product="competence protein ComEA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81962"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568669.1"
FT                   /protein_id="ACX81962.1"
FT                   /translation="MKSLKSLLAVAVVMTVSTTVFAEESVFTEVKDGAKSAWQTVKSDA
FT                   KTVGGKVKEGAVKVKDATKEKFVEAKEATKETFTKAKDATKEKFAEGKKAVKDTFQNEK
FT                   PAPVEDKSTAKEKSAVENKAKITRSKKVDINTADAATLENLSGIGEAKAKAIVEYREKN
FT                   GKFKNLNDLSNVPGIGDVTLEKVKSHVRFN"
FT   gene            complement(499924..501036)
FT                   /locus_tag="D11S_0553"
FT   CDS_pept        complement(499924..501036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0553"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="catalyzes the formation of 4-aspartyl phosphate from
FT                   aspartate 4-semialdehyde"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81963"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545176.1"
FT                   /protein_id="ACX81963.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMDRMQQENDFTNINPIFFTTSQAGQAAP
FT                   TFGGKDAGTLKNAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWSGYWVDAASALRM
FT                   EEDAIIVLDPVNQHVISEGLKNGVKTYVGGNCTVSLMLIALGGLFEKDLVEWISVATYQ
FT                   AASGAGAKNMRELLVQMGELNGEVKGLLADPNSSILDIERAVTAKMRDKDFPIDNFGAP
FT                   LAGSLIPWIDKLLESGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFT
FT                   IKLKRDIPLAEIEQILASHNEWVKVIPNDKETTLRELTPTKVTGTLSVPVGRLRKLNLG
FT                   PEYLAAFTVGDQLLWGAAEPIRRILVQLVK"
FT   gene            complement(501220..502032)
FT                   /locus_tag="D11S_0554"
FT   CDS_pept        complement(501220..502032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0554"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81964"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568673.1"
FT                   /protein_id="ACX81964.1"
FT                   /translation="MTIPNYRDQIKVIFFDIDETLFMKEQDHLPASVPLFIRKLKQNGI
FT                   IPAIASGRSRTMFPWQVKQLVEQEGMALFVTMNGQSVTHKNQVIAKHTIPTEQIRRLTY
FT                   FFDQHHIAYAFITDDAVNVSEKNARVTSSFDVITTDYAVDKAFFERHAISQILPFYREE
FT                   QDQLVQNCGLLDGLRMVRWHEESVDLFDAEGSKVRGIETAVKHLGLSMENVMAFGDGLN
FT                   DLEMLSRVGVGVAMGNGHEKLKAIADHVADPIDQDGIYRFLVKAGLID"
FT   gene            502178..502864
FT                   /locus_tag="D11S_0555"
FT   CDS_pept        502178..502864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0555"
FT                   /product="competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81965"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568674.1"
FT                   /protein_id="ACX81965.1"
FT                   /translation="MNVFQSCCVHCHTPLKLAKHGLCSRCNRTIQRFAYCGCCGAELAE
FT                   NVLHCGNCLRQEPAWDRMVIIGRYNEPLSTLIHRFKFQNQFWLDRTLARLLYLAIRDAR
FT                   RTHRLPLPEVILPVPLHHFRQWRRGYNQADLLAQQLAKWFKIPVDNGLLLRTKRTPTQR
FT                   GLTTKDRRHNLKNAFRISTNDRHFPYRSVALVDDVITTGSTLNEIAKRLRQANVVHIQV
FT                   WGLART"
FT   gene            502981..503565
FT                   /locus_tag="D11S_0556"
FT   CDS_pept        502981..503565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0556"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81966"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539159.1"
FT                   /protein_id="ACX81966.1"
FT                   /translation="MQQITISEAAQAHFRRLLDQQEEDTHIRIFVVNPGTPNAECGVSY
FT                   CPPNSVEADDTEIKYDSFSAFVDEISLPFLEDAEIDYVTEELGAQLTLKAPNAKMRKVA
FT                   DDAPLIERVEYVIQTQINPQLASHGGKITLLEITDDGYAILQFGGGCNGCSMVDVTLKD
FT                   GVEKQLVNIFPGELNGARDVTEHRRGEHSYY"
FT   gene            complement(503611..504045)
FT                   /pseudo
FT                   /locus_tag="D11S_02365"
FT                   /note="hypothetical protein; disrupted"
FT   gene            complement(504062..505453)
FT                   /locus_tag="D11S_0558"
FT   CDS_pept        complement(504062..505453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0558"
FT                   /product="branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81968"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568679.1"
FT                   /protein_id="ACX81968.2"
FT                   /translation="MTLCVLYDFITNRKAFVVEYRGFLSQEKFIMFSRKDIVVLGMMIF
FT                   ALFLGAGNIIFPPMEGYTAGQHWAIAALGFVLTGVLMPFITLVVVSVLGRGEELTRDLP
FT                   KWAEVLFLATLYLVIGSTFAMPRITNVAYEMALVPLEIVADTSANHLIFAVAFNIIAML
FT                   FMLKPNTIISSVGKFMTPALLVLLVVVTAAVFISPLSEISAPSKAYAEGSVLTTGLISG
FT                   YQTMDVLAAIAFGGIVARALSSKNVTEPHKIMRYTIFAGCISVVLLAALYFSLFYLGAT
FT                   SDAVAQGANNGGQIFSRYVGVLFGKEGSLIMSGIIFLASLTTLVGVTSACAYYFAKFSN
FT                   RLPYSFWVVFFTIMTTIISENGLTKLLQVTIPALLLIYPVAIMLVVLQMVRAKLPWVKL
FT                   TYNATIIITVCFSLCDSLNNVELLPAGVKRLLENFPLYDNGLAWLIPALGMMVLTILIG
FT                   KMAKK"
FT   gene            505591..507225
FT                   /gene="pyrG"
FT                   /locus_tag="D11S_0559"
FT   CDS_pept        505591..507225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="D11S_0559"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /note="CTP synthase; cytidine triphosphate synthetase;
FT                   catalyzes the ATP-dependent amination of UTP to CTP with
FT                   either L-glutamine or ammonia as the source of nitrogen; in
FT                   Escherichia coli this enzyme forms a homotetramer"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81969"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576728.1"
FT                   /protein_id="ACX81969.1"
FT                   /translation="MATNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYI
FT                   NVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRTKMTKRNNFTTGKIYSEVLRKER
FT                   RGDYLGATIQVIPHITNEIKARVIDGAAGHDVVIVEVGGTVGDIESLPFLEALRQLAVQ
FT                   VGRERTIFMHLTLVPYIPTAGELKTKPTQHSAKELLSIGIQPDVLICRSDRMIPPNERA
FT                   KIALFCNVPERAVISLKDVSSIYQIPALLKSQGLGDFICDRFHLTCPEADLSEWEQVLY
FT                   QQANPTGEVIIGMVGKYTELPDAYKSVNEALKHAGLKNRLTVNIKYIDSQDVETKGVEI
FT                   LKGLDGILVPGGFGYRGVEGKILTAKYARENSIPYLGICLGMQVALIEFARNVAGMSHA
FT                   NSSEFDRTCEQPVVGLITEWQDADGNTEVRSDESDLGGTMRLGAQKCHLAEGSLARKLY
FT                   GTETIEERHRHRYEVNNVLLPQIEKAGLKVTGLSADKKLVEIIEVPNHPWFVACQFHPE
FT                   FTSTPRDGHPLFEGFVKAAKDNQKRSD"
FT   gene            507469..507921
FT                   /pseudo
FT                   /locus_tag="D11S_02370"
FT                   /note="transposase; disrupted"
FT   gene            508243..508614
FT                   /locus_tag="D11S_02375"
FT   CDS_pept        508243..508614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02375"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02375"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590135.1"
FT                   /protein_id="ANN81528.1"
FT                   /translation="MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNTEQPIGTRIFGPVT
FT                   RELRSEKFMKIISLAPEVL"
FT   gene            508625..508936
FT                   /gene="rplX"
FT                   /locus_tag="D11S_0560"
FT   CDS_pept        508625..508936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="D11S_0560"
FT                   /product="50S ribosomal protein L24"
FT                   /note="assembly initiator protein; binds to 5' end of 23S
FT                   rRNA and nucleates assembly of the 50S; surrounds
FT                   polypeptide exit tunnel"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81970"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014992365.1"
FT                   /protein_id="ACX81970.1"
FT                   /translation="MAAKIRQNDEVIVLTGKSKGKRGKVTKVLSNGKVIVEGVNIITKH
FT                   EKPVPALGKEGGLVKKEAAIDVSNVAIFNPTTNKADRVGFRFEDGKKVRFFKSNNEII"
FT   gene            508954..509493
FT                   /locus_tag="D11S_0561"
FT   CDS_pept        508954..509493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0561"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81971"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P44346.2"
FT                   /protein_id="ACX81971.1"
FT                   /translation="MAKLHDYYRDQVVNELKTKFNYSSVMQVPRIEKITLNMGVGEALT
FT                   DKKLLDNAVADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFLERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKND
FT                   EEGRALLAAFNFPFRK"
FT   gene            509506..509811
FT                   /gene="rpsN"
FT                   /locus_tag="D11S_02380"
FT   CDS_pept        509506..509811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="D11S_02380"
FT                   /product="30S ribosomal protein S14"
FT                   /note="located in the peptidyl transferase center and
FT                   involved in assembly of 30S ribosome subunit; similar to
FT                   what is observed with proteins L31 and L33, some proteins
FT                   in this family contain CXXC motifs that are involved in
FT                   zinc binding; if two copies are present in a genome, then
FT                   the duplicated copy appears to have lost the zinc-binding
FT                   motif and is instead regulated by zinc; the proteins in
FT                   this group do not appear to have the zinc-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02380"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167559.1"
FT                   /protein_id="ANN81529.1"
FT                   /translation="MAKQSMKARDVKRVKLAEKFYAKRVELKKIISDINASDEDRWNAV
FT                   LKLQTLPRDSSPSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   gene            509848..510240
FT                   /locus_tag="D11S_0562"
FT   CDS_pept        509848..510240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0562"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81972"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q65QW9.1"
FT                   /protein_id="ACX81972.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAISMPSSKLKVAIANVLASEGY
FT                   IESVKVVEGVKPELEITLKYFQGKPVVESIQRVSRPGLRIYKRKDELPKVMGGLGIAVV
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            510256..510789
FT                   /locus_tag="D11S_0563"
FT   CDS_pept        510256..510789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0563"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81973"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014326503.1"
FT                   /protein_id="ACX81973.1"
FT                   /translation="MSRVAKAPVSIPAGVEVKLNGQLLTIKGKNGELSRSIHHSVEVKH
FT                   ENNELTFSPREGVEGGNAQSGTARALVNSMVIGVTEGFTRKLQLVGVGYRAQIKGNAVA
FT                   LSLGFSHPVEHVLPAGITAECPSQTEIVLKGSDKQLIGQVAADIRAYRRPEPYKGKGVR
FT                   YADEVVRIKEAKKK"
FT   gene            510803..511156
FT                   /locus_tag="D11S_0564"
FT   CDS_pept        510803..511156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0564"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81974"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q7VKE9.1"
FT                   /protein_id="ACX81974.2"
FT                   /translation="MDKKSARIRRAARARHMMREQGVTRLVVHRTPRHIYAQVIAPNGS
FT                   EVLAAASTVEKAIIEQVKYTGNKDAAAVVGKIVAERALAKGVKDIAFDRSGFKYHGRIQ
FT                   SLADAAREAGLQF"
FT   gene            511172..511672
FT                   /locus_tag="D11S_0565"
FT   CDS_pept        511172..511672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0565"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81975"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017805528.1"
FT                   /protein_id="ACX81975.1"
FT                   /translation="MSNIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMINVALSEGTLQHPIKGTHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKSVDE
FT                   ILG"
FT   gene            511679..511858
FT                   /gene="rpmD"
FT                   /locus_tag="D11S_02385"
FT   CDS_pept        511679..511858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="D11S_02385"
FT                   /product="50S ribosomal protein L30"
FT                   /note="L30 binds domain II of the 23S rRNA and the 5S rRNA;
FT                   similar to eukaryotic protein L7"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02385"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017805527.1"
FT                   /protein_id="ANN81530.1"
FT                   /translation="MAKTIKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTLVVR
FT                   GMINQVSYMVKVEE"
FT   gene            511862..512296
FT                   /locus_tag="D11S_0566"
FT   CDS_pept        511862..512296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0566"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81976"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018356920.1"
FT                   /protein_id="ACX81976.1"
FT                   /translation="MRLNTLSPAEGAKHSAKLLGRGIGSGLGKTGGRGHKGQKSRTGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSMKSAVTAEVRLDDLNKIENGIVTLETLKAANILTKD
FT                   IQFAKVILAGEVKNKLVIRGLRVTKGAKAAIEAAGGSIEE"
FT   gene            512300..513625
FT                   /gene="secY"
FT                   /locus_tag="D11S_0567"
FT   CDS_pept        512300..513625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="D11S_0567"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="forms heterotrimeric complex in the membrane; in
FT                   bacteria the complex consists of SecY which forms the
FT                   channel pore and SecE and SecG; the SecG subunit is not
FT                   essential; in bacteria translocation is driven via the SecA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81977"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561771.1"
FT                   /protein_id="ACX81977.1"
FT                   /translation="MAKQPGYQTRSTQGGTSELKSRLLFVLGALIVFRIGSFIPVPGID
FT                   AAVLAQLIEQQKGTIIDMFNMFSGGALSRASIFALGIMPYISASIIIQLLASVHPALAE
FT                   LRKEGESGRRKISKYTRYSTVVLATLQAVGISTGLPNMLPGLVPNLGFGFYFTAVISLV
FT                   TGTMFLMWLGEQITERGIGNGISLIIFAGIVAGLPAAVGQTIEQARLGQMHFLVLLLIA
FT                   VIVLAVTYFVVFVERGHRRIKVEYAKRQQGRQILGGHSTHLPLKVNMAGVIPAIFASSI
FT                   ILFPATLTQWVGQGSSLEWLTDLSMLLHPGQPLYLVVYASAIIFFSFFYTAMQYNPRDT
FT                   ADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGLYVTFVCLVPYIMTSAWNVQFYF
FT                   GGTSLLIVVVVIMDFIVQIQSHLMSTRYESALKKANLKGFGQ"
FT   gene            513651..513764
FT                   /gene="rpmJ"
FT                   /locus_tag="D11S_0568"
FT   CDS_pept        513651..513764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="D11S_0568"
FT                   /product="50S ribosomal protein L36"
FT                   /note="smallest protein in the large subunit; similar to
FT                   what is found with protein L31 and L33 several bacterial
FT                   genomes contain paralogs which may be regulated by zinc;
FT                   the protein from Thermus thermophilus has a zinc-binding
FT                   motif and contains a bound zinc ion; the proteins in this
FT                   group have the motif"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81978"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006250018.1"
FT                   /protein_id="ACX81978.1"
FT                   /translation="MKVRASVKKLCRNCKIVKREGVVRVLCSDPKHKQRQG"
FT   gene            513906..514262
FT                   /locus_tag="D11S_0569"
FT   CDS_pept        513906..514262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0569"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81979"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007242368.1"
FT                   /protein_id="ACX81979.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGIGKTRSKSICAAAGIAEDVKI
FT                   SELSEEQIDKLRDEVGKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            514278..514667
FT                   /locus_tag="D11S_0570"
FT   CDS_pept        514278..514667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0570"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81980"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P44379.2"
FT                   /protein_id="ACX81980.1"
FT                   /translation="MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNVLAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEIVKEFGLKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            514697..515317
FT                   /locus_tag="D11S_0571"
FT   CDS_pept        514697..515317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0571"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81981"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005759597.1"
FT                   /protein_id="ACX81981.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDIAPGQHGARK
FT                   PRLSDYGSQLREKQKVRRMYGILERQFRNYYKEANRLKGNTGENLLVLLEGRLDNIVYR
FT                   MGFAATRAEARQLVSHKAIVVNGRVVNIPSFQVSVDDVVAVREKSKKQARIKASLELAE
FT                   QKEKPTWLEVDAAKMEGVLKRVPERSDLSADINEHLIVELYSK"
FT   gene            515346..516335
FT                   /locus_tag="D11S_0572"
FT   CDS_pept        515346..516335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0572"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="catalyzes the transcription of DNA into RNA using
FT                   the four ribonucleoside triphosphates as substrates.
FT                   Dimerization of the alpha subunit is the first step in the
FT                   sequential assembly of subunits to form the holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81982"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575706.1"
FT                   /protein_id="ACX81982.1"
FT                   /translation="MQGAVTEFLKPRLVDIEQISSTQAKVILEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEVLLNLKGLAVKVQNKDDVLLTLSK
FT                   SGIGPVVAADITHDGDVEVINPEHVICHLTDENASISMRIRVRRGRGYVPASVRAQIQD
FT                   EERPIGRLLVDACYSPIERIAYNVEAARVEQRTDLDKLVIELETNGTIDPEEAIRRAAT
FT                   ILAEQLDAFVDLRDVRQPEVKEEKPEFDPILLLPVDDLELTVRSANCLKAETIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIAED"
FT   gene            516377..516766
FT                   /gene="rplQ"
FT                   /locus_tag="D11S_0573"
FT   CDS_pept        516377..516766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="D11S_0573"
FT                   /product="50S ribosomal protein L17"
FT                   /note="is a component of the macrolide binding site in the
FT                   peptidyl transferase center"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81983"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005556262.1"
FT                   /protein_id="ACX81983.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMASSLIGHEIIKTTLPKAKELR
FT                   RVVEPLITLAKVDSVANRRLAFARTRNTETVAKLFNELGPRFAQRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPEVSSKEATAE"
FT   gene            complement(517775..519004)
FT                   /locus_tag="D11S_0574"
FT   CDS_pept        complement(517775..519004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0574"
FT                   /product="tyrosine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81984"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545497.1"
FT                   /protein_id="ACX81984.1"
FT                   /translation="MLLKNKTFGSALIIAGTAIGAGMLAMPLTSAGMGFAFTAALLIGL
FT                   WLLLAYSGLLFVEVYQTAKRKDDGVATLAEKYFGIPGRIISTLSLFILLYALSAAYMAG
FT                   GGTLLANALPKDFLGSADITLKISILIFTFILGAFVVIGTKGVDNITRVLFSGKIIAFI
FT                   LVLAIMLPKVIGENLTAMPLEYTLILSAGPIFFTSFGFHVVMGSINNYLEGDVKRFRSA
FT                   IIIGTAIPLMAYLLWQLATHGILSQNEFVAVLKDDPTLSGLINATKTLRDTTLLSQVLP
FT                   IFYSFALITSFLGVALGLFEGLNDLFKRTKMPANRVSLTIATFTPPLIFALFYPNGFLS
FT                   ALSYAGLLCAFYCLILPIGLAWRTRKQYQDLPYRVAGGNLMLVVTLIIGIIIIIIPFLT
FT                   EAGILPRVVS"
FT   gene            complement(519134..519817)
FT                   /locus_tag="D11S_0575"
FT   CDS_pept        complement(519134..519817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81985"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568958.1"
FT                   /protein_id="ACX81985.1"
FT                   /translation="MLLFAGDPHGSFDHLYPFLKERRDVALIILGDLQLTNPEPLEKLA
FT                   QYADIWFIHGNHDSKTVAAFESIWGTEWKTRNLHGRVQQIQNKRIAGLGGVFRGQIWMP
FT                   PNKPLFFDPIHYCQYCPQEKIWRGGVPLRHRTSIFPSDIEIFEQQQADILICHEAPKPH
FT                   PSGFDVINQLAKKLGVTQIYHGHHHENFDYRTLPQQNYQIINVGFRSLCDEAGNYLYIG
FT                   VDNRE"
FT   gene            complement(519833..521104)
FT                   /locus_tag="D11S_0576"
FT   CDS_pept        complement(519833..521104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0576"
FT                   /product="transcriptional regulator"
FT                   /EC_number="2.7.7.1"
FT                   /note="catalyzes the formation of NAD(+) from nicotinamide
FT                   ribonucleotide; catalyzes the formation of nicotinamide
FT                   mononucleotide from nicotinamide riboside; also has a
FT                   regulatory function"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81986"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578345.1"
FT                   /protein_id="ACX81986.1"
FT                   /translation="MSAFQYLQEKRKKLNLKVNDVCQRANITRAYFNQLVSGKIKSPSA
FT                   TKLTALHRVLQIDAPNNKKVGVIFGKFYPVHTGHINMIYEAFSKVDEVHVIVCSDTERD
FT                   LKLFYDSKMKRMPTVQDRLRWMQQIFKYQKNQIFIHHLIEDGLPNYPNGWQAWAERVKD
FT                   LFKEKGFTPSIVFSSEIQDKAPYEKYLNLDVSLVDPERVFFNVSATKIRNEPFHYWKFI
FT                   PKEVRPFFAKTIAILGGESSGKTVLVNKLATVFNTTSAWEYGREFVFEKLGGDEQAMQY
FT                   SDYPQMALGHQRYIDYAVRHAHKVAIIDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFD
FT                   VTILLNNNTQWVDDGLRSLGNQKQRQRFQQLLKKLLDKYNVPYIEIESPSYLERYNRVK
FT                   EIVEKILNEEELPELSSDHGNSIF"
FT   gene            complement(521424..521669)
FT                   /locus_tag="D11S_0577"
FT   CDS_pept        complement(521424..521669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0577"
FT                   /product="sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81987"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005575711.1"
FT                   /protein_id="ACX81987.1"
FT                   /translation="MDNIKITQTLDTVGLRCPEPVMLIRKQIRHLQEGDVLLMLADDPA
FT                   TTRDIPSFCQFMDHTLLHSETTQIPYRYWVKKGKSV"
FT   gene            522059..522274
FT                   /locus_tag="D11S_0580"
FT   CDS_pept        522059..522274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81990"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005545493.1"
FT                   /protein_id="ACX81990.1"
FT                   /translation="MAYLHYAVCCDYTQINELQTLCEQCAILIQAQGFQVDITLRLAIR
FT                   PDKLARFQQALTERSAGQLVLNEIKN"
FT   gene            522293..523756
FT                   /locus_tag="D11S_0581"
FT   CDS_pept        522293..523756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0581"
FT                   /product="potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81991"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005586977.1"
FT                   /protein_id="ACX81991.1"
FT                   /translation="MHFLSILRIVGILVMCFSCTMLLPAFVALLYGDGGGKAFIQSFVM
FT                   SAIAGVILWWACHHHKEELRSREGFLIVVAFWVVMGSLGAIPFMLFEDPYLTVSSAFFE
FT                   SFSGLTTTGATTIVGLDNLPKAILFYRQLLQWLGGMGIIVLAVAIIPLFGIGGMSLYRA
FT                   EISGPLKENKMRPRITETAKTLWIIYASLTLLCAFSYWLAGMSPFDAISHSFSTVSIGG
FT                   FSTHDRSMAYFASSTVNIITVVFLLISACNYVLHFNAFSQLGKRNIFLSYFRDPEFRFF
FT                   MLIQFSLVLICFAMLLANHHFDETFQNLEQALFQSVSISTTAGYTTSSFEQWPLFLPIL
FT                   LLFASCIGGCAGSTGGGLKVVRVLVLYLQAKRELKRLIHPNLVYPIKLGKRVLDERVIQ
FT                   SIWAFFSAYLLVFVICLLGVISCGVETFDAFNAVIACLNNVGPALGTVSSNFVGIPDSA
FT                   KWILTLAMVCGRLEIFSLLVLFTPAFWKS"
FT   gene            523756..524268
FT                   /locus_tag="D11S_0582"
FT   CDS_pept        523756..524268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0582"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81992"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518477.1"
FT                   /protein_id="ACX81992.1"
FT                   /translation="MKTLILYSTHNGQTKKIADYIAELITANVEVKSINAEVNFADYER
FT                   IIIGASIRYGHFNKQLYKTLEKHTALLNQKTTAFFGVNLTARKADKATPETNVYVRKFL
FT                   QRITWQPTISAVFAGALLYPRYGFFDRMMIQLIMRITGGETDLTKEIEYTDWQKVRSFS
FT                   EAFLQLK"
FT   gene            524583..526187
FT                   /locus_tag="D11S_0583"
FT   rRNA            524583..526187
FT                   /locus_tag="D11S_0583"
FT                   /product="16S ribosomal RNA"
FT   gene            526240..526315
FT                   /locus_tag="D11S_0584"
FT   tRNA            526240..526315
FT                   /locus_tag="D11S_0584"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:526274..526276,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            526515..529556
FT                   /locus_tag="D11S_02395"
FT   rRNA            526515..529556
FT                   /locus_tag="D11S_02395"
FT                   /product="23S ribosomal RNA"
FT   gene            529839..529954
FT                   /locus_tag="D11S_02400"
FT   rRNA            529839..529954
FT                   /locus_tag="D11S_02400"
FT                   /product="5S ribosomal RNA"
FT   gene            530311..530736
FT                   /locus_tag="D11S_02405"
FT   CDS_pept        530311..530736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02405"
FT                   /product="multidrug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02405"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573549.1"
FT                   /protein_id="ANN81531.1"
FT                   /translation="MYCIYCFSHMYLCHECGSHTVVEGGEVWLGYLYVTISMLSLAWTS
FT                   YLRESLSLKYGSVVSMPYQYIAVAIAGLGMVFTLGLDLSQIKIIFSSPLLIALLIFLGM
FT                   GISGGSYLIQLYSFKHHIGVENSTMTLNLMPLLGYVT"
FT   gene            531858..532043
FT                   /locus_tag="D11S_0591"
FT   CDS_pept        531858..532043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0591"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81997"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544518.1"
FT                   /protein_id="ACX81997.2"
FT                   /translation="MKPKMKKKAIEIPEQTDFSPKAFKKLQRELALARAQIAYLKELEA
FT                   LDRQKQRQKKEKSLKD"
FT   gene            532195..532840
FT                   /pseudo
FT                   /locus_tag="D11S_02415"
FT                   /note="integrase; disrupted"
FT   gene            532936..533520
FT                   /locus_tag="D11S_0593"
FT   CDS_pept        532936..533520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0593"
FT                   /product="HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACX81999"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547886.1"
FT                   /protein_id="ACX81999.1"
FT                   /translation="MGGVLVDWNPRHLYRKIFSNDAEMERFLAEVCNSEWNARQDAGRS
FT                   WSEGVAEAVKQHPQYEAEIRAYHERWTETLNGAIDDTVALLEPLKRSGVRLLALTNRSN
FT                   ETFHFAEERFPFLTEFEGILVSGYERLAKPDPRIFNLLIERYHLNPQHTVFIDDNLRNV
FT                   EGARNVGLHTLQFTHAQKLKQDLITLGVKFD"
FT   gene            complement(534427..535464)
FT                   /locus_tag="D11S_0596"
FT   CDS_pept        complement(534427..535464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82002"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518475.1"
FT                   /protein_id="ACX82002.1"
FT                   /translation="MKKVLVIRNDKLGDFMLAWPAFAMLKASDPSLKLTALVPTYTAEI
FT                   ARACPYLDEVIIDVPKGDKAAFQRLVNDIKAQRFDAMISFFSNTHNAKLAWKCRIPYRL
FT                   APATKWVQFFYNHRLVQRRSQSAKPEFAYNLDLARRFLQDQSIAVVEPRPPYLSFPKSA
FT                   VDFQREFLCLQLNVDSSKKWIFVHSGSGGSANNLSLAQYAALIRGLLAQFDAYVILTAG
FT                   PNESEKAHELAGLVQDARVVVYDKNKGLVDFAQSLACADLFIAGSTGPLHLSGALNVPT
FT                   IGFYPSRRSATPLRWQPINDEAKHLAFCPSNDKASQTDLSKISIEEKLAKMIRFITKVW
FT                   HAADK"
FT   gene            complement(535646..537064)
FT                   /gene="aspA"
FT                   /locus_tag="D11S_0597"
FT   CDS_pept        complement(535646..537064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="D11S_0597"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="catalyzes the formation of fumarate from aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82003"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005594841.1"
FT                   /protein_id="ACX82003.1"
FT                   /translation="MTQFRKEVDLLGERDVPADAYWGIHTLRAIENFNISNTTISDVPE
FT                   FVRGMVMVKKATALTNGELGTISKKIADAIVKACDEVLVNGKCLDQFPSDVYQGGAGTS
FT                   VNMNTNEVVANLALEILGHKKGEYNYLDPMDHVNASQSTNDAYPTGFRIAVYNSIMKLV
FT                   SKVLYLQQGFENKSKEFAKVLKMGRTQLQDAVPMTVGQEFKAFSVLLDEEVRNLKRTAE
FT                   LLLEVNLGATAIGTGLNTPQGYVPLVVKHLSEVSGLPCVVAENLIEATSDCGAYVMVHG
FT                   ALKRTAVKLSKVCNDLRLLSSGPRAGLKEINLPELQAGSSIMPAKVNPVVPEVVNQVCF
FT                   KVIGNDTTVTFAAEAGQLQLNVMEPVIGQAMFESIDILTNACVNLRDKCIDGITVNKEI
FT                   CENYVFNSIGIVTYLNPFIGHHNGDLVGKICAQTGKGVREVVLEKGLLTKEELDDILSV
FT                   ENLMNPTYKAKLNK"
FT   gene            537294..537776
FT                   /locus_tag="D11S_0598"
FT   CDS_pept        537294..537776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0598"
FT                   /product="exclusion suppressor FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82004"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578162.1"
FT                   /protein_id="ACX82004.1"
FT                   /translation="MPFIAFLFAVFLFIYAELSLLVWVGSHFGIFMLILLLIGSSLLGI
FT                   LIIRARSWYALTRVRQQLKQGELPTETIFNSARWLIAGVLFVIPGFVTDILACILLSPL
FT                   GSHIAKMLLGSRFMFFRQNIFKNDHTFYSSRHHKAEDGEVFEAEFEKEVDEHKRLK"
FT   gene            537863..538153
FT                   /gene="groES"
FT                   /locus_tag="D11S_0599"
FT   CDS_pept        537863..538153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="D11S_0599"
FT                   /product="molecular chaperone GroES"
FT                   /note="10 kDa chaperonin; Cpn10; GroES; forms
FT                   homoheptameric ring; binds to one or both ends of the GroEL
FT                   double barrel in the presence of adenine nucleotides
FT                   capping it; folding of unfolded substrates initiates in a
FT                   GroEL-substrate bound and capped by GroES; release of the
FT                   folded substrate is dependent on ATP binding and hydrolysis
FT                   in the trans ring"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82005"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578164.1"
FT                   /protein_id="ACX82005.1"
FT                   /translation="MNIRPLHDKVILKREDVETKSAGGIVLTGSAATKSTRAKVLAVGP
FT                   GRLLENGSVHPMHVKVGDTVIFSDGYGVKAEKIDGEEVLIISESDILAIVE"
FT   gene            538274..539917
FT                   /gene="groEL"
FT                   /locus_tag="D11S_0600"
FT   CDS_pept        538274..539917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="D11S_0600"
FT                   /product="molecular chaperone GroEL"
FT                   /note="60 kDa chaperone family; promotes refolding of
FT                   misfolded polypeptides especially under stressful
FT                   conditions; forms two stacked rings of heptamers to form a
FT                   barrel-shaped 14mer; ends can be capped by GroES; misfolded
FT                   proteins enter the barrel where they are refolded when
FT                   GroES binds; many bacteria have multiple copies of the
FT                   groEL gene which are active under different environmental
FT                   conditions; the B.japonicum protein in this cluster is
FT                   expressed constitutively; in Rhodobacter, Corynebacterium
FT                   and Rhizobium this protein is essential for growth"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82006"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P46398.3"
FT                   /protein_id="ACX82006.1"
FT                   /translation="MAAKDVKFGNDARVKMLNGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVNSVVAELKNLSKPCETSKEIEQVGTISANSDSIVGQLIA
FT                   QAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPFILL
FT                   VDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRIVINKDNTTIIDGIGDEA
FT                   QIQGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVAGGGVALIRAAGRVVGLQGENEEQNVGIKLALRAMEAPLRQIVANA
FT                   GEEASVIASAVKNGEGNFGYNAGTEQYGDMIAMGILDPTKVTRSALQFAASVAGLMITT
FT                   ECMVTELPKDDKADLGAAGMGGMGGMGGMM"
FT   gene            complement(540006..540863)
FT                   /locus_tag="D11S_0601"
FT   CDS_pept        complement(540006..540863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0601"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82007"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547874.1"
FT                   /protein_id="ACX82007.1"
FT                   /translation="MTAQIISGTELSHQIKTHIARQIAHYVERGKRSPGLAVILVGADP
FT                   ASQVYVGSKRRSCTEVGIVSKSYDLPENTSEQELLGIIEQLNQDKDVDGILVQLPLPKH
FT                   IDSTKVIEKISSEKDVDGFHPYNVGRLCQRIPTLRACTPYGVMKLLETTGIAFRGKHAV
FT                   IVGASNIVGRPMALELLLAGCTVTVTHRFTEDLAHHVRQADIVVVAVGKPRFIKGEWIK
FT                   EGAVVVDVGINRIDGKLVGDVEFDVAAERAAYITPVPGGVGPMTVAMLMQNTLSAYEKH
FT                   ENLG"
FT   gene            541020..541096
FT                   /locus_tag="D11S_0602"
FT   tRNA            541020..541096
FT                   /locus_tag="D11S_0602"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:541054..541056,aa:Pro,seq:tgg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            541130..541206
FT                   /locus_tag="D11S_0603"
FT   tRNA            541130..541206
FT                   /locus_tag="D11S_0603"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:541164..541166,aa:Arg,seq:tct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(541280..542047)
FT                   /locus_tag="D11S_0604"
FT   CDS_pept        complement(541280..542047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0604"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82008"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005544519.1"
FT                   /protein_id="ACX82008.2"
FT                   /translation="MAKMPRSTFYYQQVKHDYREIKETILLRYKRNRKRDGYRPMTLKL
FT                   RQMGFHLNHKTVLKLMNALGIHSILRKKRHGKRGKTSHIAPNVLNRDFTATRSIKMGND
FT                   VTEFRVGEEKLYFSPLMDLANREIIAYNFAKRPKFSLVKRMPEEGLGKLKPSECPIIHS
FT                   DQGVLYGSAEWVKMLEGKAIQSMSRRGNCYDNAVIESFFAILKSECFYSRTYTSIAELQ
FT                   AEIEEYLVYYNQERIKLDLKGLSPVQYRAQYLS"
FT   gene            complement(542080..542253)
FT                   /locus_tag="D11S_0605"
FT   CDS_pept        complement(542080..542253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0605"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82009"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010676239.1"
FT                   /protein_id="ACX82009.1"
FT                   /translation="MKKKAIEIPEQTDFSPKAFKKLQRELALARAQIAYLKELEALDRQ
FT                   KQRQKKEKSLKD"
FT   gene            complement(542194..542452)
FT                   /pseudo
FT                   /locus_tag="D11S_02420"
FT                   /note="transposase; disrupted"
FT   gene            complement(542525..542881)
FT                   /locus_tag="D11S_0607"
FT   CDS_pept        complement(542525..542881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0607"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82011"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578151.1"
FT                   /protein_id="ACX82011.1"
FT                   /translation="MDKTTGLTHLIKSTQYSMKGLKSAVKYETAFRHELFCCIFMIPLA
FT                   LWLGENAIERALMIGSVLLVLVVELLNSAIEAVVDRIGTERHELSGRAKDQGSAAVFVA
FT                   LVIVVVTWGLMLFN"
FT   gene            complement(542906..545137)
FT                   /gene="relA"
FT                   /locus_tag="D11S_0608"
FT   CDS_pept        complement(542906..545137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="D11S_0608"
FT                   /product="(p)ppGpp synthetase"
FT                   /EC_number="2.7.6.5"
FT                   /note="(p)ppGpp synthetase; catalyzes the formation of
FT                   pppGpp and ppGpp from ATP and GTP or GDP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82012"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564743.1"
FT                   /protein_id="ACX82012.1"
FT                   /translation="MVAVRGSHLLNPKDFEIEQWCANLNVADNIKTGLTACWHYSQQKI
FT                   ALRAEHHTEEAHLLSFGVEMVEILHSLNMDCDSLLTAMLFPIVNDQLVDFAQIEADFGA
FT                   NISKLAKGVIEMDNIRQLNVTHSASGLQVDNVRRMLLAMVDDFRCVIIKLAERIAFLRD
FT                   AVNNNYTEEQRVLAAKECANIYAPLANRLGIGQLKWELEDYCFRYLHPEQYRAIAKLLQ
FT                   ERRIDREQYIADFITELTGYLQENIQQVEVYGRPKHIYSIWRKMQKKNLEFSELYDVRA
FT                   VRIIVQKLQDCYTALGIVHTHFKHLPKEFDDYVANPKPNGYQSIHTVVLGKGGKPIEVQ
FT                   IRTQQMHDDAELGVAAHWKYKEGATAGRSGYAEKIAWLRKLLAWQDDITDSGEVMAELR
FT                   SQVFDDRVYVFTPKGEVVDLPTGSTPLDFAYAIHSEIGHRCIGAKVGGRIVPFTYQLQM
FT                   GDQVDIITQKNPNPSRDWLNPNLGFTHTAKSRAKIHAWFKKQDRDKNIPAGKELLESEI
FT                   NRLGISLKQVEQQALPRYNLKNLDDLYAGIGGGDIRISPLINFLQNKFIKTSAQEVDEE
FT                   ILRHVSNKSAVNSQQKSERKDCVIVEGVGNLMHHIARCCQPIPGDSIVGYITMGRGISI
FT                   HCCDCDQFLELQAAHPERVVESRWGDNYSSGFYLNIRIVASDRNGLLRDITTVLANEKI
FT                   SVLGVSTHTDSKRQVANIDMQIELNNVEMLSKILSRLEKLDDVIEAKRL"
FT   gene            complement(545147..546463)
FT                   /locus_tag="D11S_0609"
FT   CDS_pept        complement(545147..546463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0609"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82013"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588194.1"
FT                   /protein_id="ACX82013.1"
FT                   /translation="MALLYSGTKPKKNTANFTAHILDLDYQGLGVAKMNGKTWFIENAL
FT                   PQESVEVRVLEEKRQYGHGIAQRILHPSPQRQTPLCTYFTQCGGCQNQHIPIELQRSAK
FT                   QKALIQRLSRLQPEPIQFMPLLQGEPWHYRRRVRLSVGFDSKTRKLSIGLRRKNAQQII
FT                   PIEHCPVLEQPLNDLLPKLTALFAQWSAPQQLGHIELVAADNGVAMLLRHIKNVAENDR
FT                   TLLLKFAEQHNLMLFVQELDAIEHWHGEQPFYRLDNDLTLQFDIRDFIQINAELNRQMI
FT                   NTALDWLALNEREHVLDLFCGMGNFTLPIARRVKSAVGIEGVSAMVEKARRNAERNRCH
FT                   NVQFYQADLDKSFVNQGWAQQPFNKILLDPPRTGAAFALNALCQLQAENILYVSCNPAT
FT                   LVRDTEILRNAGYQLDKVAMIDMFPHTGHLESISLFRKK"
FT   gene            complement(546465..547151)
FT                   /gene="recO"
FT                   /locus_tag="D11S_0610"
FT   CDS_pept        complement(546465..547151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="D11S_0610"
FT                   /product="DNA repair protein RecO"
FT                   /note="involved in DNA repair and RecFOR pathway
FT                   recombination; RecFOR proteins displace ssDNA-binding
FT                   protein and facilitate the production of RecA-coated ssDNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82014"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574288.1"
FT                   /protein_id="ACX82014.1"
FT                   /translation="MLHRKSYSETSLLIDLLTEDFGRISVLAKGARAKRSMLKGVLQPF
FT                   TPLLLRWSGRGELKILTKAEPAAIALPLQNIALYSGFYLNELLCRVLEPETAYPQLFQQ
FT                   YLQCLTQLAMNQQQVEPALRTFEFQLLRTLGYGIDFTHCAGSGNTVEADMTYRYREEKG
FT                   FIASLIKDNLTFYGRELLAFEQTRFDDPSILVAAKRFTRIALKPYLGDKPLKSRELFTQ
FT                   HSLYSK"
FT   gene            complement(547448..548296)
FT                   /gene="tsf"
FT                   /locus_tag="D11S_0611"
FT   CDS_pept        complement(547448..548296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="D11S_0611"
FT                   /product="elongation factor Ts"
FT                   /note="EF-Ts; functions during elongation stage of protein
FT                   translation; forms a dimer; associates with EF-Tu-GDP
FT                   complex and promotes exchange of GDP to GTP resulting in
FT                   regeneration of the active form of EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82015"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006719481.1"
FT                   /protein_id="ACX82015.1"
FT                   /translation="MAEITASLVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVIIARVQNGFGVVVELNCETDFVAKDAGFLGLANEVADYAVAHK
FT                   GTSIEQLQAEFEEKRAALVAKIGENMTIRRVAYIEGDVVGSYLHGAKIGVLVAGKGADD
FT                   ELLKHIAMHIAASRPDYVNPSDVPADVVEHERNIQVDIAMQSGKPREIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMVPSKSVGDLLKEKGAEVSNFIRLEVGEGIEKVETDFAAEVAAMSK
FT                   A"
FT   gene            complement(548451..549173)
FT                   /locus_tag="D11S_0612"
FT   CDS_pept        complement(548451..549173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0612"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82016"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005559363.1"
FT                   /protein_id="ACX82016.1"
FT                   /translation="MAQVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGPRNGVHIINLEK
FT                   TVPMFNAALAELTRIASNNGKVLFVGTKRAATDAVQAAALECQQYYVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRSREMEKLELSLGGIKDMGGLPDALFV
FT                   IGADHEHIAVKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAARAIQLYLASAVAAIK
FT                   EGRGNEEAVAEELAQAAE"
FT   gene            complement(549248..549637)
FT                   /locus_tag="D11S_0613"
FT   CDS_pept        complement(549248..549637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0613"
FT                   /product="RssA protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82017"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546224.1"
FT                   /protein_id="ACX82017.1"
FT                   /translation="MFGVNLPSKQKGRVALQQKYLNDKRYMGFHSLFTTGNIVNKDFTL
FT                   YQLPFELDIFDQDEFARAGIDFSCFRSVDIYHRRGTSDKSLSIYPRQKIRWKPTALYGI
FT                   KHAVILLFKNNVQFLIKLTKTHTYQ"
FT   gene            complement(549756..550643)
FT                   /locus_tag="D11S_0614"
FT   CDS_pept        complement(549756..550643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82018"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542896.1"
FT                   /protein_id="ACX82018.1"
FT                   /translation="MAYALLTAQQDDIICPLSHYTLIEMAGVDAEKYLQGQLTCDVTKL
FT                   AAGESTLTAHCDPKGKMSALFRLIRQDEQTFYMLLKSELLPSALDQLKKYAVFSKVTFT
FT                   PLDWQIIGAAGAKGIEKYGQISAQIRVAVNDRQPRVILLNPTRLSIEPTAEANVWDLLD
FT                   IQDGVPGLAVATQLQFIPQALNLQSIEQAISFHKGCYIGQETVARAKYRGANKRALFIF
FT                   AAQTESLPDIGSPLEMALGDNWRCTGTIISAVNFHDVLWLQAVLNTPLEDGQAFRLPDS
FT                   QTTLTLQPLPYELS"
FT   gene            complement(550671..551534)
FT                   /locus_tag="D11S_0615"
FT   CDS_pept        complement(550671..551534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82019"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167593.1"
FT                   /protein_id="ACX82019.1"
FT                   /translation="MIYSMTAFAALEIKKDWGNAVWEIRSVNQRYLETFFRLPEQFRSL
FT                   ENTLRESLRQKLTRGKIECTLRIDNKKQTAAELHINQELAGQVLQSLQWLKQQAGEGEF
FT                   NLTDVLRYPGVVEVPEQDVDLISQDLLAAFEQVVGEFIAMRQREGEKIHTLLEQRLDAI
FT                   NVEQQKVRSKMPEILQWQRERMLQRFEEIQLQPDPQRLEQELIMLAQRIDVAEELDRLQ
FT                   LHVKETQNILRKGGAVGRKLDFMMQELNRESNTLASKSINVDVTNSAIELKVLIEQMRE
FT                   QIQNLE"
FT   gene            551652..552368
FT                   /gene="rph"
FT                   /locus_tag="D11S_0616"
FT   CDS_pept        551652..552368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="D11S_0616"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="RNase PH; tRNA nucleotidyltransferase; forms
FT                   hexamers in Bacillus subtilis; phosphoroltic 3'-5'
FT                   exoribonuclease; involved in maturation of tRNA precursors
FT                   and removes terminal nucleotides near CCA acceptor arms of
FT                   mature tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82020"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542903.1"
FT                   /protein_id="ACX82020.1"
FT                   /translation="MRPNQRANHQPRPIQITRHYTKHAEGSVLVEFGDTKVLCTASVEE
FT                   SVPRFLKGQGQGWVTAEYGMLPRSTHSRMQREAAKGKQGGRTLEIQRLIARSLRAMVDL
FT                   EALGERCITLDCDVIQADGGTRTASITGACVALCDALNSLVTNGTLAKNPLKGLVAAIS
FT                   VGIVNGEAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGKPFSHEELLTLLDLAK
FT                   QGCDMIFQTQRATLAE"
FT   gene            552378..553022
FT                   /gene="pyrE"
FT                   /locus_tag="D11S_0617"
FT   CDS_pept        552378..553022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="D11S_0617"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="involved in fifth step of pyrimidine biosynthesis;
FT                   converts orotidine 5'-phosphate and diphosphate to orotate
FT                   and 5-phospho-alpha-D-ribose 1-diphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82021"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546215.1"
FT                   /protein_id="ACX82021.1"
FT                   /translation="MENYKQQFIEFALARQVLKFGEFTLKSGRVSPYFFNAGLFNQGAD
FT                   LARLGEFYAAALQAGGLQYDVIFGPAYKGIPIATTVSIALFNCFNVNKPVCFNRKEAKD
FT                   HGEGGNLIGSPLQGKVLLVDDVITAGTAIRESMQIIQANGAQLSAVLIALNRQERGNGE
FT                   LSAIQEVERDYQCNVLSIVDFADLMAFIKTQPEYQQYLPAMRAYRAQYGIK"
FT   gene            553104..553979
FT                   /locus_tag="D11S_0618"
FT   CDS_pept        553104..553979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0618"
FT                   /product="molecular chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82022"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005568247.1"
FT                   /protein_id="ACX82022.1"
FT                   /translation="MNFIGKFLGALIGFRLGGFFGMLTGIFLGHLADKKLYELGTVNSS
FT                   FFKNKTTRQLLFMQTTFAVLGHISKAKGRVTENDIQLANHLMNQLQLDDAGRRLAQDAF
FT                   NRGKQADFPIRQVIREFRIGCGQRADLLRMFLHVQVQAAFADDHLHENEKELLFVVAEE
FT                   LGLSRFQFEQMLAMEMAARQFSRGGYYQQGGYQQGSYQQSGYQYNDYQQHSYGQSSGPT
FT                   LDDAYKVLGVGANDDQNTVKRAYRRLMNEHHPDKLVAKGLPPEMMEMAKEKAQQIQAAC
FT                   DLICKAKGWK"
FT   gene            553983..554987
FT                   /locus_tag="D11S_0619"
FT   CDS_pept        553983..554987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0619"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82023"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574291.1"
FT                   /protein_id="ACX82023.1"
FT                   /translation="MRVILAPMQGVLDPLVRQLLTEVNDYDLCISEFVRVVDQRLPPKV
FT                   FYRLCPELHQRGFTPSGTPVRVQLLGQHPQWLAENAELAVQLGSHGVDLNCGCPSKTVN
FT                   GSNGGASLLKQPELIYQATKAIRLAVPQHHTVSVKVRLGWDSTEFAYDIADAVQQGGAT
FT                   EIAIHGRTKTDGYRADRINWQKIGEVRQKLKIPVIANGEIWRWADGQQCRDVTGCEDLM
FT                   VGRGALNIPNLSRVLKRNAAPLSWAEIMPILRKYAALENCHDSGFYHVARIKQWLQYLK
FT                   YEYAEAADLFEMVKRCDDGRKLKGILDSYYVDKKHLNNNPDLSKPGIRRLFIK"
FT   gene            complement(554973..556031)
FT                   /locus_tag="D11S_0620"
FT   CDS_pept        complement(554973..556031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0620"
FT                   /product="peptide ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82024"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702357.1"
FT                   /protein_id="ACX82024.1"
FT                   /translation="MQMNLPLLQIDHLNKYFGQTHVLHDISLQLNSGEILFLLGPSGCG
FT                   KTTLLRAIAGFEQPDSGEIRLKERLIFGANCNVPTQQRHLGYVVQEGVLFPHLNVYRNI
FT                   AYGLGNGKGNSPKERARVEQVMLLTGIVELAERFPHQLSGGQQQRVALARAIAPNPELI
FT                   LLDEPFSALDEHLRQKIRHDMLQALRQSGTSAIFVTHDRDEALRYADKIAVIQDGRILQ
FT                   IADPHTLYHAPQHLAAATFIGDAITLPATLNNASNAHCQLGDIPIIDKSGGHATGTLLL
FT                   RPEQFSLLKTPKKPTALFNAIVKQVEFRGKTTIAQIKVNGVEVNLEERYSEGLRVSEEV
FT                   EIYLYGEGLFYE"
FT   gene            complement(556047..557567)
FT                   /locus_tag="D11S_0621"
FT   CDS_pept        complement(556047..557567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0621"
FT                   /product="Fe3+ dicitrate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82025"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542915.1"
FT                   /protein_id="ACX82025.1"
FT                   /translation="MNRRLPFWLTILILLISLPLLLPFLYVVVRAIEVGWDRSIELLWR
FT                   PRMWELLSNTLLLMVCVTSGAITLGTFCAFLLERYRFWGKSFFQVSMTLPLCIPAFVSC
FT                   FTWISLTFRVEGFWGTIGIMTLSSFPLAYLPVAATLKRLDRSLEEVSFSLGKNLSYTFW
FT                   HAIFPQLKPAIGSSFLLIALHMLVEFGAVSILNYQTFTTAIFQEYEMSFNNSTAALLSA
FT                   VLMVICAFIVFGEIFFRGQQTLYNSGKGVVRPYPVKNLSGGKQALIIVFFMTILILSIG
FT                   IPFTMLIYWLIVGHSIESAVDFHAFFEAFSNSLVISALGTILTVVCALPLVWSAVRYRS
FT                   RLTIWIDRLPYLLHAVPGLVIALALVYFTINYAYSFYQTFLMVVIAYLMLYLPMAQTTL
FT                   RSSLEQISDKMEKVGQSLGRSHFYIFRTLTFPAILPGIAAAFALVFLNLMKELTATLLL
FT                   TPNDIKTLSIAVWEYTSDAQYAAATPYAVMLVLFSGIPVFLLKKYAFK"
FT   gene            complement(557648..558646)
FT                   /locus_tag="D11S_0622"
FT   CDS_pept        complement(557648..558646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0622"
FT                   /product="iron ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82026"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546204.1"
FT                   /protein_id="ACX82026.1"
FT                   /translation="MKINQFKLAALATALAFSTAAFADITVYSGQHKEGAKAVADAFTK
FT                   ETGIKVTLNSAKSEQLAGQLKEEGDKTPADVFYSEQTAPFAALSEAGLLEPLSAETIKQ
FT                   TEYKGVPVAPKKDWIALSGRSRVVVYDKNKLSEKDMEKSVLDYATPKWKDKIGYVPTSG
FT                   AFLEQVIAITKLKGEKAALDWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYA
FT                   LAKEKGEDKLNSRLYFIRHQDPGALVTYSGAAVLKGSKNKEEAKKFVDFLAGKKGQEAF
FT                   TAVRAEYPLRPDVHSPFNMEPYAKLEAPEVSATTAKDRKNANKLIEQAGLK"
FT   gene            complement(558865..559206)
FT                   /locus_tag="D11S_0623"
FT   CDS_pept        complement(558865..559206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82027"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546203.1"
FT                   /protein_id="ACX82027.1"
FT                   /translation="MAIKRNQRQRKKMHLAEFQELGFLVQWQFAEGTSVEQIDNTVDRF
FT                   ISEVIQPNGLAYEGSGYLHWEGLVCLEKIGKCDASHQELVKNWLTQNGLQQVEVSELFD
FT                   IWWDYPAKD"
FT   gene            complement(559237..560004)
FT                   /locus_tag="D11S_0624"
FT   CDS_pept        complement(559237..560004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0624"
FT                   /product="tRNA (guanine-N7)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82028"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578123.1"
FT                   /protein_id="ACX82028.1"
FT                   /translation="MLETQSSDSIQPTFADQKRKTVESAEFTADGRYKRKVRSFVLRTG
FT                   RLSDYQKNAMNQNWATFGLDYQPQPFDFQAIYGNDNPVILEIGFGMGSSLVEMAAQNPD
FT                   KNYLGIEVHTPGVGACIAYAVEKGVTNLRVICHDATEILRDSIGNHSLGGLQLFFPDPW
FT                   HKARHHKRRIVQPHFIDGLLNKLHEGAFIHMATDWQDYAEHMLEVLSQYPQLRNTSVAN
FT                   DYIPRPDFRPLTKFEQRGHRLGHGVWDLYFVKS"
FT   gene            560221..561360
FT                   /locus_tag="D11S_0625"
FT   CDS_pept        560221..561360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0625"
FT                   /product="adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82029"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578120.1"
FT                   /protein_id="ACX82029.2"
FT                   /translation="MPAQSSSNAPFAHAVLTWYAKFGRKNLPWQQNKTLYGVWLSEVML
FT                   QQTQVTTVIPYFERFVKTFPNLTALANAPLDEVLHLWTGLGYYARARNLHKAAQIMRDQ
FT                   HGGEFPTEFEQVWALPGVGRSTAGAVLSSCLNAPYPILDGNVKRVLSRYFAVSGWPGEK
FT                   KTEDHLWHLTAQVTPTEQVADFNQAMMDIGAMVCTRSKPKCELCPLKSDCKANAEQNWQ
FT                   VYPGRKPKKVLPERESYFLLLEKDGKIALEQRDNAGLWGGLYCFPQFSEKQELLAYLAA
FT                   NGIRQYQEWTAFRHTFSHFHLDIYPIYAQVDTPKALAEENRSHRQKVAETAGEYQSDLL
FT                   SAVKYWYDPQNPEPIGLAAPVKNLLTQYVRNHYGKNGVL"
FT   gene            561338..561616
FT                   /locus_tag="D11S_0626"
FT   CDS_pept        561338..561616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0626"
FT                   /product="iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82030"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542927.1"
FT                   /protein_id="ACX82030.1"
FT                   /translation="MARMVFCERLKQEAEGLDFQLYPGELGKRIFDSISKQAWGEWMKK
FT                   QTMLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYTPPEAKE"
FT   gene            561619..562698
FT                   /gene="mltC"
FT                   /locus_tag="D11S_0627"
FT   CDS_pept        561619..562698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="D11S_0627"
FT                   /product="murein transglycosylase"
FT                   /note="Murein hydrolase C; membrane-bound; lytic; catalyzes
FT                   the cleavage of the beta-1,4-glycosidic bond between
FT                   N-acetylmuramic acid and N-acetylglucosamine residues"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82031"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542929.1"
FT                   /protein_id="ACX82031.1"
FT                   /translation="MKKYLILALIPFLYACGGGMSYKKGLDYDEAFAKDTRGLDILTGQ
FT                   FANNIDRIWGVNELLVASRKDYVKYTDRYYTRSHVSFDEGLITIETQADLNRLHNAIVH
FT                   TLLMGSDANGIDLFTSGDVPISSRPFLVGQVIDNQGESIIDQFTAGNFATYLIRNKLQT
FT                   RRLANGHQVQFVVIPMIANHVEVRAQKYLPIVRKVARHYGLDESLILGIMQTESSFNPY
FT                   AISYANAMGLMQVVPHTAGRDVFQMKGMSGQPSKAYLFDPEKNIDTGASYLWLLQNKYL
FT                   DGITNPTSKRFAMISAYNSGAGAVLRVFNDDKDVAIMQINRLYPEQIYRILTTNHPSAQ
FT                   ARNYLVKVDKAQKSYRVRR"
FT   gene            562904..562979
FT                   /locus_tag="D11S_0628"
FT   tRNA            562904..562979
FT                   /locus_tag="D11S_0628"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:562937..562939,aa:Phe,seq:gaa)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            562984..563059
FT                   /locus_tag="D11S_0629"
FT   tRNA            562984..563059
FT                   /locus_tag="D11S_0629"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:563017..563019,aa:Asn,seq:gtt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(563199..563792)
FT                   /locus_tag="D11S_0631"
FT   CDS_pept        complement(563199..563792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82033"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590416.1"
FT                   /protein_id="ACX82033.1"
FT                   /translation="MKFKMKSLTLGAVLLSGVLLTGCQSEPNTLTFTLAPPKASMNVNQ
FT                   SAVVYVTTRDLRNTPEISSYVKDGQLLKLSASPELTQLFQQIEQQDLVSKGFRIGMANN
FT                   SNAAVTVDIQQFYAKVNQGNLRYDIDSKIQLAIHVQGRRGQFTKNINAGRTHSGAFFAR
FT                   NWEIQKVLGETFNEVVESIYKDQEVANAINQYAN"
FT   gene            563896..564207
FT                   /locus_tag="D11S_0632"
FT   CDS_pept        563896..564207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0632"
FT                   /product="BolA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82034"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542935.1"
FT                   /protein_id="ACX82034.1"
FT                   /translation="MTKQQELEQRLRQEFRPHFIAVENESYMHSSGRGADSHFKVVLVS
FT                   DVFEGIGKVARHRKIYQFLVQDLQQGIHALALHLYTLSEWKALGQQFPKSPNCTGVGQ"
FT   gene            564563..565903
FT                   /locus_tag="D11S_0635"
FT   CDS_pept        564563..565903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0635"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit A"
FT                   /note="uses the energy from reduction of ubiquinone-1 to
FT                   ubiquinol to move Na(+) ions from the cytoplasm to the
FT                   periplasm"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82037"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005586439.1"
FT                   /protein_id="ACX82037.1"
FT                   /translation="MITIKKGLDLPIAGKPEQVIRDGNAVSEVALLGEEYVGMRPSMKV
FT                   REGDVVKKGQVIFEDKKNPGVVFTAPAGGMITAIHRGEKRVLQSVVIKIEGDAALSFDK
FT                   YPAAELSALTAEQVRKNLQESGLWTAFRTRPFSKVPAVDSIPSSIFVNAMDTNPLAADP
FT                   SVVIAEAENDFVNGLTVLSRLHEGNIHLCKAPDNKIPGSHASNVIVNEFSGPHPAGLSG
FT                   THIHFIDPVGIQKTVWYINYQDVIAIGRLFTTGELYTERVISLAGPQVKKPRLVRTVIG
FT                   ANLSQLTKDEISAGENRVISGSVLCGNTAKGAHDYLGRYALQVSVIAEGNEKELFGWIT
FT                   PQPNKYSITRTVLGHFSKKLFNFTTAENGGERAMVPIGSYERVMPLDILPTLLLRDLIA
FT                   GDTDGAQALGCLELDEEDLALCSFVCPGKYEYGSILRQALDKIEKEG"
FT   gene            565906..567141
FT                   /locus_tag="D11S_0636"
FT   CDS_pept        565906..567141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0636"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit B"
FT                   /note="uses the energy from reduction of ubiquinone-1 to
FT                   ubiquinol to move Na(+) ions from the cytoplasm to the
FT                   periplasm"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82038"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574303.1"
FT                   /protein_id="ACX82038.1"
FT                   /translation="MGLKSLLEKMEPAFLPGGKYSKLYPIFESIYTLLYTPGTVTHKNT
FT                   HVRDALDSKRMMITVFLALFPAIFYGMYNVGNQAIPALNQLGNLEQLISSNWHYALANG
FT                   LGLDLTLNAGWGSKMALGAIFFLPIYLVVFTVCTIWELLFSVVRGHEVNEGMFVSTILF
FT                   ALIVPPTLPLWQAALGISFGIVVAKEIFGGVGRNFMNPALAGRAFLFFAYPAQISGDLV
FT                   WAAADGFSGATALSQWSQGGQDALQHTVTGQSISWMDAFIGNIPGSMGEVSTLAILIGG
FT                   AIIVFTRIAAWRIIAGVMIGMIATSTLFNLIGSETNHMFSMPWYWHLVLGGFALGMVFM
FT                   ATDPVSASFTNTGKWWYGALIGVMAVLIRTINPAYPEGMMLAILFANLFAPIFDYIVVQ
FT                   ANIKRRRARTNG"
FT   gene            567134..567919
FT                   /locus_tag="D11S_0637"
FT   CDS_pept        567134..567919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0637"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82039"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012771762.1"
FT                   /protein_id="ACX82039.1"
FT                   /translation="MAKFNKDSVSGTVTVVVLLSLVCSIVVSGAAVALKSKQDEQKALD
FT                   VQRNILTVAGLMKEDNASVIKETYNKFIEPRLVDLQSGDFVQATKEEAEKFDPKAAIKD
FT                   TALSQPIPADQDKAGLKVRAKQAVVYLVKDEQGTVNQVVLPMYGRGLWSTMYGFVSVAP
FT                   DANTIKGITYYDQGETAGLGGEIANPRWQAFFVDKKLFDDNQNVAIRIAKNASSDKEHG
FT                   IDALSGATLTSNGVQGSFDYWFSQNGFGPFLAKFKAGAR"
FT   gene            567919..568548
FT                   /locus_tag="D11S_0638"
FT   CDS_pept        567919..568548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0638"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /note="Part of the NQR complex which catalyzes the
FT                   reduction of ubiquinone-1 to ubiquinol by two successive
FT                   reactions, coupled with the transport of Na(+) ions from
FT                   the cytoplasm to the periplasm"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82040"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590427.1"
FT                   /protein_id="ACX82040.1"
FT                   /translation="MADAKSNLRALLLDPIAKNNPIALQILGICSALAVTTQLQTALVM
FT                   AIAVCLVTGFSSMFIAMIRNYIPNSIRIIVQLAIIASLVILVDQVLKAFAYGLSKQLSV
FT                   FVGLIITNCIVMGRAEAFAMKSRPLESFVDGIGNGLGYGAILLIVATLRELIGSGRLFG
FT                   FPILQTIQDGGWYQPNGLFLLAPSAFFIIGFVIWGVRTWKPEQQEK"
FT   gene            568552..569148
FT                   /locus_tag="D11S_0639"
FT   CDS_pept        568552..569148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0639"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit E"
FT                   /note="Part of the NQR complex which consists of NqrA,
FT                   NqrB, NqrC, NqrD, NqrE and NqrF; NQR complex catalyzes the
FT                   reduction of ubiquinone-1 to ubiquinol by two successive
FT                   reactions, coupled with the transport of Na(+) ions from
FT                   the cytoplasm to the periplasm; NqrE is probably involved
FT                   in the second step, the conversion of ubisemiquinone to
FT                   ubiquinol."
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82041"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005695377.1"
FT                   /protein_id="ACX82041.1"
FT                   /translation="MEHYISLFVKAIFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAV
FT                   VVVLGIAVPANQFVYEHVLKESALVEGVDLSFLNFITFIGIIAGLVQLLEMTLDKFFPA
FT                   LYNALGIFLPLIAVNCAIFGGVSFAIQREYTFAESAVYGIGAGLGWMLAIVALAGLTEK
FT                   MKYSDVPAGLRGLGITFISAGLMALGFMSFSGIQL"
FT   gene            569160..570395
FT                   /locus_tag="D11S_0640"
FT   CDS_pept        569160..570395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0640"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit F"
FT                   /note="uses the energy from reduction of ubiquinone-1 to
FT                   ubiquinol to move Na(+) ions from the cytoplasm to the
FT                   periplasm"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82042"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005702832.1"
FT                   /protein_id="ACX82042.1"
FT                   /translation="MSETTILLLGVAAFTAIVLVLVAIILFAKSKLVDSGDITIKINDD
FT                   PSKAITLPAGGKLLSALAGKGIFVSSACGGGGSCGQCVVRVKSGGGEILPTELSHITKR
FT                   EAKEGYRLSCQVNVKGNMDIELPEEIFGVKKWECTVISNDNKATFIKELKLAIPEGEEV
FT                   PFRAGGYIQIEAEPHTVYYKDFDIPQEYHEDWNKYDLWRYVSKVDKHIIRAYSMASYPE
FT                   EKGIIMLNVRIATPPPRQPDAPPGQMSSYIWSLKPGDKVIISGPFGEFFAKETDAEMVF
FT                   IGGGAGMAPMRSHIFDQLKRLHSKRKMSFWYGARSKREMFYVEDFDTLQAENPNFQWHV
FT                   ALSDPLPEDNWTGYTGFIHNVLYENYLKNHEAPEDCEYYMCGPPVMNAAVIKMLKDLGV
FT                   EDENILLDDFGG"
FT   gene            570546..571634
FT                   /locus_tag="D11S_0642"
FT   CDS_pept        570546..571634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0642"
FT                   /product="thiamine biosynthesis protein ApbE"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82044"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546180.1"
FT                   /protein_id="ACX82044.1"
FT                   /translation="MNIKQPLVRGFALAAMALALMACDKPNPSQQADTQQAMAAKNEIV
FT                   SLTGKTMGTTYHIKYSNNGEVSTASQQAHEQIELILKDVNAKMSTYIKDSELSRFNQNT
FT                   QINTPIEISADLAKVVKEAIRLNQVTQGALDITVGPVVNLWGFGPEKRVDKRPTSAQIA
FT                   ERQAWVGIDKLSLTEEGGKFFLAKAVPQLYVDLSSIAKGFGVDQVADYLESIRVQNYMV
FT                   EIGGEIRAKGKNAEGKAWQIAIERPTLDGKQVAQQVIGLNNMAMATSGDYRNYFEQDGV
FT                   RFSHEIDPHTGYPIQHALASITVLAPTSMTADGLSTGLFVLGEQKALDVAEQEKLPIFM
FT                   IIKDSKGYRTEMSTTFKQFLAQ"
FT   gene            571713..571970
FT                   /locus_tag="D11S_0643"
FT   CDS_pept        571713..571970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82045"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005571582.1"
FT                   /protein_id="ACX82045.1"
FT                   /translation="MKLFLLTLGIFLLIILAMALGYIVKRQALKGSCGGLSSLGIAKAC
FT                   DCDKPCDTLQSKLDAGDEQAKVEYEQKFTNNVQTQFYEVK"
FT   gene            572230..573381
FT                   /gene="mnmA"
FT                   /locus_tag="D11S_0644"
FT   CDS_pept        572230..573381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmA"
FT                   /locus_tag="D11S_0644"
FT                   /product="tRNA 2-thiouridylase"
FT                   /EC_number="2.8.1.-"
FT                   /note="catalyzes a sulfuration reaction to synthesize
FT                   2-thiouridine at the U34 position of tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82046"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005594798.1"
FT                   /protein_id="ACX82046.1"
FT                   /translation="MKSQTYENHFPKLTAQQLAENATKKIICGMSGGVDSSVSAFILQQ
FT                   QGYQVEGLFMKNWEEDDDTDYCTAAADLADAQAVCDKLGIKLHKINFAAEYWDNVFEHF
FT                   LSEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGANYIATGHYVRRRGADDNAQLLRGL
FT                   DNNKDQSYFLYTLSKTQVGQSLFPVGNIEKPIVRAIAEELGLVTAKKKDSTGICFIGER
FT                   KFKDFLARYLPAQPGNIRTVDGEIIGRHDGLMYHTLGQRKGLGIGGVKGAGEDAWYVVE
FT                   KDLINNELIVAQGHDHSALLSTGLIAQQLHWVDCLPIRAPLRCTVKTRYRQTDVPCIIE
FT                   PIDDETIKVIFDEPQIAVTPGQSAVFYLDEICLGGGIIEKQLK"
FT   gene            574019..575329
FT                   /gene="eno"
FT                   /locus_tag="D11S_0646"
FT   CDS_pept        574019..575329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="D11S_0646"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="catalyzes the formation of phosphoenolpyruvate from
FT                   2-phospho-D-glycerate in glycolysis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82048"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542971.1"
FT                   /protein_id="ACX82048.1"
FT                   /translation="MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVLKAVAAVNGPIADAIIGKDGLNQAEIDQIMIDLDGTDNKS
FT                   KFGANAILAVSLANAKAAAASKGLPLYAYIAELNGTPGVYSMPLPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTLREALRIGAEVFHNLAKVLKAKGLNTAVGDEGGFAPNLASNAEA
FT                   LACIKEAVEKAGYVLGKDVTLAMDCASSEFYNKETGKYEMKGEGRSFTSQEFTHYLEEL
FT                   TKQYPIVSIEDGQDESDWEGFAYQTKVLGDRVQLVGDDLFVTNTKILKEGIEKGIANSI
FT                   LIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMS
FT                   RSDRIAKYNQLIRIEEALERAGTPAPFPGLKAVKGQA"
FT   gene            complement(575425..575844)
FT                   /locus_tag="D11S_0647"
FT   CDS_pept        complement(575425..575844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0647"
FT                   /product="Holliday junction resolvase"
FT                   /note="similar to RuvC resolvase with substantial
FT                   differences; NMR structural information suggests this
FT                   protein is monomeric; unknown cellular function"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82049"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549562.1"
FT                   /protein_id="ACX82049.1"
FT                   /translation="MGITVLAFDFGTKSIGCAVGQSITGTAQSLPAFKAQDGIPNWDAI
FT                   EKCIQEWQPARIVVGLPLNMDGTEQPLTLRAKKFAKRLHGRFNVPVDLQDERLTTTEAR
FT                   SEIFSRGGYHALNKSKVDGISACLILESWFENYAG"
FT   gene            complement(575844..576404)
FT                   /locus_tag="D11S_0648"
FT   CDS_pept        complement(575844..576404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82050"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702356.1"
FT                   /protein_id="ACX82050.2"
FT                   /translation="MMDLQDHLLIAMPNLDDSYFYRTVIYICEHNEKGSMGLVLNQPTD
FT                   LSIAELGAKMNFMMVTHRTYNDKLVLAGGPVNIDRGFILHTNTKVPFDHSYRVSDNLML
FT                   TTSADVVDTFGTMLEPEKYLVTLGCASWEANQLEQEIMNNSWLVVPAAEQILFDLPYEQ
FT                   RWWAANQLLGIDSHNFAGQVGHS"
FT   gene            complement(576418..577152)
FT                   /locus_tag="D11S_0649"
FT   CDS_pept        complement(576418..577152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0649"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82051"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578088.1"
FT                   /protein_id="ACX82051.1"
FT                   /translation="MRVPRIYHPIPLNQHTTCALSEDGANHVGRVLRMRAGDQLELFDG
FT                   SNHIYQAVITAVAKKSVEVDILSRQFDDRESPLAIHLGQVISRGERMEFTIQKSVELGV
FT                   NVITPLWSERCGVKLDGERMDKKIQQWQKIAIAACEQCGRNKIPEIRPLMKLQQWCAEP
FT                   NDALKLNLHPRARYSIRTLPEIPAAGVRLLIGSEGGLSPQEIAQTEQQGFVDVLLGKRV
FT                   LRTETAAMAAITALQVCFGDLG"
FT   gene            complement(577239..577556)
FT                   /locus_tag="D11S_0651"
FT   CDS_pept        complement(577239..577556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0651"
FT                   /product="transcriptional repressor protein MetJ"
FT                   /note="when combined with S-adenosylmethionine represses
FT                   the expression of the methionine regulon and of proteins
FT                   involved in S-adenosylmethionine synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82053"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542035.1"
FT                   /protein_id="ACX82053.1"
FT                   /translation="MADWNGQYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQ
FT                   IRNLRHATNSELLCEAFLHAFTGQPLPTDEDLLKERSDEIPEEAKVIMRTLGIDPDNWE
FT                   Y"
FT   gene            complement(577710..578597)
FT                   /locus_tag="D11S_0652"
FT   CDS_pept        complement(577710..578597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0652"
FT                   /product="nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82054"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589413.1"
FT                   /protein_id="ACX82054.1"
FT                   /translation="MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAG
FT                   IKEIVLVTHSSKNAIENHFDTSFELETMLEKRVKRQLLEEVRSIVPKNVTIMHVRQGNA
FT                   KGLGHAVLCGRPLVGNEPFAVVLPDVLLAEFSANQKKENLALMLKRFKQTQASQIMVNP
FT                   VKPEEVSSYGIADCGGVEIPPGESAKIDSIVEKPSVDEAPSNLAVVGRYVFSATIWDLL
FT                   EKTPVGVGDEIQLTDAIDMLIDKETVEAFHMTGISYDCGDKIGYMKAFVEYGLHHNKLA
FT                   SEFKAYLKDLVKTF"
FT   gene            complement(578673..580037)
FT                   /locus_tag="D11S_0653"
FT   CDS_pept        complement(578673..580037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0653"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="capsular polysaccharide biosynthesis protein;
FT                   catalyzes the formation of D-mannose 6-phosphate from
FT                   alpha-D-mannose 1-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82055"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561965.1"
FT                   /protein_id="ACX82055.1"
FT                   /translation="MTKLTCFKAYDIRGRLGDELNTDIVYRIGHAFGQFLTPKTIVVGG
FT                   DVRLTSKELKSAVTNGLLDSGVNVIDLGETGTEEVYFATSFLKTDGGIEVTASHNPMDY
FT                   NGLKLVREGSRPISADTGLADIQRLAEENNFPPVTKRGEYKQLSVLDDYVEHLLSYINL
FT                   DSLKPLKLVINSGNGAAGHVIDAIEAQFKTKHIPVEFIKVHNNPDGTFPHGIPNPLLHE
FT                   NRQDTIDAVLKHKADMGIAFDGDFDRCFLFDEHANFIEGYYIVGLLGQAFLQKNQGAKI
FT                   IYDPRLIWNTVKLVEENGGEAVMSKSGHSFIKEKMRAVDAIYGGEMSAHHYFRDFFYCD
FT                   SGMIPWLLVMELVSVTGKSLSELVNNSVNTFPSPGEINSKLVDAKSAIARVLAAYEKDA
FT                   IRVDEIDGISIEYPNWRFNLRSSNTEPVVRLNLETRGDKQLMAEKTEEILALLRQ"
FT   gene            complement(580069..580251)
FT                   /locus_tag="D11S_0654"
FT   CDS_pept        complement(580069..580251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0654"
FT                   /product="carbon storage regulator"
FT                   /note="affects carbohydrate metabolism; has regulatory role
FT                   in many processes"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82056"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005559414.1"
FT                   /protein_id="ACX82056.1"
FT                   /translation="MLILTRKVGESLLIGDDVSITILNIRGNQVKIGVQAPKDVSIHRE
FT                   EIYQRIHQARDEQKA"
FT   gene            complement(580374..582998)
FT                   /locus_tag="D11S_0655"
FT   CDS_pept        complement(580374..582998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0655"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82057"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546159.1"
FT                   /protein_id="ACX82057.1"
FT                   /translation="MKTTAQIRQSYLDFFHSKGHQVVASSSLVPENDPTLLFTNAGMNQ
FT                   FKNVFLGLEKRPYSRATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQ
FT                   DAIHFGWEFLTSPQWLGLPKERLWVTVYETDEEAYKIWHDEIGIVAERIIRIGDNKGAP
FT                   YASDNFWQMGDTGPCGPCTEIFYDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQFNRHA
FT                   DGTMEKLPKPSVDTGMGLERISAVLQHVNSNYDIDIFQKLIAKTAELTGEKDLTNKSLR
FT                   VIADHIRSCAYLIVDGVVPSNEGRGYVLRRIIRRAVRHGHLLGAAEAFFYKLVPTLIEV
FT                   MAQAGEEVKKHQATVEKLLRLEEEQFARTLERGLTLLDEALAEVKGKVLSGEVAFKLYD
FT                   TYGFPLDLTADVCRERGITIDEAGFEREMENQRLRAQSASQFGMDYNNVIRVDGITRFE
FT                   GYTESETLAKVTALFHDGKPVDTISSGQSAVVILDNTPFYAESGGQIGDIGRLEGNGFN
FT                   FDVKDTQKYGQVFGHIGELTQGSLSVGQSVNAVVDEVRRQRISLNHSATHLLHAALRQV
FT                   LGEHVAQKGSLVSDALLRFDFAQHEPISKAQLAEVERIVNQQVRANNPIKTDIMELEAA
FT                   KAKGAMALFGEKYSDQVRVLTMGDFSIELCGGIHAKRTGDIGLFKIVTETAVAAGIRRI
FT                   EAITGETAIEWLQNQQSLLNQSAELLKSDVNSITDKISLLQDKFKKVEKELQTLKEKAA
FT                   LQAGNDLAQSAVKINGVSVIAQQLDGIEAKSLRSMVDSLKNQLGSAVIVFASVVDEKVN
FT                   LIVGVTQDLTGKVKAGELVNLMAQQVGGKGGGRPDMAMAGGTQPENVNKALSVCSDWLK
FT                   ANL"
FT   gene            complement(583198..583626)
FT                   /locus_tag="D11S_0656"
FT   CDS_pept        complement(583198..583626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0656"
FT                   /product="Universal stress protein A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82058"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005696761.1"
FT                   /protein_id="ACX82058.2"
FT                   /translation="MMYKHVLVAVDLSEESAFLLKKAVGVAKRYDAKLSIIHVDVNFSD
FT                   LYTGLIDVNMVSMQDRISSETQQALIKLAEQAGYPITEKLSGSGDLGQVLADAIDKYDV
FT                   DLLVTGHHQDFWSKLMSSTRQVMNSITVDMLVVPLRDE"
FT   gene            583805..584599
FT                   /locus_tag="D11S_0657"
FT   CDS_pept        583805..584599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0657"
FT                   /product="nucleoside triphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82059"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574313.1"
FT                   /protein_id="ACX82059.2"
FT                   /translation="MTYSIHDFTQLIAQLRDPEHGCPWDIKQTYQSMIPCLKEEAYEVI
FT                   EAIEQNNVENLKEELGDLLLQVVFLSQLAAEEKKFTFDQVVQDVAEKIVRRHPHVFGDK
FT                   HANNEQEALQNWNAMKAQEHQNQGYTSILDNIPHAFPALMRAEKLQKRCAKVGFDWKDI
FT                   APVFAKVEEELQEVKQEMERSPQDQQKIEEEMGDLLFATVNLSRHLKCQAEESLSKANQ
FT                   KFEQRFRRVEEKLKQQHRSLEDASLVEMDLLWDEVKQEEKHR"
FT   gene            complement(584697..585686)
FT                   /locus_tag="D11S_0658"
FT   CDS_pept        complement(584697..585686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82060"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578081.1"
FT                   /protein_id="ACX82060.1"
FT                   /translation="MTKNHVRSFKTYIRDEIIKKGGWVNAHAHADRAFTMTPEKIGIYH
FT                   SSNLQQKWDLVDEVKRTSSVDDYYARFCQSIELMISQGVTAFGTFVDIDPVCEDRAIIA
FT                   AHKAREVYKNDIILKFANQTLKGVIEPTARKWFDIGSEMVDMIGGLPYRDELDYGRGLD
FT                   AMDILLDKAKSLGIMCHVHVDQFNSPQEKETEQLCDKAIEHGMQGRVVAIHGISIGSHS
FT                   KEYRYRLYEKMRQAQMMMIACPMAWIDSNRKEELMPFHNALTPADEMIPEGITVAIGTD
FT                   NICDYMVPLCEGDMWQELSLLAAGCRFPDLDAMVNIASINGRKVLGID"
FT   gene            complement(585945..587684)
FT                   /locus_tag="D11S_0659"
FT   CDS_pept        complement(585945..587684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0659"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82061"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005559421.1"
FT                   /protein_id="ACX82061.1"
FT                   /translation="MWKFNSKQYREETSQKISWGHWFAFFNILWAIFIGARYAFIIDWP
FT                   DTLFGKVYFFISLLGHFSFIVFAFYLLVIFPLSFIVKNHRTFRGLTVILATISNTLLLV
FT                   DTEVFVRFNLHLSSLVWNLLVNPENGELSRNWQLFFVPMPLILLIQMLFSRWSWQKLRS
FT                   LERQKWLKGIGIFFVCTFSATHLIYAWADAYLYRPITMQRSNFPLSYPMTARSLLEKRG
FT                   FINKREYAERLAQEGRLDALAIEYPKKPLTFDEPTEKQNIILITISGLRYDAINEKSMP
FT                   NLARFTTDSTQFTNHYSSGNNNNAGLTGLFYGLNANYTDSLLSSKIPSALVEHITQQKY
FT                   VQGLFSGRKFNSSILRRAIYQQTKLIGDTSNQGAVNAFQHWLETAKTQEKPFWGYLSLD
FT                   IKPNLSPENYAQERTKIDELLGQILPQLDLPNTLVIITAEHGYTFRQLTEKEENRYFAQ
FT                   DKVRVPMIVHWQGLAKGKVTKLTSHVDVLPALMKHVFKVRNPIGDYAQGRDLFDLNQTP
FT                   DWVLVSNYRWNVIIQPDGTQYHIDTRGNYQKYDRTYQKISSKRPPLGLFLEVFNQERSF
FT                   LEK"
FT   gene            complement(587689..587913)
FT                   /locus_tag="D11S_0660"
FT   CDS_pept        complement(587689..587913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82062"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546151.1"
FT                   /protein_id="ACX82062.1"
FT                   /translation="MAIQSKYQDKQIDEILNDMIAVLEKHQAPLDLSLIVLGNMTTNLL
FT                   LGSVGKQQRQVLAKAFSDALLNSLNTTNQ"
FT   gene            588040..589065
FT                   /locus_tag="D11S_0661"
FT   CDS_pept        588040..589065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0661"
FT                   /product="nucleoid-associated protein NdpA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82063"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578075.1"
FT                   /protein_id="ACX82063.1"
FT                   /translation="MSITVKQIILHQITKSNQTEAESVPQLNSVLRKQVLTITPEVEQM
FT                   MLQLHQGYQNKAKGYGIFLDSSVFAQSLNRLLENELEFLPFSYEATNLLINELGKYNFA
FT                   DSGTLVLCQYNFLATDYLFIALLDSRVSMLVDDKLEIQRTEYLDITQFDVAARINLTDL
FT                   QLNANSNRYLTFIKGRVGRKIADFFMDFLGAEEGLNPQVQNQCLLQAVSDYCAQGELNR
FT                   EQTQAVKKQVFEYCKGQINSGEEIELAELSGELPTLNQQPFAEFTQAQNYGLEENIPPV
FT                   RTALKSLTKFSGSGKGVTISFDAELINQRIFWDEAADTLTIKGLPPNLRDQLQRQLKEQ
FT                   N"
FT   gene            589131..589544
FT                   /locus_tag="D11S_0662"
FT   CDS_pept        589131..589544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0662"
FT                   /product="membrane protein SmpA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82064"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005559427.1"
FT                   /protein_id="ACX82064.1"
FT                   /translation="MQFRSVVTALIFALSVTACSTVNKVVYRIDVPQGNYLEASKVTQL
FT                   KTGMTAQQVQYLLGTPVLIDPYSNHTWYYVYLQQKAYETPEQHTLVVNFDQNGAVSNFD
FT                   LDKPLPNDDKVEVNNTIITAPDAQAKRWWQFWK"
FT   gene            589586..590281
FT                   /locus_tag="D11S_0663"
FT   CDS_pept        589586..590281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0663"
FT                   /product="transcriptional regulator"
FT                   /note="response regulator in two-component regulatory
FT                   system with CpxA; part of the envelope stress response
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82065"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012771831.1"
FT                   /protein_id="ACX82065.1"
FT                   /translation="MAKILLVDDDAELTELLAQLLDLEGFQVNVANNGKEALELLDHSY
FT                   DLILLDIMMPVLNGIETLKQIRKNYSTPVMMLTARGDDIDRILGLELGADDYLPKPFND
FT                   RELVARIKAILRRTAQANNAKDPTDVDKIEFGGIVFYPGRQQAMLGSKDLELTGTEFAL
FT                   LLKLITHPGLILTREELSLEVLGKPLTPFDRAIDMHMSNLRKKLPARSDDLPWFKTLRG
FT                   RGYLLIAEK"
FT   gene            590326..591714
FT                   /locus_tag="D11S_0664"
FT   CDS_pept        590326..591714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0664"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82066"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542016.1"
FT                   /protein_id="ACX82066.1"
FT                   /translation="MFRKEFIFNSLTIRIFTFFWLTFSILLIFIFLLPYFDAHIYSDLK
FT                   EHEMVKYQKEITTSMRNNQISRILAGIPSFPNDRFTPHPVLISPSGQILGALTEEEKSV
FT                   RQFIFNNASLDQPLKKIYSNIQIVGPFSLYLNPEHNQSYSLYFVNQINAQKEILNYIFD
FT                   RPFFLIILVILISTPLLWWLSRSIGQPIRNLQLAANAVAIGNLKINKNLETKGLIELRQ
FT                   VGQSFNRMMLSLEEVLSNQQSLLSSISHELRTPLTRLQLATALLRRRLGDSNEIQRIDT
FT                   EAQRLDKMVSDLLQLSRQQLNSHLEKDIFPIPLLWKEILEDAKFEAAQRNIRFHVEQGI
FT                   AHPEQYYLNGNHGLLASAVENIVRNALKYTKSAISVHIYTHENDLFIRIEDNGAGLPED
FT                   EYEKIFKPFYRVDETRTRETGGTGLGLSIVANTAKDHHGAVWAGKADLGGLAVILRLPL
FT                   WVAK"
FT   gene            complement(591770..592978)
FT                   /locus_tag="D11S_0665"
FT   CDS_pept        complement(591770..592978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0665"
FT                   /product="sodium:glutamate symporter"
FT                   /note="is involved with the sodium-dependent uptake of
FT                   glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82067"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588866.1"
FT                   /protein_id="ACX82067.1"
FT                   /translation="MTFNTFETLALAGFVLLLGYFLVKRISLLKSYNIPEPVVGGFLVA
FT                   IILTVLYQGWGLSFMFDTNLQFTMMLVFFSSIGLSANFARLVKGGKPLIIFVIAATLLI
FT                   TVQNIVGVTGSVLLGIDPAYGLIAGSVTLTGGHGTGAAWASKLTELFHLEGALELAMAC
FT                   ATFGLVSGGIIGGPVARHLLGKMKHGENPESDDVDDVQEAFEHPTYQRKITTRSLIETI
FT                   TMMTCCLLIGQFLDAHTKGSVIELPTFVWCLFTGVIIRNSLTHIFKFNVADSAVDVLGN
FT                   VGLSLFLAIALMSLKLWQLAGLALPVMAILAIQVVLMAIFAVYVTYRIMGKDYDAVVLS
FT                   AGHCGFGLGATPTAVANMQAVTSRFGPSHKAFLIVPMVGAFFIDLVNASVLKVFLFVVS
FT                   ALH"
FT   gene            complement(593144..593578)
FT                   /locus_tag="D11S_0666"
FT   CDS_pept        complement(593144..593578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0666"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
FT                   free tRNA(Tyr); possible defense mechanism against a
FT                   harmful effect of D-tyrosine"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82068"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542014.1"
FT                   /protein_id="ACX82068.1"
FT                   /translation="MIALIQRVTQAKVEVGGEVVGQIGKGLLVLLGVEKDDDRQKADKL
FT                   AEKVLNYRVFSDADDKMNLNVQQIGGELLVVSQFTLAADTQKGLRPSFSKGASPQLANE
FT                   LYAYFVRKCGDKLKVKCGRFAADMQVSLVNDGPITFWLSC"
FT   gene            complement(593575..594405)
FT                   /locus_tag="D11S_0667"
FT   CDS_pept        complement(593575..594405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82069"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566601.1"
FT                   /protein_id="ACX82069.1"
FT                   /translation="MIDLKTFCALFWQRFNQNKLTQAAGYLTYSTMLAIVPLIMVVFSI
FT                   FSAFPVFNEVTGALKEFIFTNFAPSAGDVVGQYIDEFVNNSKQMSAVGIISLIVVALML
FT                   INSIDRTLNGIWHDTSTRPIFTSFAIYWLILTLGPLLVGTSIAASSYVKTMFEYSAASS
FT                   FGLKLLSFVPFLSTWFIFTVIYMVVPNKKVSIKHSAAGALIAAVFFTLGKQAFAWYIVT
FT                   FPSYQLIYGAMATLPIMLLWIQLSWTFVLLGAQLAAVLAEVQSKKQVNHQEVKQ"
FT   gene            complement(594402..594875)
FT                   /locus_tag="D11S_0668"
FT   CDS_pept        complement(594402..594875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0668"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82070"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542012.1"
FT                   /protein_id="ACX82070.1"
FT                   /translation="MTAFLDSYCPCHSHNTYGECCGRFHAYVQFPETTEQLMRSRYAAY
FT                   VLKNVPYIVETTVPNQQKLLNVQAIQTWAENTQWLGLQILNTETLTKVQSAVEFNAIFQ
FT                   GEEGEQAHHERSIFVKIDRRWYFVDPTVPLPTMKQPCICDSGKKFKHCCGGFL"
FT   gene            complement(594878..595546)
FT                   /locus_tag="D11S_0669"
FT   CDS_pept        complement(594878..595546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0669"
FT                   /product="molybdenum cofactor sulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82071"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546916.1"
FT                   /protein_id="ACX82071.1"
FT                   /translation="MATAEILIIKIGKVQQLTFADGSLYESAIRKVPVEAVKIHSLGAE
FT                   GNDVGLKAHHGGVDKALFFMSADAFPALNALLDENFSYQDTAVYGENFVVSALNEDSVC
FT                   VGDIYQIGSCVVEVSQPRKPCERLSKNTNNPNTQQTVYRSGWSGWYVRVVREGEIQRGD
FT                   KLILQARPHPDFTIRHLNRLLSAPDTINELEQALALEVLAPAFKRSLHSQLTKLQQKQS
FT                   "
FT   gene            595672..597171
FT                   /locus_tag="D11S_0670"
FT   CDS_pept        595672..597171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0670"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82072"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006719652.1"
FT                   /protein_id="ACX82072.1"
FT                   /translation="MQYLLAQTEQNQQFGISAKMANRHGLIAGATGTGKTVTLRKMAET
FT                   FSDDGVPVFLVDVKGDLSGLVQAGAMQGKVAERIEQFNLGGESYLSGYPVSFWDVFGET
FT                   GIPLRTTISEMGPLLLSRLLNLNATQEGLLNLVFRVADDKGLLLIDLKDLRAMLKYVAE
FT                   NAKTFQVEYGNVSAASVGAIQRALLTLENEGAANLFGEPALNLEDWLQTRDGRGVINVL
FT                   NSEKLINSPRMYSAFLLWLMAELFEQLPEVGDPDKPKFVMFFDEAHLLFDGAPSVLVDK
FT                   VEQVVRLIRSKGVGIYFVTQNPLDLPDTVLGQLGNRVQHALRAFTPRDQKAVKSAAETF
FT                   RTNLKVNVVETISTLGVGQALVSFLDEKGMPTPVEIAYIFPPKSQLAPISAEQRAAWVK
FT                   DDDLYAFYKDYVDNESAFEVLNAQADLAAVAQKQAEQAKQEEENGIMGSLSRMIFGTKK
FT                   RGEQLSVTEQVVSSVAKSVGRNIRNQVTKQIMRGILGAFKK"
FT   gene            597510..598325
FT                   /locus_tag="D11S_0671"
FT   CDS_pept        597510..598325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0671"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82073"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546920.1"
FT                   /protein_id="ACX82073.1"
FT                   /translation="MFKIQDAVSETLLIPLYMRYHESLKPDPIIHDASALRLVPQIDYD
FT                   FSKFDTAIRSSVGSAIRATYLDSLTKAFIQQHQQPIIVMIGCGLDARHERVGDIGKNVP
FT                   FYELDLPDVIALRKQLMPPAENEILLAASAFDTDWMDELRSTYPQAQFLFVIEGVLMYF
FT                   NEAQVKKLFEDLAVRFSGGEIAFDIGSTWMSRNSQKHHDVMKHMRAQFDYGCDDDHEME
FT                   RWADNLHLISAKYMFDFPAWKRIGLLQAAIMWIVPFVRKSYRFLYYRIS"
FT   gene            complement(598403..599296)
FT                   /locus_tag="D11S_0672"
FT   CDS_pept        complement(598403..599296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0672"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82074"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542006.1"
FT                   /protein_id="ACX82074.1"
FT                   /translation="MIDNINELRTFITAAQEGSFTKAAAKLNVSTSALSHSIRKLEEQL
FT                   NIKLFNRTTRSIATTEAGEQLFQNLLPLFESIEDNLNALSTFRNTLKGKLRINGNDHVF
FT                   LSILWDKLMAFAEQYPEMELELTSDTKFVDIVAGRFDAGIRLGSDVAQDMIAVRLSDKM
FT                   QMAVVGTPEYFAKKATPKKVEDLGEHECLLVRLPTSDSIMTWEFQPAKKSAPVVKFHPK
FT                   GQLCFNNSHLISRAVLVGKGLAWLPIDTMQPYLDSGELVEVLSNVAISYDGYHLYYPNR
FT                   RQNSPLFKALVAALKI"
FT   gene            599655..600500
FT                   /locus_tag="D11S_0673"
FT   CDS_pept        599655..600500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0673"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82075"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546924.1"
FT                   /protein_id="ACX82075.1"
FT                   /translation="MEKVFKLNNGVEMPMVGFGVYQVSDEETEKAVLEALKAGYRLLDT
FT                   AAVYANEAGVGRAIKTSGIPREDIFVTTKLWIQRKNGYENTKKALEDSLERLGLDYVDL
FT                   YLMHQPLGDVHEEWRAMEELYKAGKARAIGVSNFHTDRLMDLITCHDIVPAVNQIETHP
FT                   FYQRDEEIAFHKEHGILQQSWGPLAEGKFDIFTNPVLTKIAEKHGKSVAQVVLRWLNQR
FT                   GVAIIPKSVKVERMLENRDIFGFTLDEQDLADIATLNRNEIIFNHRDPKMIVWLAQARG
FT                   "
FT   gene            600564..601544
FT                   /locus_tag="D11S_0674"
FT   CDS_pept        600564..601544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0674"
FT                   /product="aldehyde oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82076"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005574333.1"
FT                   /protein_id="ACX82076.1"
FT                   /translation="MQTRQLGSQGLTVSELGLGCMGITFGYSTEIPQAEGVKLIRQAFD
FT                   LGVTFFDTAEAYGEANEVLVGKAVAPFRDQVVVATKFGFKNGNVAEGLDSRPERIRQVV
FT                   EQSLKRMNTDYIDLLYQHRVDPNVPIEEVVGAVKDLIAEGKVKYFGLSEVGAEIIRRAH
FT                   AVQPVSALQSEYSLMWREPEAEIFPLLEELNIGFVPFSPLAKSLLTGTITADTQFAAND
FT                   FRNSVPRLQGDALKSNLGLAELVKNIAAQKGVTLAQVALAWVLAQKPWIAPIFGTTKPH
FT                   RLVENLGGADVHLSAEDLTRIQTALSQIQIVGERYSAAGQALINR"
FT   gene            601770..602825
FT                   /locus_tag="D11S_0675"
FT   CDS_pept        601770..602825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82077"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549598.1"
FT                   /protein_id="ACX82077.1"
FT                   /translation="MKLFPSKLTLALAIASGLSVTNLSYATNDTIQAGNGIAVVQTQSG
FT                   EIQGYIHNDILTYKGIPYATAERFMPPKPVENWQGTKMALTYGDVCPQVPMGGRSFFFT
FT                   GPEMTESEQCLNLNVWAPKNDGKKRAVMVWIHGGGFQSGASNDLDSYDGENLARKGDVV
FT                   VVSVNHRLNAMGYLDLSAYGKQYKNSANAGIQDLVAALEWVKANAEQFGGDPNNVTIFG
FT                   ESGGGAKVLTLMATPAAKGLFNKAIVQSGAVEKMGMTLTSPKTGQRVAELTLANLGVKP
FT                   TALNRLNSFTPDQINAAANKALKQTAEEQKITPLRGTGYGLAWAPTMDGDYIPQEPVGK
FT                   NTQKSRKIFHF"
FT   gene            603093..603425
FT                   /locus_tag="D11S_0676"
FT   CDS_pept        603093..603425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0676"
FT                   /product="carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82078"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546929.1"
FT                   /protein_id="ACX82078.1"
FT                   /translation="MYNYLFTWDTPVFNGTPMSYHTAEIAFVFNNIQRMAQATGGGDEA
FT                   QALADKMARAWTNFAKAGNPNGEGLPQWDAYTRENGNVMIFDNQVEVKQHHDAKLQRLL
FT                   APSMKF"
FT   gene            603562..604671
FT                   /locus_tag="D11S_0677"
FT   CDS_pept        603562..604671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0677"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82079"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546931.1"
FT                   /protein_id="ACX82079.1"
FT                   /translation="MKKFAKISTLLTACALAVQAYAAPLSIEKQGSFAVGGTVKTSEGT
FT                   YTPIPDAIKNRQSSAFFDVYGEAVKAGGMTLHGDHASVFYQIPTNAKQNSLVFLQGYGQ
FT                   SARGWMTTPDGHEGFNELFLQRNYPVYLVDQPRRGQAGRSTVDANVPATPDDQFWYAQF
FT                   RIGVYPKMNEGVAFPKDAESQAQFFRMMTPDTGAFDVPVITDSMVKLFDKTGGGVFVTH
FT                   SAGGVIGWTTAMASDKVKGVVAYEPGAFFFPEGETPAKLESKFGDVAPLTVPKAQFEKL
FT                   TKMPIVIYFGDFIPDHLDGTQGGEQWFIRMKMAQQFVDTINKHGGKAELIHLPKIGIKG
FT                   NTHFMFSDLNNDKVAEEMARWLKAKGLDK"
FT   gene            complement(604810..605700)
FT                   /locus_tag="D11S_0678"
FT   CDS_pept        complement(604810..605700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0678"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82080"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590555.1"
FT                   /protein_id="ACX82080.1"
FT                   /translation="MLNNLPNLNELYYFIQVVQAGSFAKAANKLGVTSSALSQNVKSLE
FT                   KSLDLRLLNRTTRSISPTNAGEKLLAQITPHFHAIVGGLNQLDDWRNSPLGTIRINTSE
FT                   VAANLLLYPKLKTLMQRYPELKIEMVVENRWVDIVEQGFDMGVRLGYALYKDMIAVKIS
FT                   DPVRMAVVASPDYLRGKPSVQAIADLPAHLLIGLRLSNQHGEAHWEFQHKGERITFQPE
FT                   PHFSVNNGLRHQAALDGLGIAWLPKIVVEKDLEAGWLVELLDEYAMEYEPLYLYYPNRQ
FT                   GHSRAFELVVEALRV"
FT   gene            605800..606864
FT                   /pseudo
FT                   /locus_tag="D11S_0680"
FT                   /note="alpha/beta hydrolase; disrupted"
FT   gene            complement(607016..608848)
FT                   /locus_tag="D11S_0681"
FT   CDS_pept        complement(607016..608848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0681"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="Catalyzes the first step in hexosamine metabolism,
FT                   converting fructose-6P into glucosamine-6P using glutamine
FT                   as a nitrogen source"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82083"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005586860.1"
FT                   /protein_id="ACX82083.1"
FT                   /translation="MCGIVGAVAQRDIAEILINGLHRLEYRGYDSAGLAVVNSQHELQR
FT                   VRCLGKVKALDDAVEKTPLIGGTGIAHTRWATHGEPSEENAHPHVSGNFAVVHNGIIEN
FT                   YEELRTLLKERGYVFTSQTDTEVIAHLVEWEMRTAGSLLEAVQKVVKQLTGAYGMVVMD
FT                   RMQPEHLVAARSGSPLVIGLGIGENFLASDQLALLSVTRRFIFLEEGDIAEITRRSVDI
FT                   YDRDGNKVEREAHDSNLENDAAEKGKYRHFMQKEIYEQPTALINTMEGRVTHNNVIVEA
FT                   IGNSAKEILEKVEHVQIVACGTSYNSGMVARYWFESIAGVSCDIEIASEFRYRKFVVRP
FT                   NSLLITLSQSGETADTLAALRLAKEKGYMAAMTICNVAGSSLVRESDLAFMTRAGVEIG
FT                   VASTKAFTTQLTSLLMLVVAIGKAKHTLSAEKEQEMVKALQALPAEIEKALAFDKQIEA
FT                   LAEDFAEKHHALFLGRGEYYPIAMEASLKLKEISYIHAEAYAAGELKHGPLALIDADMP
FT                   VIVVAPNNELLEKIKSNIEEVRARGGQLYVFADKEAGFTEAEGMKIITMPTVNEITAPI
FT                   YYTVPMQLLAYHIALIKGTDVDQPRNLAKAVTVE"
FT   gene            complement(608903..609679)
FT                   /locus_tag="D11S_0682"
FT   CDS_pept        complement(608903..609679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0682"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82084"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541994.1"
FT                   /protein_id="ACX82084.2"
FT                   /translation="MTKRNIQTRNTQQRRHGIMQLLQERGEISVEQLVQLFDTSEVTIR
FT                   KDLSVLQSNGFLLRRYGGAILMPQELLEDAQEDFLSERKLAIAKVAAERIRDHNRIIID
FT                   SGTTTAALIKQLNHKQGLVVMTNSMYVANELRSLENEPTLLMTGGTWDNRSESFQGNVA
FT                   EQVLRSYNFDQLFIGADGIDFERGTTTFNELVGLSRVMAEVAREVIVMVESQKIGRKMP
FT                   NVELTWQQIDVLITDSLLSEESKNRIAAHGVEVICA"
FT   gene            complement(609826..610098)
FT                   /locus_tag="D11S_0683"
FT   CDS_pept        complement(609826..610098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0683"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82085"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016533059.1"
FT                   /protein_id="ACX82085.1"
FT                   /translation="MNKTDLIDAIASSAELNKKQAKAALEATLDAITGSLKKGEAVQLI
FT                   GFGTFKVNARKARTGRNPQTGAEIKIAASKVPAFVSGKALKDAVK"
FT   gene            complement(610265..610858)
FT                   /locus_tag="D11S_0684"
FT   CDS_pept        complement(610265..610858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82086"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518346.1"
FT                   /protein_id="ACX82086.2"
FT                   /translation="MMRNPIHKRLENLATWQHLTFIACLCERMYPNYQLFCQITEQPQH
FT                   AKVYHNILNLAWEYLTVKDEKINFENQLEKLENIIPDVNDYDFYGVVPALDACEALSEM
FT                   LHTIIAGDSLTQAVKLSQLSLQTVADLLAEQNERELSETELKESEEIQQELDVQWQIYR
FT                   ALKDAEKRNVELILGLKNELREVGISNICVKIDQ"
FT   gene            complement(610873..611937)
FT                   /gene="hemE"
FT                   /locus_tag="D11S_0685"
FT   CDS_pept        complement(610873..611937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="D11S_0685"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="catalyzes the formation of coproporphyrinogen from
FT                   uroporphyrinogen III"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82087"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541991.1"
FT                   /protein_id="ACX82087.1"
FT                   /translation="MTTLKNDRYLRALLRQPVDMTPIWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCRNAELACEVTLQPLRRYDLDAAILFSDILTIPDAMGLGLSFGAGEGPKFERVID
FT                   SKSAVENLPVPDPEQELQYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYIVEGGSSKA
FT                   FTKIKKMLYAEPHLLHALLDKLADSVILYLNAQIKAGAQAVIVFDTWGGVLAHRDYPAF
FT                   SLHYMHKIVDGLIREHEERRVPVTLFTKGGGLWLEAIADTGCDAVGLDWTVDIAEARRR
FT                   VGHKVALQGNLDPSVLYAPANRIEDEVRSILAAFGAGNGHVFNLGHGIHQDVPVESPKR
FT                   LVDAVHQLSQPYHL"
FT   gene            complement(611934..612735)
FT                   /pseudo
FT                   /locus_tag="D11S_0686"
FT                   /note="NADH pyrophosphatase; disrupted"
FT   gene            complement(612874..613518)
FT                   /locus_tag="D11S_0687"
FT   CDS_pept        complement(612874..613518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0687"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82089"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578046.1"
FT                   /protein_id="ACX82089.1"
FT                   /translation="MKLRKTFLLVALLYFPAAWAADLAGLNIKYSSNYLMPAYVHFKSD
FT                   GFEYTIKANINVPLYNIQFTSKGTQSSNFFNMLSYQDTRNNKPYAKAKIANHKIEYGKV
FT                   KNGLKTEDLTLPTYDLFTVAFQLSYYDKLPNSFQITNGKKLYPMENVVLNTSKKQVKYN
FT                   KQEVTEITYKFKTGDKDIMVKKHEGEKFPRFISYNRDGDKYELTFSEFVKD"
FT   gene            613776..615392
FT                   /locus_tag="D11S_0689"
FT   CDS_pept        613776..615392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0689"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="PEP carboxykinase; PEP carboxylase; PEPCK; catalyzes
FT                   the phosphorylation and decarboxylation of oxaloacetate to
FT                   form phosphoenolpyruvate using ATP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82091"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541986.1"
FT                   /protein_id="ACX82091.1"
FT                   /translation="MTDVNNVVKELEAIGIHNVKEVVYNPSYEQLFEEETKPGLEGFEK
FT                   GTVTTTGAVAVDTGIFTGRSPKDKYIVLDDTTKDTVWWTSDAAKNDNKPMTQETWASLK
FT                   DIVTKELSGKRLFVIDGFCGASEKDRIAVRIVTEVAWQAHFVKNMFIRPTDAELKDFKP
FT                   SFVVMNGSKCTNPNWKEQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLP
FT                   LKGVGAMHCSANVGKDGDVAVFFGLSGTGKTTLSTDPKRELIGDDEHGWDDVGIFNFEG
FT                   GCYAKTIHLSEENEPDIYRAIRRDALLENVVVRADGSVDFDDGSKTENTRVSYPIYHID
FT                   NIVKPVSRAGHATKVIFLTADAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEP
FT                   TPTFSACFGAAFLTLHPTQYAEVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIID
FT                   AILDGSIEKAQMSELPIFNLAIPKALPGVDPAILDPRDTYADKAQWEAKAKDLAGRFVK
FT                   NFEKYATNAEGKALISAGPKA"
FT   gene            complement(615457..617004)
FT                   /locus_tag="D11S_0690"
FT   CDS_pept        complement(615457..617004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0690"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82092"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541983.1"
FT                   /protein_id="ACX82092.1"
FT                   /translation="MNNENLLKKANELYARRGEVREIAAIDLGSNSFHMIIARIVNGTL
FT                   QVLSRLKQKVQLAEGLDENQVLSQAAIERGVNCLALFAERLQGFSAENVSVVGTYTLRR
FT                   AVNNDVFLRQAANVFPYQINIISGKTEAKTIYAGVCHTQPETGRKFVIDIGGGSTEMII
FT                   GDNFTPLIYESRHVGCVSFAKKFFPNGEISAENFRQAKQSALNKIEDLAWEYRNLGWQS
FT                   VLGSSGTIKTVHQVIYENIDPNGTITAPRLDQLIEQTLQYSHFNQLKFNGLNPDRADVF
FT                   VPGLAILSAVFENFHIEKMRYSDGALREGVMYSLEQNFQVNNIRERTALGLAEQFNIDQ
FT                   AQAERVYQSAVLLFNQYNAWQNTELIPEMQDVLFWAARLHEVGIVINHKAMQKHSAYIL
FT                   YNTELPGFDNEQHRLLSTLVRYHIGNFKLPDMFKFSRYNEKDVLALIRILRLAAIINRS
FT                   RQATEKTEKIILKNDRTFSNWQLEFETDYLTHNPLLKNDLALENRFLQTLELSLSAR"
FT   gene            complement(617007..620888)
FT                   /locus_tag="D11S_0691"
FT   CDS_pept        complement(617007..620888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0691"
FT                   /product="tubulin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82093"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518345.1"
FT                   /protein_id="ACX82093.1"
FT                   /translation="MTEHTEQAPQTPAPKTKKSKWHRRLCAVSAVVFFAVFALLGMLAT
FT                   ENGQHKLIQWADDFTDALSIKRIEGNLSEGLVLTNVRFQTQGIGVQVNQARLQMQLSCL
FT                   WKLKVCVDDISLQQPGIQIDTALLPPSGQKLKESAPMKRISLPISVQVNQLAVKDLSLL
FT                   IDKNQMHLATFHTAAGLNNETGITLSPTQIDDFRFVQQLTENTSQKAEAKSADTAASPP
FT                   INWEKLEQDLSRPLLADLPKIDLPFDMHVQGISGKNWQYQLINDKQETLQDILVSSVEL
FT                   QADATDYTVQLQKFDVKSSLGGLTASGQMQLSEDFPLQFKLLGDFNTFRHNNNVLLPAS
FT                   KIDLTLSGSLKKKTALSLQTQGALEATLEAQAQPAAPKLPLTLHFTADKAQYPFNNKDP
FT                   LQINDLVLDIEGDLLTAQVNLKSAVSGMGIPTNTLKLQAVSHLSNVEIQRLLLNALSGS
FT                   AELQGNLNWRDGIAWDSHLQLEKINVGKYLSAFPAQLSGKLSSQGKANQSGWQVAVPEL
FT                   DIQGTLSQRPLNLKGNFTAGNQQLLNIPQLLLTYGDNKIEAQGHLGDTSDFNLDINAPN
FT                   LQGLWADLSAGLKGNVKLNGSIARPSIHADLTASRFALQHMRLNQALIKGEINSAEQIS
FT                   GQLEVNLNGFNYDDIKVNQLKLTANGDEQKHSLQLQSDGTPVATNLNFTGNFNRTLQQW
FT                   KGTLSQIMIKSEFGNLQTNKNVAVTYNNKTTEATISAHCWIHSHADLCFPQSFNVGANG
FT                   EVPFDIKRFNPAFINKLLEQELLSGQLNSQGKVAWFTDKPLQAELQLNGNHVSLTQKVD
FT                   RKTFRLAIPQIGLNANLANNNLALKSDIHLQDQGRIGADLKLSDIANARELGGTFSIQN
FT                   LNLNLVNQLLNRDEQVNGALRANLTLGGSLTAPTLNGDVNLNKLTAKIRALPFDITESE
FT                   LTLLFTGTGSTLKGYVQTADSRLHLSGEANWKNVNDWRTRLHAEADKFKVDIPSMARLR
FT                   ISPNIDISATPKLLELSGNIDIPWARIAIENLPDSAVAVSSDEVILNGNKKSTLPKTLP
FT                   SETQSGMAIRSDLRINIGDDVSLNAYGLKTHLHGLLSVKQEKGNLGLYGEVNLKNGRYA
FT                   SFGQDLIIRKGLISFVGQPSQPMLNIEAIRNPEAMEDASVTAGVKVNGIATAPSVTIFS
FT                   EPGMPQDQALSYILTGRSLENSGDTASSGSVGAALLGMGLAKSGNVVGGIGKAFGIKDL
FT                   NLSTAGVGDRSKVVVSGTITPRLQVKYGVGLFDGLAEVTLRYRLLPQLYVQSVSGVNQA
FT                   FDLLYQFEF"
FT   gene            complement(620916..622775)
FT                   /locus_tag="D11S_0692"
FT   CDS_pept        complement(620916..622775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0692"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82094"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167611.1"
FT                   /protein_id="ACX82094.1"
FT                   /translation="MTDLRKYFGNPPHFALQGFSLTGTLLAFDFEVNMKQSGNRITHWA
FT                   AKTIFIFCFLWHPSVCAEHLVDLQVSGIKNEKLNENVQIYTNAIEKEDMDGSDRYQESV
FT                   RQAVDKGLRAFGYYESAVSFELKNRAKPNKPLLITHVTVGNPVKIAATDVVISGQAEED
FT                   PEFAKLERKVPKPGTVLNHETYDDYKSSLQQLALTRGYFDAGFETSRLEVMPSTYQAWW
FT                   KLDFNSKARYHYGKIHFQHAQIREDYLRNMLNIQPGEDYLLSDLSTLTNNYSSTNWFSS
FT                   VLLQPHLDDENKLVDLDVLLYPRKKNIMSVGVGYSTDVGPRLQWSWTKPWINARGHSVR
FT                   SNMYISSPKQTLELTYKHPLLKNPLNYYYEYSAGFENENTNDTKTTASTLAALRYWNHP
FT                   TGWQYSLGLRVRHDSFTQAEISDKTLLIYPTTSLTRTRLRGGAFPDWGDSQRITFDFGR
FT                   KFWLSDVDFWKIQASTAWIRTYAQNHRFLTRLEAGVLNTASIHRIPPSLRFFAGGDRSV
FT                   RGYSYKKISPKDRNGKLIGGSRLLTGSIEYQYQVYPDWWLATFVDSGLAANSFDMNELR
FT                   YGTGVGVRWASPVGAIKFDIATPVHDKDNSKNIQFYIGLGSEL"
FT   gene            complement(622842..623471)
FT                   /locus_tag="D11S_0693"
FT   CDS_pept        complement(622842..623471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0693"
FT                   /product="nitrate/nitrite response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82095"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549976.1"
FT                   /protein_id="ACX82095.1"
FT                   /translation="MTDKLKVLIIDDHPLMRRGIKQLVELEEGFEFVGGAGNGTEGINL
FT                   ALQTSPDLIILDLNMKGLSGLDTLKALRAEGVDARIVILTVSDAKNDIFTLIDAGADGY
FT                   LLKDTEPDTLLSQLKRIARGEVILSDSIKNLLLERQSAQEPIYSLTDREMGVLRLIATG
FT                   LSNKQIAGQLFISEETVKVHIRNLLRKLNVHSRVAATVLYFEHKNG"
FT   gene            complement(623481..625982)
FT                   /locus_tag="D11S_0694"
FT   CDS_pept        complement(623481..625982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0694"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82096"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005572438.1"
FT                   /protein_id="ACX82096.1"
FT                   /translation="MKLDLNKARKRVDYLDKLRIQRALSDTPESFQQVFRLIPLLLHFN
FT                   HPDLPGYIADAPCGIVHFVANKFQQNYLKHNYAPDSVKNILKSHRTFHERAILGVYVMG
FT                   SIASIAQTPSSDLDIWLCHREDLSAQSRQLLQQKIELIQQWAKRFHVEINFYLMDQKRF
FT                   RCFHDTEPVGIENCGSAQYMLLLDEFYRSAIRLAGKPLLWLHLAVENEADYEAEIERLA
FT                   QNGELDLNDWVDFGGLGTLSANEYFGASLWQLYKGIDYPYKSLLKILLLEAYSHDYPNT
FT                   FLISREFKQALLSNQLKVEHKFDAYLAMLQRVTAYLTRQKEFKRLDFVRCCFYIKVHEN
FT                   EVGPEQSNWRLDELLKLTQQWGWKCGQLEHLNHRAQWKIKQTIKVHNDLIKFLMLSYRN
FT                   LVNFARKHQVNASIMPQDMSILTRKLYTAFEELPSKVTLLNPQLAVDLSEKYLTFIEVK
FT                   NNRHFRDGWYLVNQTPTVQGFSRPRYTEYNESLNKLVAWGYFNRLLTANTELFITSKNV
FT                   DLKTLRQYVTDLRLAFPLENRFANNSELSHPCEIRNLAVIVNLTQDPTRHLTEVKSSIQ
FT                   SSDLFSFGPNEESLVGSIDLTYRNVWNEIRTLHFEGANAILLALKVLSNKIYRGAPLPQ
FT                   QVQVFCYSRYYRHALRRIVTTLINKCISIQVGTAEPPKNNLLRVAGKNWQFFFEERGIS
FT                   LQEIHHADIGKTHQLDTALNAKVKATEPKIVKLQKYPHEIDMFASEGFLQFFFEDNANG
FT                   SFNVYILDELNRIEIYRNCDGTKEKKIHEINRIYQLSGLDENDNPYKIVQRDFNYPQFY
FT                   QLVTTKEGTTIVPFHSRLALS"
FT   gene            626138..627064
FT                   /locus_tag="D11S_0695"
FT   CDS_pept        626138..627064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0695"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82097"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589373.1"
FT                   /protein_id="ACX82097.1"
FT                   /translation="MTQKSLKIATRQSPLALWQANYVKDLLQQLYPDLNVELVPMVTKG
FT                   DVILDSPLAKIGGKGLFVKELENALLNKEADIAVHSMKDVPMQFPEGLGLAVICKREDP
FT                   RDAFVSNSYRTLAELPQGAVVGTSSLRRQCQLKTLRPDLEIRSLRGNVGTRLSKLDNGD
FT                   YDAIILASAGLIRLGLAERIASFIDVEQSLPAAGQGAVGIECRTDDVAVQQLLAPLADA
FT                   ETTSCVLAERAMNHHLQGGCQVPIGGYAVLRDSELYLRALVGSVDGSTIIRAEGKSAVE
FT                   NADVLGVQIAEQLLAQGADKILQDIYA"
FT   gene            627077..627823
FT                   /locus_tag="D11S_0696"
FT   CDS_pept        627077..627823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0696"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82098"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005560647.1"
FT                   /protein_id="ACX82098.1"
FT                   /translation="MAVLVTRPDERGQQLVDMLAKAGVVAIHLPLFRIESGAELNELPN
FT                   KFAQLKNGDYVFAVSKSAVDFAFKTLTATGFVWRRDLHYFTVGQGTAQYFAATTEMPVH
FT                   YPTAQENSEGLLQLSAMRDLSDKTVLILRGNGGRELFAEQAQQRGASVETVECYRREPI
FT                   VYNNAEQTSICKRAGIQTIVATSAEILTQLVDFVPQNEHNWLKSCQLITVSERIAHLAE
FT                   ALGWKNVVISPRADNQTLLQTLLQCR"
FT   gene            627852..629237
FT                   /locus_tag="D11S_0697"
FT   CDS_pept        627852..629237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0697"
FT                   /product="HemX protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82099"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540522.1"
FT                   /protein_id="ACX82099.1"
FT                   /translation="MANKKSNHPKNNAGIEHKIDVSDDLDLATQDTTPNEHVETNAEDK
FT                   TETMQQSEEKIAPSEQKPIVHETVVVKKTGSALGLLALLIALGLGGAGYYFGQLQVDEI
FT                   QQKLTALESQLQQKGASADAAGMPDFSAEKNQLAKLTEFSQVASDQISALNQSLSAKEQ
FT                   SLSALQQQVQRLSNQAKAEQPNDWLLTEADFLLNNALRKLVLDNDVDTSVSLLKVADET
FT                   LSKVAMPQVAQVRSAINADLKQLLSLNNVDQNAIMQNLSQLANNVDELTVLDVNFDEDP
FT                   SSDKLTDSLDDWKENAEKSAVSFLNHFIRITPKKADSKALLAPNQDIYLRENIRLRLQI
FT                   AILAVPRQQDDLYKQSLETVASWIRSYFDTNTEVAQIFLKTLDELAEQSIYVDVPTRLN
FT                   SLNALDKLLDKQPQEVQKITLSVDKDLTDTADKPAADKPTNENEAGSAPTNEANQDSNQ
FT                   GQQ"
FT   gene            629250..630500
FT                   /locus_tag="D11S_0698"
FT   CDS_pept        629250..630500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0698"
FT                   /product="heme biosynthesis protein HemY"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82100"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005594820.1"
FT                   /protein_id="ACX82100.1"
FT                   /translation="MVRVLFLMLLLLAGLIAGPYLSGKQGYVRIETASNIIEMSITTLV
FT                   IFFVIALALVYSIEVAISRFFRLSNNTYSWFSRRKRAKAQKQTLEGLMRMDEGDYSKAE
FT                   KLIGKNAKHSDEPVLNFIKAAEAAQQRGDEFSANRYLIEATEIAGSDSLILEIARTRIL
FT                   LQQHKLPAARSSVDSLLLMEGRNKEVLKLAVDIYLKSKAYQALDNILEQVEKSGLYSAE
FT                   GFVQLQHQVEDGLLDEKMNEEGVDGLLDWWDEQPRKRRNDAYVKLALISRLIDANDHES
FT                   AYELMLELVKKLDDENSPLNQELFKQISRLQPEDNTKLIKFISKWLKGANPSVQCGANR
FT                   ALGYLYMRNNDFAKANEVFKALIANKDKLEPADITMASYVFEQVGDTAAAAQLRKDGLQ
FT                   SMMAIRKPQAAEKTPEK"
FT   gene            complement(630567..631304)
FT                   /locus_tag="D11S_0699"
FT   CDS_pept        complement(630567..631304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82101"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540527.1"
FT                   /protein_id="ACX82101.1"
FT                   /translation="MTYSFSIFNDQQKRRALVLLSFFHIFIITASNYLVQIPFEVHVPL
FT                   AFFGAQEDFMFHSTWGTLTFPFIFLATDLTVRVFGAKEARWIIFVVMIPALIISYVVST
FT                   LFSDSQYQGWQALTAFNLFVFRIALASFCAYVFGQLLDVLVFNRLRQLKTWWIAPTSSM
FT                   VFGSMADTYLFFAIAFYASSDPFMAAHWMEIGFVDYLFKLFIGLLLFVPAYGVVLNVIL
FT                   RKIQTLTAAMQTEFGGKIEEANG"
FT   gene            631566..631847
FT                   /locus_tag="D11S_0700"
FT   CDS_pept        631566..631847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82102"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540529.1"
FT                   /protein_id="ACX82102.1"
FT                   /translation="MKKTALFATLAGVFTMAMATQASAEMKAMDHKMEQGMEHKMEHTM
FT                   KDDKAMMDHKMDKTMKDGKMMDHKKDKMMKDGKSMDHKMDKEMKDHKM"
FT   gene            632033..632620
FT                   /locus_tag="D11S_0701"
FT   CDS_pept        632033..632620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0701"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="Bacteria have multiple sigma factors which are
FT                   active under specific conditions; the sigma factor binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82103"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014702353.1"
FT                   /protein_id="ACX82103.1"
FT                   /translation="MQFSFQHISSQEIEDIRRQMLKFATLQLRDEDLAEDVVQETLVKA
FT                   YQHATSFKGASALKTWFFAILKNQIIDLINYRKRTVNVSEIYDDEDEADEPNAFFDQSG
FT                   HWDRSHFSPQTWHEPDNQVHKREFWVVFEACLEHLPAQQARVFMMREYFEMKSEQICEE
FT                   CDLSVSNLHVLLYRARLQLQACLSNNWFDEKK"
FT   gene            632635..632826
FT                   /locus_tag="D11S_0702"
FT   CDS_pept        632635..632826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82104"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005578025.1"
FT                   /protein_id="ACX82104.1"
FT                   /translation="MKCKQVTKLISDGQEKPLSLLQHSQVYMHLAICPYCRAFARNCAK
FT                   MHDMMHEFAEQPDNEKAR"
FT   gene            complement(632909..633391)
FT                   /locus_tag="D11S_0703"
FT   CDS_pept        complement(632909..633391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0703"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82105"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564808.1"
FT                   /protein_id="ACX82105.1"
FT                   /translation="MAKSNYITRQGWNMLDRELKFLWKEERPQVTQAVSDAAALGDRSE
FT                   NAEYIYGKRRLREIDRRVRFLTKRLEVLQIVDYSPKQESKVFFGAWVELENEDGEVKQY
FT                   RIVGCDEFDPANNWISIDSPVARALIGKQEDDEITVDTPAGKIWLCVNRIWYEKNA"
FT   gene            complement(634126..634725)
FT                   /locus_tag="D11S_0705"
FT   CDS_pept        complement(634126..634725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0705"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82107"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540545.1"
FT                   /protein_id="ACX82107.1"
FT                   /translation="MRLILLRHGETLWNKEHRLQGHLNSPLSEKGIAQAKAIKPLIEKF
FT                   SLKKVICSDLERAKQTAELIGFPNATPDSHLRELAMGEWEGRKKDEIMQENPILYQDWR
FT                   NGNYTPRGGESWQDFCHRISTALFQWTNKSDGDILAIVHSGVVRAACERLISLSTKHLL
FT                   PVTQGTLTIFDITPNHPIKLEAYNLGSFVPEINVAD"
FT   gene            complement(634737..636205)
FT                   /pseudo
FT                   /locus_tag="D11S_02435"
FT                   /note="permease; disrupted"
FT   gene            636315..637202
FT                   /locus_tag="D11S_0709"
FT   CDS_pept        636315..637202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0709"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82111"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546989.1"
FT                   /protein_id="ACX82111.1"
FT                   /translation="MNINQLKTFIVLADCLSVTETSKRLFCTQPAVSIKIRKLEETLNT
FT                   VLFERINNRLYLTEQGKIFYSYAEQIISTLEMSVEHLHQYDDPNYGKIIIGASHFVGVY
FT                   LLPQVIAEYRKLSPNVELRLEILSSQQLIQGLENHSIDFIIMSDQIYFDPQKYDVNRFL
FT                   SDELILIVPPDHVLATYESCHFEQLCDELFIIKPKNSQTRKFLLQQFSKDQISLLKFME
FT                   INSLEGIKRCVMNGLGVSIISRFSVENELKMGMLKAVELDSFQFKRGINYIYHKEKRLS
FT                   SAIGRFIGLLNILK"
FT   gene            637419..639734
FT                   /locus_tag="D11S_0710"
FT   CDS_pept        637419..639734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0710"
FT                   /product="transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82112"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542170.1"
FT                   /protein_id="ACX82112.1"
FT                   /translation="MLNQQISQLIAQELNVCDNQILAAIQLLDDGNTIPFIARYRKEAT
FT                   GGLDDTQLRHFETRLIYLHELEERRQTILKSIEEQGKLTDELRGKIQATQSKTELEDLY
FT                   LPFKPKRRTKGQIAIEAGLEPLADLLWNEPKTDPETAANEFINVEKGVADSKAVLDGAR
FT                   YILMERFAEDAGLLAKVRDYLSKNALLVSKVLEGKETEGAKFQDYFDHQELFKNVPSHR
FT                   ALAMFRGRNEGILQLSLNADPDAEEGSRQSYCEEIIRDYLGVRFTGQPADKWREQVIAW
FT                   TWKIKVALHLETELMATLREKAEEEAIDVFARNLTALLMATPAGAKNTMGLDPGLRTGV
FT                   KVAVVDSTGKLLATDTIYPHTGQMDRAMLSIFQLIKQHNVELIAIGNGTASRETERFAK
FT                   DVIKEIKENKPQTVVVSEAGASVYSASELAAQEFPELDVSLRGAVSIARRLQDPLAELV
FT                   KIEPKAIGVGQYQHDVNQSQLARKLDAVVEDCVNAVGVDLNTASVPLLARVAGMTKTIA
FT                   QNIVAYRDENGRFDSREQLKKVPRLGPKSFEQCAGFMRIAAGNNPLDASGVHPEAYPVV
FT                   EKILQATEQSIQDLMGNAGLVRQLDAKQFTDEQFGLPTVQDIFKELEKPGRDPRGEFKT
FT                   ATFADGVEEITDLKAGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVEEPHQV
FT                   VKTGDIVKVKVLEVDVARRRIALTMRLDESAVKNDGKSDRTLSAKPRTNASRQERNAPR
FT                   TNNAMGNAFADALKNWKR"
FT   gene            complement(639782..641239)
FT                   /locus_tag="D11S_0711"
FT   CDS_pept        complement(639782..641239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0711"
FT                   /product="xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82113"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005565472.1"
FT                   /protein_id="ACX82113.1"
FT                   /translation="MHYYLGIDCGGTFIKAALFDKTGKIHACERESLSVISEQASYAER
FT                   DMDELWRACANVIRTTIKHSKIEPHFIKSVGISAQGKGAFLLDKENKPLGRAILSSDQR
FT                   SQPIVKRWQQEGLEKKVYPLSYQGLWTGHPVSILRWLKENQPQRYYAINKLLMAHDYLR
FT                   FCLTGELYCEESNISESNLYNMAIGNYEPELARLLGIEEIIGKLPPIVKPNQIAGYITQ
FT                   QAAHQCGLAVGTAVVGGVFDVTAMTLCLTDDNDETKLNVLLGTWSIVTGISHTIDENQT
FT                   LPFAHGRYVEQNTFLIQEASPTSAGNLEWFIKQWNLTYHQTNQMVEALPPAQSAVIFIP
FT                   FLYGTNAKLGMTAGFYGMQAHHTLAHLLQAVYEGVLFSLMIHLERMYQRFPHVQRLRVT
FT                   GGPVKSQVWLQMLADFSGKTLEVLQTEEVGCLGAALMAAEGANHEAATLKRNQKLKIIH
FT                   PNSFHFDAYQQKYQKYRKLVNLLSEMA"
FT   gene            complement(641245..642273)
FT                   /locus_tag="D11S_0712"
FT   CDS_pept        complement(641245..642273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0712"
FT                   /product="sugar ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82114"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585455.1"
FT                   /protein_id="ACX82114.1"
FT                   /translation="MFSLKKIISKLGIGLVLFFMILGMSFTSEAFLSTNNIFNILLQVS
FT                   VICVISVGMTYVILTGGIDLSVGSIVALSAVCLGLFTHWGVALLGENPTEPMLSIVVIV
FT                   SVLGSIGVGALCGYVNGVIIVYGKVTSFITTLGMMGIARGLALTLSNGKTIYNFPEALR
FT                   FFGNGRLNITYGFGIPIPVIIALIVVLISFYILTQTVFGRQVYALGGNREAVRLSGINV
FT                   NKLEIKTYVINGALAAIGAVILVGRLNAAQPIAGTGYELDAIAATVIGGTSLMGGVGSV
FT                   ISTSIGALIMGVLQNGLTLLNVTSYLQRLIIGLVIILAVFLDQLRRGEVSTGRLRRIFF
FT                   RE"
FT   gene            complement(642289..643776)
FT                   /locus_tag="D11S_0713"
FT   CDS_pept        complement(642289..643776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0713"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82115"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542167.1"
FT                   /protein_id="ACX82115.1"
FT                   /translation="MSENIILELKNISKHFFGVTVLDDIHLDIRQGEVLCLIGENGAGK
FT                   STLCKIIAGIYHCDDGEMFYSGRKYSPDTVKQAQEAGIGFIHQELMLVPKLTVLENIFL
FT                   GSEKTSAFGRMNWTVMREKTQHIINELELDIKPDDLISDLSIAQQQMVEIAKAVFSEYK
FT                   IIIFDEPTSSISRKNTEVLFNIIHQLKAKGVAMIYISHRLEEFKYIADRVTVLRDGRIT
FT                   GTMRYQDTSPEEIVRLMVGRKIDFTRYLRTGSFNQEKLRVENLHNKYIKPISFSVHKGE
FT                   ILGFAGLVGAGRTEVLRAIYGADQTSGKIYIDGKEIKINSPEDAVKHKIGLITEDRKSQ
FT                   GLVLGMSIRENITLPILKHFWRKFYLDKKQERRVAEKNRTKLHIVSHDQEQQTKTLSGG
FT                   NQQKVILARWLESGVDILFFDEPTRGIDIGAKSEIYDLMHQFTESGGTIVMISSDLPEL
FT                   ITISDRVIVMRNGEKIKEIADRTEMTEENLMRLMIGV"
FT   gene            643939..644880
FT                   /locus_tag="D11S_02440"
FT   CDS_pept        643939..644880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02440"
FT                   /product="sugar ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02440"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005547001.1"
FT                   /protein_id="ANN81532.1"
FT                   /translation="MKLKLLKNLFKIGALLAALPTLAVAADKPQIALLMKTLSNEYFIS
FT                   MQQGAEEAAKQKNVDLIIQVAEKEDSTEQLVGLVENMIAKKVDAIIVTPNDSIAFIPAF
FT                   QKAQKAGIPIIDLDVRLDAKAAEAAGLKFNYVGVDNFNGGYLEAKNLAEALGGKGNVAV
FT                   LEGIPGVDNGEQRKGGALKAFAEYPDIKIVASQSANWETEQALNVTTNILTANPNVNGI
FT                   FAANDNMAIGAVTAVENAGLAGKVLVTGYDGIPLAIEYVKQGKMQNTIDQLPKKQVAIA
FT                   IEHALKQINKQEIPAVYYVDPVVVDKEQSKNY"
FT   gene            complement(644950..646135)
FT                   /pseudo
FT                   /gene="tuf"
FT                   /locus_tag="D11S_02445"
FT                   /note="elongation factor Tu; disrupted"
FT   gene            complement(646229..646304)
FT                   /locus_tag="D11S_0718"
FT   tRNA            complement(646229..646304)
FT                   /locus_tag="D11S_0718"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:646269..646271,aa:Thr,seq:ggt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(646308..646382)
FT                   /locus_tag="D11S_0719"
FT   tRNA            complement(646308..646382)
FT                   /locus_tag="D11S_0719"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:646347..646349,aa:Gly,seq:tcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(646423..646507)
FT                   /locus_tag="D11S_0720"
FT   tRNA            complement(646423..646507)
FT                   /locus_tag="D11S_0720"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:646471..646473,aa:Tyr,seq:gta)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(646538..646613)
FT                   /locus_tag="D11S_0721"
FT   tRNA            complement(646538..646613)
FT                   /locus_tag="D11S_0721"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:646578..646580,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            646829..647782
FT                   /locus_tag="D11S_0722"
FT   CDS_pept        646829..647782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0722"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82120"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588201.1"
FT                   /protein_id="ACX82120.2"
FT                   /translation="MEFPVSHSISEQLMPFLSFNRQRWAELRKSVPLKLTEQDLKPLLG
FT                   INEALSLDEVRTIYLPLTRLINYYIDENIRRQDVLHRFLGGQSPKVPYIISIAGSVAVG
FT                   KSTSARILQSLLSHWPQERKVDLITTDGFLHPLSYLQQHNLLHKKGFPISYNTPKLIHF
FT                   LADIKSGKPNVSAPIYSHLTYDIVPDQFNVIDQPDILILEGLNVLQPNKNQANELFVSD
FT                   FVDFSIYVDAEETLLKEWYIRRFLKFRQSAFSNPSSYFKHYANLSEQEATETAGKIWDE
FT                   INGLNLKENILPTRERANLILKKGANHEVELVKLRK"
FT   gene            complement(647837..650257)
FT                   /gene="gyrB"
FT                   /locus_tag="D11S_0723"
FT   CDS_pept        complement(647837..650257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="D11S_0723"
FT                   /product="DNA gyrase subunit B"
FT                   /note="negatively supercoils closed circular
FT                   double-stranded DNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82121"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005585440.1"
FT                   /protein_id="ACX82121.1"
FT                   /translation="MSTNTPETYGANSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVF
FT                   EVVDNAIDEALAGYCDDIVVTIHSDNSVSVQDDGRGIPVDIHPEEGVSAAEVIMTVLHA
FT                   GGKFDDNSYKVSGGLHGVGVSVVNALSDKLQLTIRRQGKVHEQFYSLGDPQAPLAVIGE
FT                   TTQTGTTVRFWPSPTIFTNIEFEYDILAKRLRELSFLNSGVSIRLIDERTDKQDHFHYK
FT                   GGIQAFVEYINRGKTPIHPKPFYFSAEKDGIGVEIALQWNDGYAENIYCFTNNIPQRDG
FT                   GTHLAGFRGAMTRTLNNYMENEGYTKKSKVATSGDDAREGLVAVISVKVPDPKFSSQTK
FT                   DKLVSSEVKSAVESLMNEYLQTYLLENPNDVKIIVTKIIDAARAREAARKAREMTRRKG
FT                   ALDLGGLPGKLADCQERDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEK
FT                   ARFDKMLSSAEVGTLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFF
FT                   YRQMPELIERGYVYIAQPPLYKVKKGKQEQYIKDDEAMAEFELAIALENAALYVNESAP
FT                   GMQGVALQNLASEYLAVQKMIARLTRYYPESVLKELIYQPALTTALMQQESAVNSWADS
FT                   LVATLNMKETDGRHYSYRLQFNAERNLYEVVLTVRTHGIDTDYFLNFQFATGSEYTRLI
FT                   ALGEKLVDLLEGSAYVMRGERKVAVGSFEQAIEWLMRESRRGLMIQRYKGLGEMNPEQL
FT                   WETTMDPNIRRMLKVSIKDAVAADQLFTTLMGDEVEPRRDFIESNALRANLDI"
FT   gene            complement(650354..652243)
FT                   /locus_tag="D11S_0724"
FT   CDS_pept        complement(650354..652243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0724"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="functions in blocking illegitimate recombination,
FT                   enhancing topoisomerase activity, initiating SOS signaling
FT                   and clearing blocked replication forks; component of the
FT                   RecF recombinational pathway"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82122"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005595387.1"
FT                   /protein_id="ACX82122.1"
FT                   /translation="MSDLNPSKPTKSAVDFADESSVNSTALHASALHVLHSVFGYQSFR
FT                   KGQQEIINAVLNGQDCLVIMATGTGKSLCYQIPALCFDGTTLVVSPLISLMKDQVDQLR
FT                   ANGVEADYLNSTQTFEEQQQVQNRAISGQLKLLYLSPEKVMTSSFFQFISLCQVSFIAI
FT                   DEAHCISQWGHDFRPEYTQLGGLKGSFPNVPIMALTATADQTTQQDILQNLRLNRPHFY
FT                   VGSFDRPNIRYTLVEKFKPMEQLCRFVLAQKGKSGIVYCNSRNKVERIAETLYNKGVRA
FT                   AAYHAGMENGLREKVQRDFQRDNIQVVVATIAFGMGINKSNVRFVAHFDLPRSIESYYQ
FT                   ETGRAGRDDLPAEAVLFYDPADYVWLNKMLMEKPETPQRQIEQHKLQAIGEFAESQTCR
FT                   RLVLLNYFGEHRQTPCQNCDICLDPPKKYNGLLDAQKIMSAIYRTGQCYGAHYVIAVLR
FT                   GMNNQKIRDQHHDQLSVYGIGKEHGTEYWQSVLRQLVHLGLVRQIIGEYGNTLQLTENA
FT                   KPILRGEEPLELATPRLSSIVTTAMTPKSAVGSYDKDLFARLRFLRKQIADKENIPPYI
FT                   VFNDATLQEMAQYQPVSNIEMLQINGVGAIKLERFGQAFLTLIREHKSARAGE"
FT   gene            complement(652240..652554)
FT                   /locus_tag="D11S_0725"
FT   CDS_pept        complement(652240..652554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0725"
FT                   /product="frataxin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82123"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577994.1"
FT                   /protein_id="ACX82123.1"
FT                   /translation="MNIIEFHQKIEQVWDEIEEQLEAQDCDVDCERQGSVFTITLGDRS
FT                   QIVINKQESLLELWLASHNGGFHFAYKEDGRWVSNDGLDFWQALTEALAKHGEQVQFNQ
FT                   "
FT   gene            652814..654064
FT                   /locus_tag="D11S_0727"
FT   CDS_pept        652814..654064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0727"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82125"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558101.1"
FT                   /protein_id="ACX82125.1"
FT                   /translation="MDFFQYQYDRLMVENLPVKQLAEEFGTPLYVYSKAALEHHWYAFE
FT                   NAFGNHPHLVCFAVKSNPNIAILNIMARLGSGFDIVSQGELERVLAAGGEAHKVVFSGV
FT                   AKSRREIARALEVGIRCFNIESEAELLRINQVAGDIGKIAPISLRVNPDVDAHTHPYIS
FT                   TGLKENKFGVSVEQAREVYKLATTLPNIEIVGMDCHIGSQLTELQPFLDAADRLIMLME
FT                   QLKQDSIQLKHLDLGGGLGVTYTDETPPHPTEYAKALWEKLSAFNELEIIVEPGRAITA
FT                   NAGILVTKVEYLKSNESRNFAIVDAGMNDMIRPALYQAYMNILEIDRTLAREEKIYDVV
FT                   GPICETSDFLGKQRKLAIAEGDYLAQRSAGAYGASMSSNYNSRPRTAEVMVDGDNAYLI
FT                   RRREALNELWRLESLLP"
FT   gene            complement(654117..654722)
FT                   /locus_tag="D11S_0728"
FT   CDS_pept        complement(654117..654722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0728"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82126"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577987.1"
FT                   /protein_id="ACX82126.1"
FT                   /translation="MSGLFVQTDPSRRRYSVAAFVAIIAGVVSSFVKWGAEHPFPPRSP
FT                   LDLFTAACKDPSQALEVCSRAFLNPPHVFLRDYIGINPTEAVFTFADYGFNWIGVTHIT
FT                   FSVVFALFYCIVAERFPKIKLWQGILFSIICNIGVHYIAFPLLNLTPQISELPWYEHVS
FT                   EFVGHVFWFWSIELIRRDLRNRITHEPDPEVPLNQPYR"
FT   gene            654921..655481
FT                   /locus_tag="D11S_0729"
FT   CDS_pept        654921..655481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0729"
FT                   /product="DNA-3-methyladenine glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82127"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546873.1"
FT                   /protein_id="ACX82127.1"
FT                   /translation="MKKRCTWAENSQIYQDYHDNEWGKPQFDDRKLFEKLCLEGQQAGL
FT                   SWITVLKKREAYRQAFFHFDPHKVAAMTDADIDHCMQNTGLIRHRAKLQAIVTNARAFL
FT                   AMQKCGENFSHFIWSFVNHQPQIHDVPELSHVPAQTATSIALSKALKKRGFVFVGPTTC
FT                   YAFMQSMGLVDDHWNACAYKTPH"
FT   gene            655547..657889
FT                   /locus_tag="D11S_0730"
FT   CDS_pept        655547..657889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0730"
FT                   /product="LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82128"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012820903.1"
FT                   /protein_id="ACX82128.1"
FT                   /translation="MKKNYYTLISLSILTALYTADSAADLNQQCLLGVPHFTGEVVTGD
FT                   PNDQPVYIEADKVEINQPSSALYQGNVDIKQGNRHLKSAAVEMQQSGEGGNVQRYAFAR
FT                   GGFDYRDNQINLLGSDAKIHLNSKDTDIQHADYQFVDRQGRGSAKSVELREDYRLMKNA
FT                   TFTSCLPNDNAWSIYASEMRQHVKEEYAEMWHARFRVHGVPVFYTPYFQLPIGDRRRSG
FT                   LLVPTAGHSSRDGYFYAQPVYWNIAPNYDATIAPKYMSKRGWQFNGEFRYLTPLGEGKI
FT                   AGEYLGNDRLTDYTAENRKRHLLHWLHSSSFLENWRLNVDYTRVSDKRYFTDFDSEYGS
FT                   STDGYADQKARIAYYQPNYNLAISAKQFQIFDEVAIGPYRTLPQIDFNYYKNNLWNNLD
FT                   FKLFSQAARFDNDSIQMPKAWRFHLEPGLNKTLSNRYGSINFETKLYATHYQQKNGRIV
FT                   SEDEKVERSVTRVLPQFKVELQTVLASNKILFNGYTQTLEPRVQYLYRPYKNQGNIGPK
FT                   NPQYLGFGYDSTLLQQDYFSLFRDGRYSGLDRIASANQVTLGGTTRFFDVEKEERFNFS
FT                   IGQTFYLKPSRIDDNPNNKTSGASSSWALESNWKISDQWRWRASYQYDPQLKQVSLANT
FT                   GLEWNPQKENLIQLTYRYASQRYIDQNLDVGANRYNQDIKQLGVQAAWEITDNWAVVGR
FT                   YYQDLALKKPVEQYLGVQYNSCCWSIGVGARRYVTSRQNQKYDEIFYDNSIGVTFQLRG
FT                   FGNDHKNGIEELLKRGKLPYLQAFSLY"
FT   gene            complement(657978..658442)
FT                   /locus_tag="D11S_0732"
FT   CDS_pept        complement(657978..658442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0732"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82130"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005540681.1"
FT                   /protein_id="ACX82130.1"
FT                   /translation="MSEKYVVTWDMFHMHARKLSERLLPASQWKGIVAVSRGGLFPAAV
FT                   LARELSIRHVETICIASYNHDTQGELQVLHAAQLANGGEGFIIIDDLVDTGNTARAIRE
FT                   MYPNARLVTVFAKPAGAELVDNYVVDIPQNTWIEQPWDMGICFVPPLARK"
FT   gene            658557..660017
FT                   /locus_tag="D11S_0733"
FT   CDS_pept        658557..660017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0733"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="catalyzes the hydrolysis of Xaa-His dipeptides"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82131"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006719807.1"
FT                   /protein_id="ACX82131.1"
FT                   /translation="MSEIQKLTPNLLWKWFDQICAIPHPSYQENALAEFIVNWAKGKAF
FT                   YAERDEAGNVLIRKPATKGMENRRKVALQAHLDMVPQANEGSLHNFATDPIQPYIDGEW
FT                   VRATNTTLGADNGIGMAATLAVLDSDDLPHPDLEVLLTMTEERGMEGAIGLRPNWLQSD
FT                   IMINTDTEENAEIYVGCAGGENANISLPVEYENNRFAHSTQIVLKGLRGGHSGCDIHTG
FT                   RANAIKLLARFLAKLAQNQPHFDFALSDIRGGSIRNAIPREAFATLNFNGDVDRLKSAV
FT                   ENFGVLLKTELALIEPNLSFELQPIDKPTKIFTPLTTEHIIHLLNVLPNGVIRNSDVLE
FT                   NIVETSLSVSVLETEENWIKATILVRSLIDSGKEYVAEMLKSLAQLSDAKAEFSGSYPG
FT                   WEPQAHSPIVDLTYKIYAQVLGYEPAIKVIHAGLECGLLKKIYPNMDMVSIGPTIKNAH
FT                   SPDEKVHIPAVQIFWSLITKLLAEIPVK"
FT   gene            complement(660097..660852)
FT                   /locus_tag="D11S_0734"
FT   CDS_pept        complement(660097..660852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0734"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82132"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561437.1"
FT                   /protein_id="ACX82132.1"
FT                   /translation="MRNIIITGAGGDLAQAIVKQLPDARLILIGREAALLENLYAFHPH
FT                   KACFQLDICDEHAVAACLHEVEQRYGAIDVLINNAGYAVYDDFDCLTTEEARKMFEVNV
FT                   FAGMTFCQLVGHNMKALGRGHIVNIVSMSGFLASAKSSLYSASKFAMIGYSDAIRLELA
FT                   DKGVFVTTVNPGPIATKFFKQADPEGTYLKSIKPFLIPVDLVAQKIVMALGKNVREINL
FT                   PRTLAFARKFYVLFPKTADFLARTLFNYK"
FT   gene            complement(660946..661458)
FT                   /locus_tag="D11S_0735"
FT   CDS_pept        complement(660946..661458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0735"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82133"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566355.1"
FT                   /protein_id="ACX82133.1"
FT                   /translation="MLPMLGITGYSGSGKTTLLEKLLPQLKQCGLRPAVIKHSHHDVQI
FT                   DKPGKDSWRMKDAGASQVIMACDQRWALMTETPQQHISLPYLCTQFDEALADLILVEGF
FT                   KQEPIEKILLHRKDMTRPLPEMDEYVLAVATDYPLTAHKPHLDINDIKQIAQFIVMWYE
FT                   QKCGGKK"
FT   gene            complement(661539..661976)
FT                   /locus_tag="D11S_0736"
FT   CDS_pept        complement(661539..661976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82134"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577976.1"
FT                   /protein_id="ACX82134.1"
FT                   /translation="MLTESAVVIEYESGRAKVKCQSQSACGACAAKPACGNSALSELAG
FT                   SGARGEHIFTIETITPLKIGQRVEIGLSERSLIKSALLMYCVPLFTLLFSTLLFDSLFA
FT                   HELVSVFFIFISTALSFLGVRWYAQKLNRQSAYQPVLLRVL"
FT   gene            complement(661986..662942)
FT                   /locus_tag="D11S_0737"
FT   CDS_pept        complement(661986..662942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0737"
FT                   /product="sigma-E factor regulatory protein RseB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82135"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005561432.1"
FT                   /protein_id="ACX82135.1"
FT                   /translation="MLKTLLKTTALFLLLSCSLSSVAQENLSPKQLLGEMKKAAQQLNY
FT                   EFSFVQTTPSNMDSLRYRHFVADGKTYAQLVTLDGPQQEIVQRENLISYFQPNYQAFTI
FT                   NGSGIIDNLPPLSRANFDALEKYYDFVNIGRNRVADHVVQTIRILPKDDFRYQYLAFID
FT                   EENHLLLRTDMLDREGNLLDQFRVVNLYIGNELSGLPAYLNRVVFPPLLMDQKANNPPA
FT                   FKWQPGWLPQGFKLVNHSIELDGEEKIESQLYSDGLFSFTLYVSDKIAESTQQDNTWRQ
FT                   GAYTIYTESMENKEMTIIGQLPISTAKRIVQDIEFRK"
FT   gene            complement(663025..663609)
FT                   /locus_tag="D11S_0738"
FT   CDS_pept        complement(663025..663609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0738"
FT                   /product="sigma-E factor negative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82136"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005595377.1"
FT                   /protein_id="ACX82136.1"
FT                   /translation="MQKELLSAYIDGEQVSSELTEQLCQDAELQESWANFHTIRAVMRQ
FT                   ETNVFLSADFTAKMESLIAEEEIVVAQPTVSQPLPQEVESSPFMQKLKSWFVPMTQVAV
FT                   AAGVCLVAVLGVQSLNSKSAVQNAPDTPVLQTLPFNNGVQEVSYNAPSKDVITTEQLEQ
FT                   KNKRIGAMLQSYELQRRVYGDSLSLEQTSAK"
FT   gene            complement(663648..664223)
FT                   /locus_tag="D11S_0739"
FT   CDS_pept        complement(663648..664223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0739"
FT                   /product="RNA polymerase sigma factor RpoE"
FT                   /note="Member of the extracytoplasmic function sigma
FT                   factors which are active under specific conditions; binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription; this
FT                   sigma factor is involved in heat shock and oxidative stress
FT                   response"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82137"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577973.1"
FT                   /protein_id="ACX82137.1"
FT                   /translation="MAEQLTDQALVERVQQGDKKAFNLLVSRYQNKVAGLLTRYISPND
FT                   IPDVVQESFIKAYRSIDSFRGDSAFYTWLYRIAVNTAKNYLTAQGRRPPNEDILAEDAE
FT                   SYDVGTNLRDVDTPENEMLSNELKKIVFDTIKSLQEDLRTAITLREIEGLSYEEIAEIM
FT                   DCPVGTVRSRIFRAREIIESKVKPLLQR"
FT   gene            complement(664356..664610)
FT                   /locus_tag="D11S_0740"
FT   CDS_pept        complement(664356..664610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82138"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566361.1"
FT                   /protein_id="ACX82138.1"
FT                   /translation="MKDYDPFRIEWDCRRGMLELDKVIMPFYQQHFAQLSEHQKAVFVR
FT                   LLACSDLQLFSWFFNNGTIDDPELCKMVAEIQQKLNLTN"
FT   gene            complement(664650..664838)
FT                   /locus_tag="D11S_0741"
FT   CDS_pept        complement(664650..664838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0741"
FT                   /product="multidrug DMT transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82139"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546851.1"
FT                   /protein_id="ACX82139.1"
FT                   /translation="MAISICLEIVATNLLKVSDGFTKLVPTLGALAFYGCSFYFVSIIF
FT                   RTLSVGLVINLFSQTSH"
FT   gene            complement(664923..666638)
FT                   /locus_tag="D11S_0742"
FT   CDS_pept        complement(664923..666638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0742"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="catalyzes the formation of prolyl-tRNA(Pro) from
FT                   proline and tRNA(Pro)"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82140"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005558147.1"
FT                   /protein_id="ACX82140.1"
FT                   /translation="MRTSKYLLSTLKETPAEAAVVSHQLMLRAGMIRPLASGLYNWLPT
FT                   GLRVLKKVENIIRDEMNKSGAIEVEMPVVQPAELWQESGRWEQYGPELLRFEDRGNRNF
FT                   VLGPTHEEVITDLVRREVSSYRQLPLNLYQIQTKFRDEVRPRFGVMRGREFLMKDAYSF
FT                   HTSKESLQETYDVMYQTYSNIFTRLGLDFRAVQADTGSIGGSASHEFQVLANSGEDDVI
FT                   FSTESDYAANIELAEAVAVGERAQPTKAMELVDTPKAKTIAELVEQFNLPIEKTVKTLI
FT                   VKGANEEQPLVALILRGDHELNEVKAEKLAEVASPLEFADEAAIKAKIGAGVGSLGPVN
FT                   LNIPVIIDRSVALMSDFGAGANIDGKHYFNINWERDVALPKIADIRNVVEGDPSPDGKG
FT                   TLLIKRGIEVGHIFQLGDKYSQTMNATVQGEDGRPMVVTMGCYGIGVTRVVAAAIEQHH
FT                   DERGIIWPSDAIAPFSVAIVPMNMYKSESVQQFAEDLYRTLQAQGVEVIFDDRKERPGV
FT                   MFADMELIGVPHMVVIGEKNLANGEIEYKNRRTGEKQMIAKAQLLDFLKSQINV"
FT   gene            666782..668176
FT                   /locus_tag="D11S_0743"
FT   CDS_pept        666782..668176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0743"
FT                   /product="selenocysteine synthase"
FT                   /EC_number="2.9.1.1"
FT                   /note="catalyzes the formation of selenocysteinyl-tRNA(Sec)
FT                   from seryl-tRNA(Sec) and L-selenophosphate in selenoprotein
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82141"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518147.1"
FT                   /protein_id="ACX82141.1"
FT                   /translation="MSALYQALPAVDKLLKTPQGEQLVAEFGHSATVNMCRDLLQQARE
FT                   HIKRHENLPHFLQNTDATFQHLKEQLLLQQQVNIKTVHNLTGTVLHTNLGRALWSPAAQ
FT                   QAALDAMQGNVALEYDLSAGERSHRDNYISALMQQLTGAEAACVVNNNAAAVLLMLATF
FT                   AQGKEVIISRGELIEIGGAFRIPDIMAQAGCKLVEVGTTNRTHLKDYRNAINENTAFLM
FT                   KVHSSNYQICGFTHSVDEQELADLGKEFGIPVITDLGSGALMDLKQFGLPEEPTVQEKL
FT                   QHGVDLISFSGDKLLGGPQAGIIVGKKALIQQLQAHPLKRVLRCDKVTLAGLEATLRLY
FT                   LQPEKITEKLTALLLLTQPMERLQAQAEQLKVRLENRLNTNYVIAIEPSEAQIGSGSQP
FT                   LARIPSVAVTIAPASEKTPAKTTALFARLLALPQPVIGRIERDKIWLDLHSLASLDRLL
FT                   NSLETL"
FT   gene            668173..670032
FT                   /locus_tag="D11S_0744"
FT   CDS_pept        668173..670032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0744"
FT                   /product="translation elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82142"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005543542.1"
FT                   /protein_id="ACX82142.1"
FT                   /translation="MIIVTSGHVDHGKTALLQALTGTHTAHLPEEKKRGMTIDLGYAYL
FT                   PFNDQILGFIDVPGHEHFLANMLAGLGGIHYAMLIVAADEGVQAQTIEHLSILSLLQLQ
FT                   EIMVVITKADRADAVQIDALENQLRQQYAVLANSKFFVTSAITGQGIDALRDYLAQLAE
FT                   LSEVDKPFRYAIDRIFTIKGAGTVVTGTAFAGKVSLDDELYLSNGQKVRVKNIHAQNEQ
FT                   NCVGLAGQRLALNINLDFDRTSIERGDWLFSQTPGEPTDRITVWLESQMALNESQPVHI
FT                   YHAASHTTGKLTLLQQQKLAPQQLALAELILEQPLFLAYGDKIILRNGNSTAVLGGAKV
FT                   IEIDSPKRHKRTEARFDYLRRLIQAETAQKRTALYLQNHAVEVQKIMWIEQLTGVQLDA
FT                   ILQQNGDIRFQSWCFNADYRAQQTAKLLTALAQYHEQHPDQLGLGKARLYRIAALNQPE
FT                   KLIYHFIDELLAENQLQHTRGWLHTADHKIQFSEQERALWQQVLAQFEQHNGQALWVRD
FT                   LANALGQEESAMRNFLYKAGKLGYLTAVVKDRFFLTENIYTFARLIKQLTAGKEGFSVN
FT                   ELRDALQFGRKMTVQLVEYFDRCGFLRRKGNIHVLRDADVFDL"
FT   gene            670078..670980
FT                   /locus_tag="D11S_0745"
FT   CDS_pept        670078..670980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82143"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566901.1"
FT                   /protein_id="ACX82143.1"
FT                   /translation="MKKLLIATLIAGSLMLTACDDKEKTALSEQMQKQAQTIEQLNEQV
FT                   KTLEKQVLDLAENQTIRVEPEVLFEKSETIKFDKKSADSYTPESGEVKVNVKTLKTGED
FT                   WLTDLLLNELIRQFTASGQVKIENKQQFVEWLQTLYTDSVKEVKDNEMIGSSTEFSVKY
FT                   LGQRENIATFTISYSGYSGGAHGMYSTQFLNIDLAKKALLDIDDVINPEQHQKLKDLLW
FT                   DAYRDSNNEAEPFTQKDGGFYVPKDFYFSRNGVTFVYPPYAIGSFSEGEKELTIYWWQL
FT                   KENDLINPQFSALAKSVIE"
FT   gene            complement(671471..671746)
FT                   /locus_tag="D11S_0748"
FT   CDS_pept        complement(671471..671746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0748"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82146"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573855.1"
FT                   /protein_id="ACX82146.1"
FT                   /translation="MRLISEPDFLWQRISPIRERKHIPTAWLEVKIDEGRNRQVRRMTA
FT                   HIGFPTLRLIRYQLAGFNLQNLMPKTYRTLTQNELRELYQLLKLTI"
FT   gene            672152..673654
FT                   /locus_tag="D11S_0749"
FT   CDS_pept        672152..673654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0749"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82147"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566088.1"
FT                   /protein_id="ACX82147.1"
FT                   /translation="MTHTTQKRETFSGRRAFIFAAIGSAVGLGNIWRFPYVTYENGGGA
FT                   FIIPYIVALLTAGIPLLFLDYAIGHKFRASPPLAYRKLKTGFETFGWWQVMINVIIGLY
FT                   YAVILGWAASYTYYSVTSAWGSNPVDFFLHEHIKMADEVALNLDFVGTVVGPLLAVWLI
FT                   TLLILSLGVQKGVARTSVIFMPILVIMFVTLMVYSLFLPGAKKGLDALFSPDWDKLKDP
FT                   SVWIAAYGQIFFSLSICFGIMVTYASYLKKQSDLTGAGLVVGFANSSFEVLAGIGVFSA
FT                   LGFIAAANGHDVSEVAKGGIGLAFFAFPTIINQAPLGQLLGVLFFGSLVFAGLTSFISV
FT                   LEVIISAVQDKLRLRRVHATFLVGLPMMVASTLLFGTTAGLPMLDTMDNFVNMFGIVAV
FT                   AFFSLFSIIMSGRLKELGEHLNETGSFKVGMIWKAFIVITTGVLAFMLYKEAGKVLTKG
FT                   YEGYPDRFVNTFGWGMAIALVIIAFLLSRLPWKHLTQTQGEK"
FT   gene            673656..673748
FT                   /locus_tag="D11S_02455"
FT   CDS_pept        673656..673748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02455"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02455"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577959.1"
FT                   /protein_id="ANN81533.1"
FT                   /translation="MSTNAIIMMAVALIIIWGGLLVSVIRLPKE"
FT   gene            674638..674874
FT                   /locus_tag="D11S_0751"
FT   CDS_pept        674638..674874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0751"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82149"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546836.1"
FT                   /protein_id="ACX82149.1"
FT                   /translation="MNILADVTFFGRDFGVLVLLDSLSGKVIYHQIVKTEKDIYYKMAF
FT                   NRLREKGYVIQLITCDGRRGVLKDLFNTPIQMC"
FT   gene            675126..675299
FT                   /locus_tag="D11S_02460"
FT   CDS_pept        675126..675299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02460"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02460"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005576726.1"
FT                   /protein_id="ANN81534.1"
FT                   /translation="MNYLFTFEQYADLNIEKTTNRLEGLFKELKQKLTVHNGLTRRRKI
FT                   VFIKDFLNRKSW"
FT   gene            complement(675504..675580)
FT                   /locus_tag="D11S_0752"
FT   tRNA            complement(675504..675580)
FT                   /locus_tag="D11S_0752"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:675544..675546,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(675852..677489)
FT                   /locus_tag="D11S_0753"
FT   CDS_pept        complement(675852..677489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0753"
FT                   /product="pilus assembly protein TadG"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82150"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588033.1"
FT                   /protein_id="ACX82150.1"
FT                   /translation="MKRNFNLTAKLFSTVKQFLQNEHGVYTIITALLAFPLLLFVAFTV
FT                   DGTGILLDKARLAQATDQAALLLIAEDNQYRKNKDHSDVKRQNVSQQEIEREGRDFSSA
FT                   KVQAQWKKRNQELVQGLVKLYLRSDDSKGQKNSSPVTIKEPFLAECLEEKTQPKNKNGT
FT                   AKSIACVVQGSVQRKFWLPWGQTLVSSSQLYDGRVGINSGKTYAVKEKQITIPIDLMMV
FT                   TDLSRSMMWAINATGNNPPEVNYPNRRIDALREAVEGIEKILLPAQNKGDVSPYNRMGF
FT                   VSFAAGTRQRDELTNCVLPYYVKSEDKKREISAKFKKGYNGGNHIAKGFELLDRDLDIP
FT                   KTIDQISQFDGQKRTYDFTLDSKTSRNYCLEDNVNKKTTQAWFDKNNRAVASALKQIIP
FT                   RGGTAVTSGIFIGTNLMMEKNKDFEAMPNKIGTNTRRILMILSDGEDNIPSKDTLVKLM
FT                   EAGLCTRVKEKIDGLQDSNYPKVETRIAFVAFGFNPPQKQQEVWKKCVGDQYYSVSSKQ
FT                   ALFDAFKQIISFEEEVGRSSSQKPKLFQ"
FT   gene            complement(677505..678083)
FT                   /locus_tag="D11S_02465"
FT   CDS_pept        complement(677505..678083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02465"
FT                   /product="pilus assembly protein TadF"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02465"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566002.1"
FT                   /protein_id="ANN81535.1"
FT                   /translation="MKKNILTNTKKFFHNKRGAVSLEFLFMLILLVFIFAFLTDLVIVR
FT                   TTQGKLDNASYSLVNVLRERNQLYNDNGSEPLKNTDLTEYQQMAKLILFGDKNSPNTVG
FT                   VTIEHWTEKKSTETLTNLNTCQPYRKLDNNLSYLSPRSEAANPDNQRKIPLYQVTLCVE
FT                   AGSFFKNLITRKENQSFGMLSSSSLAVAR"
FT   gene            complement(678152..678727)
FT                   /locus_tag="D11S_02470"
FT   CDS_pept        complement(678152..678727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02470"
FT                   /product="protein TadE"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02470"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005553055.1"
FT                   /protein_id="ANN81536.1"
FT                   /translation="MEKFLSNKKGASTVEFALTVVFYFFVVFLILEFCRISITTAYWDL
FT                   AITESARIAKNRTAEGNDYAVEFEKALKQQLVYQESSTIGYLARLDKNGGYKIDVKYVD
FT                   CDSGRSCIQSLLDSKFREPKKDKEGKIIPPNGRLATLAVYSLTYNYEFLVSLPFLPKDS
FT                   VGGLLSRKFVAVQEFNRSKFQYPSRSNK"
FT   gene            complement(678742..679503)
FT                   /locus_tag="D11S_0755"
FT   CDS_pept        complement(678742..679503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0755"
FT                   /product="NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82152"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557718.1"
FT                   /protein_id="ACX82152.1"
FT                   /translation="MYSKSLKNVLLCGMILSVTACSAVLNKKPLSADKLAAKEALYQST
FT                   NNNDALITMYRDGLKNKEDPLTRYKLSEIYYKKGDSNSSLLYLQPLLTNSGQLSERAKI
FT                   LQARNLNQLKRYQEALEVENSLLTTSPKNGEVYNLRGVTYALIGNPNKANEDINKAREY
FT                   FLNDAVAVNNLAMLSIVNGDYRNAVSLLLPQYLNGVREQRLVHNLIFALIKNNDIDYAK
FT                   DIIVKENINTSPDDLINALKKTERVSNNIAR"
FT   gene            complement(679493..680359)
FT                   /locus_tag="D11S_0756"
FT   CDS_pept        complement(679493..680359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0756"
FT                   /product="pilus assembly protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82153"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546825.1"
FT                   /protein_id="ACX82153.1"
FT                   /translation="MMIKLLLSYALLTIFGIIVLFAALSARKKFQYRKEVITGERPKDQ
FT                   DSDEVAKNKSKQQIELELLLINNNPILKVLGIIDKNIKVKLLIMLLLFGVYYLYSLTDE
FT                   TTDSSSLLLGFLTILIITIVIPGVLIGSILKAKIKKIMNDLAGFIDLVAVNVQTGISIE
FT                   AALKQVATDFKTLNPDLTYVMLRIIRKSEITGMSQALQDLSVSLPTTEIRMFCTVMQQS
FT                   LNFGSSIYHQLIQLSTDIREIQLLAIEEKLGTLSAKMSIPLILFIMFPIIILILAPGVM
FT                   RVFPHVF"
FT   gene            complement(680356..681243)
FT                   /locus_tag="D11S_0757"
FT   CDS_pept        complement(680356..681243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0757"
FT                   /product="MaoC protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82154"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566009.1"
FT                   /protein_id="ACX82154.1"
FT                   /translation="MNYYLYYAVLTIGGLLFIYTLSSWFSTKRKINEYDTSVSRTTSFF
FT                   KSLKSKVSLWYYHFTKGDKKNLIRNIAISCFIFFAFFVINVAYIHIDRLVFCLIFLVGF
FT                   VLFIWKLGQYRNKKTFNAMFPEVIQILNAAATSGAGLLQALERCGKDLTGQLGEEFKSI
FT                   HKRIAIGEDPVSVFEDSYDRYPYKEFYFFITIVRTNLSKGGQIREVISRLGRVIADSNK
FT                   MEKKKKAMTSEARMSAIIVACFPVGFFFFMQFAMPENFDFLINDPTGRYVLYYVFGSEL
FT                   FGMGIIWWLMRKST"
FT   gene            complement(681243..682523)
FT                   /locus_tag="D11S_0758"
FT   CDS_pept        complement(681243..682523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0758"
FT                   /product="pilus assembly protein CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82155"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546820.1"
FT                   /protein_id="ACX82155.1"
FT                   /translation="MLTKQQKILLRSEVLSNLDIEKIDELQSERSSLVNELVQIVNRVA
FT                   NKSGAYLTSADTLVMAEIVADEIEGYGPLRDLMADDTINDILVNGPNDIWVERAGILEK
FT                   TDKEFVSNEQLTDIAKRLVARVGRRIDDGSPLVDSRLPDGSRLNVVIAPIALDGTSISI
FT                   RKFSKNKKTLQELVNFGSMTREMANFLIIAARSRVNIIVSGGTGSGKTTLLNALSNYIS
FT                   HTERVITLEDTAELRLEQPHVVRLETRLAGVEHTGEVTMQDLVINALRMRPERIIVGEC
FT                   RGGEAFQMLQAMNTGHDGSMSTLHANSPRDATSRLESMVMMSNASLPLEAIRRNISSAV
FT                   NIIVQASRLNDGSRKIMNITEVMGMENGQIVLQDIFSYKASKYRDKEGKILGEFINHGL
FT                   LTRSAVFQNAQVFNLSAELQSIFGETE"
FT   gene            complement(682537..683661)
FT                   /locus_tag="D11S_0759"
FT   CDS_pept        complement(682537..683661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0759"
FT                   /product="pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82156"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005538996.1"
FT                   /protein_id="ACX82156.1"
FT                   /translation="MLLLDQETITADSARTITIVSSRDDIQGEVAQILRTRGLENIEIV
FT                   KKDFFTSSDEISFSAEDTVGVIIDITHETNIKTIVERVFSIVPQNVWCCVIGDSDSISL
FT                   SQKLLDEGILYFNSHTQLSQMVEKIILGVDIPRLRDTVKIAVLSCKGGIGASLISSHIA
FT                   NEIVSSKKIPVLLAQGPNGSQDLDLLFDKKLSGNVIEYTPNLDIFNGSLFELTPAATEK
FT                   YNFIIYDQPIYNVKKDNFIGFLENYNSFVLVVERRIGSLRLAKQFLDECERIRSTSRKP
FT                   IRTFVCISDNRMESAKLMAKNDIETLIGSSIDAVIPYIKNTNTKTVLGINLGRDGKKEI
FT                   NSLMLKVIGAISRSSKPKEKQSLFSSFFSKLIKQ"
FT   gene            complement(683677..684180)
FT                   /locus_tag="D11S_0760"
FT   CDS_pept        complement(683677..684180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0760"
FT                   /product="RcpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82157"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518145.1"
FT                   /protein_id="ACX82157.1"
FT                   /translation="MRKLVITASIALASITAPVTTFAISEFVNDTTVAQPVQNSEFNRT
FT                   QLVDRYVLPDYSNVSYSNLFNSVIRDIGSNNQKQINIIWRDATAKKAAMKIRTKLIKNG
FT                   IASKSIYLEKKAHKAKTYPIYIEVAQIAPKPAPCAYRTGEVVFWNSNETSCALKSNQRV
FT                   QLKY"
FT   gene            complement(684177..685559)
FT                   /locus_tag="D11S_0761"
FT   CDS_pept        complement(684177..685559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0761"
FT                   /product="secretin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82158"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566011.1"
FT                   /protein_id="ACX82158.2"
FT                   /translation="MQNWNHTFGKKQLICCAVLGAVFSLNAYAQNFSLDKGATQLVQTK
FT                   EKIDTIFVSSPNIADYEILDDNTFIIYAKEEGRTEVTAFGADGRPLTSDTVNVDSVVTS
FT                   IADTNKQLKSRFPNTNLSVKKVGKAYVIEGKARSQEESDEVRRIVGEALGSGRKVTETK
FT                   LGEDSLPFLDKYHYDGVVDNANIADTTQINVKLSVVEVNKKLSEAMGINWSHVAGSGPL
FT                   VGGNFGFGGGFNGNQGVLRLDAKGISAFINALDNQSNGKVLAEPNISMLSGETADILVG
FT                   GEIPFAQRDRDGSPTIIYKEFGIKLAVAAKLQKNNRIRLALDQTVSTIAGNYNFDGIGN
FT                   IPFFNTRKAKSLFEVANGESFIIGGLFSSNDLEGINKVPLLGDIPILGSFFRSATTERD
FT                   KKELVIVATVNVVKPVNEKDVVYPDFEKTGTMERFFHTTPLKNVYYKTLTSNFLKNSGF
FT                   IQ"
FT   gene            complement(685561..686385)
FT                   /locus_tag="D11S_0762"
FT   CDS_pept        complement(685561..686385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0762"
FT                   /product="flp operon protein C"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82159"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557708.1"
FT                   /protein_id="ACX82159.1"
FT                   /translation="MNYRTLLIISVLTLAVGIGGIMFMPTFDNTENQQTIINNQPVPEA
FT                   EKKPEKLILTAELKNDVSKGHLLQADDYILNEISVPEDSALVDNDLREATTKNGIQGLQ
FT                   GYLMAENVRAGSFLSNKSIISPNDPRFFTSSLDPNQEVAYRIYVKSGDDYILNTILSGD
FT                   YVAIYSQQIASDSRNTYDRKDLVKILGKVLVLQARNFTQSTEQGAPEAEKAADGIPNNQ
FT                   EYAGYVALKITAEQAKKFYSLDRESKLVILPAENNTQEVDSRGVFIRKLRGQ"
FT   gene            complement(686436..686864)
FT                   /locus_tag="D11S_0763"
FT   CDS_pept        complement(686436..686864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0763"
FT                   /product="flp operon protein B"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82160"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566676.1"
FT                   /protein_id="ACX82160.1"
FT                   /translation="MNWFINALVIIMLLLLITLSITDIRSRLISNRVVLFLLLVIIPFS
FT                   LLKYQTIFVIPALCTLIIGFLLFSLRFIGAGDIKLASVLMLAVPSDEVFSFFFFTTFAG
FT                   LGLIIIGWLFFRKSIKENGLPYGVAISLGFMINLALSN"
FT   gene            complement(687205..687435)
FT                   /locus_tag="D11S_0764"
FT   CDS_pept        complement(687205..687435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0764"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82161"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588026.1"
FT                   /protein_id="ACX82161.1"
FT                   /translation="MLNTLTTKAYIKAAEAIRSFRENQAGVTAIEYGLIAIAVAVLIVA
FT                   VFYSNNGFIANLQSKFNSLANTVNSANVTKS"
FT   gene            688002..688466
FT                   /locus_tag="D11S_0766"
FT   CDS_pept        688002..688466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0766"
FT                   /product="metal-binding heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82163"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546814.1"
FT                   /protein_id="ACX82163.1"
FT                   /translation="MGKMIIDLQIASADESGLPTAAQIEQWATAAVQPQSGEVEMTVRI
FT                   VDETESHALNFNYRGKDHPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAQEQEKPL
FT                   IAHWAHMVVHGSLHLLGYDHIEDDEAEEMESLETQIMMGLGFVDPYLSEK"
FT   gene            688628..689326
FT                   /locus_tag="D11S_0767"
FT   CDS_pept        688628..689326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0767"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82164"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005551567.1"
FT                   /protein_id="ACX82164.1"
FT                   /translation="MLKKYLLVLPISILTACAGYYPYPQFEPGYPTPSVQYDDEEHAVF
FT                   STRRTHEPKYQDPRYKISTEDMEKFVLAKNNLEYCLLPELGKQSDERVTALEKRLLKDM
FT                   INDELAKIVGKASARTIFDDQSSYDYFQFKYQQLNHDVNNIREFECRDLKRRFRDRLNE
FT                   RKRRQGLAGDSRSVENQVQKQRQTIDDAFRRFHTQRESIERQIRGESEPLYKSNKNINV
FT                   DWTDPYSRGW"
FT   gene            689330..691252
FT                   /locus_tag="D11S_0768"
FT   CDS_pept        689330..691252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0768"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82165"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573834.1"
FT                   /protein_id="ACX82165.1"
FT                   /translation="MARQLILLVGDDATLARQWEYFPTLKSAVWIGGVLPHFPAQPHFP
FT                   FSKSKNLLGSEFPALIYDGRQGIHLDAFAIAAGALSEGGTLLLLFNEWQDLAAQPDGDS
FT                   LRWSSEKHPINTPHFIAFLQEKIRKYSFPIYQHLPSALVFPKIEKLLSEQHQPTQEQAH
FT                   LLRQMAKSDAEMLIVTAKRGRGKSALAGLFAKQQLAANKPVLLTAPNKSVVKIFNEFSG
FT                   AEIPFMPPDELRRKIDEDLRPFSDHWLFVDEAAMIPLDTLFGLTTAFKRIVLTTTIHSY
FT                   EGTGRGFLLKFMAKTDRTLRHFELFSPLRWQADDKLERFIDELLLCDCEDRLTQPRYDA
FT                   NLAKQIQIVYEEQIPPYQIESVYGLLTLAHYRTSPLDLRRLLDAPRQQFYLAQTQEVLL
FT                   GCVWAVPEGEFGDDVLIRQIRRGQRRPRGNLVAQMLCFQAGLEQACKLRSLRISRIAVQ
FT                   PNWQQRGLGQRLIEQVKQQRAVDFLSVSFGYTPELLAFWQKCGFILVHFSESKDAGSGC
FT                   YSVVALCPLTERGRALMQQAEQQFTRNLPLSLHPLATQFVGTETDWSLNEADWQCLADF
FT                   ADFFLPLAFALPAIRRLMKLNGDRDFPLLTAYCKRPDDIQHKKTWLTNCRLEVKKGLQK
FT                   NFAFL"
FT   gene            691594..695052
FT                   /locus_tag="D11S_0770"
FT   CDS_pept        691594..695052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0770"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82167"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588021.1"
FT                   /protein_id="ACX82167.2"
FT                   /translation="MQTQFFHLEIPTQANDHKILANILPGADSLAISEIAAQFDGLTVV
FT                   VTNDTRSAVRLEKELKQPAPSALSQNVTFFPDWETLPYDSFSPHQDIISARLSALFHLQ
FT                   QRKQGIFILPVATLMQRVCPPSYLQHNVLLINKGDRFVIESLRLQLEKAGYRAVEQVLE
FT                   HGEYAVRGALLDLFPMGSAEPFRLDFFDDEIDSIRTFDVDTQRTLQEIDQINLLPAHEF
FT                   PTDSTGIEFFRSQFRAEFGEIRRDPEHIYQQVSKGTLAAGIEYWQPLFFEQMATLFDYF
FT                   PANTLFITAEQNQAQGERFYTDAQQRFESRRVDPMRPLLPPDKLWLRIDDVNRHLKQYP
FT                   AIALKAEKVRSSARQKNLAIAPVPPLTIQSQQKEPLHQLRQFIEQFKGNILFIVETEGR
FT                   RETLLSLLAPLKLKPKQIHTLAQAEEQKFALMVSPLEHGFIIEQGTPLAIICETELLGE
FT                   RVQQRQRDKSRTVNPDTLIRNLAELQIGQPVVHLEHGVGRYGGLVTLENGGVKAEYLLL
FT                   NYANNSKLYVPVASLHLISRYVGGSDETAPLHKLGSEAWGKARSKAAEKIRDVAAELLD
FT                   VYAQREAQKGFSFQYDREEFQQFTATFPFEETHDQLMAINAVISDMTQPKAMDRLVCGD
FT                   VGFGKTEVAMRAAFLAVMNHKQVAVLVPTTLLAQQHFDNFKDRFANLPVNVEMLSRFKT
FT                   AKEQKRVIQDLADGKVDILIGTHKIIQGDVQFHDLGLLIIDEEHRFGVRQKEKMKQLRA
FT                   NIDILTLTATPIPRTLNMAMNGIRDLSIISTPPARRLTIKTFVRQTDDLVIREAILREI
FT                   LRGGQVYYLHNDVASIENTAEKLTALVPEARVTVGHGQMRERELERVMSDFYHQRYNVL
FT                   VCSTIIETGIDVPTANTIIIERADNFGLAQLHQLRGRVGRSHHQAYAYLLTPPPKLMTK
FT                   DAQKRLEALESLDNLGAGFILATHDLEIRGAGELLGNEQSGQIESIGFSLYMELLERAV
FT                   KALKEGREPSLDELTQQQTEIDLRVPSLLREDYLGDVNMRLSFYKRIAGAENTEALDEL
FT                   KVELIDRFGALPQATRNLLQIAQLRLDLKPLNVIRLDANAQGGFIEFAPNADLDPTIFL
FT                   QLIQRNPSVYRFDGPHKFRFSKDLTDNKVRLEFVVDLVWELIIPR"
FT   gene            695154..695738
FT                   /gene="gmhA"
FT                   /locus_tag="D11S_0771"
FT   CDS_pept        695154..695738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="D11S_0771"
FT                   /product="phosphoheptose isomerase"
FT                   /note="catalyzes the isomerization of sedoheptulose
FT                   7-phosphate to D-glycero-D-manno-heptose 7-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82168"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566022.1"
FT                   /protein_id="ACX82168.1"
FT                   /translation="MYFDQIKAELTEAADVLNKFLSDDNNIKLIQQAALLISDSFKQGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYDYVFSRY
FT                   VEAVGQKGDVLFGLSTSGNSKNVLNAIEAAKAKGMKVIAMTGKDGGKMAGLADVEIRVP
FT                   HFRYADRIQEIHIKVIHILMMLIEFEMAKAE"
FT   gene            695879..696613
FT                   /locus_tag="D11S_0772"
FT   CDS_pept        695879..696613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0772"
FT                   /product="arginine ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82169"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557689.1"
FT                   /protein_id="ACX82169.1"
FT                   /translation="MTISVENLNFFYGANQALFDINLTADDGDVLVLLGPSGAGKSTLI
FT                   RTLNLLEVPQSGKLSIANNQFDLSSGNDPKQLRQLRRDVGMVFQQYNLWPHMTVLQNLI
FT                   EAPMKILGVSETEAKQRALELLQRLRLDEFADRFPLHLSGGQQQRVAIARALMMKPQVL
FT                   LFDEPTAALDPEITAQIVSIIEELQQTGITQVIVTHEVNVAKKVATKVVYMEQGHIIEI
FT                   GDKTCFEQPHTEQFKQYLSHNI"
FT   gene            696634..697353
FT                   /locus_tag="D11S_0773"
FT   CDS_pept        696634..697353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0773"
FT                   /product="arginine ABC transporter substrate-binding
FT                   protein"
FT                   /note="with ArtPMQI is involved in arginine transport"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82170"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018357096.1"
FT                   /protein_id="ACX82170.1"
FT                   /translation="MKKLLLSAILLGSAVVANAQDLTFAMEPSYPPFEFTNEKGEIIGF
FT                   DVDIANAICKEIQATCHFKGEAFDSLITNLRSKRFDAAISAMDITEARAKQVLFSDPYY
FT                   DSTASYVALKGKATLDSAKNVGVQNGTTFQQYTVAETKQYAPKSYASLQDAILDLKNGR
FT                   IDIIFGDTAVLADMISKEAEIQFVGDKVTNKKYFGNGLGIAMNKSNKVLTESLNKVLAA
FT                   IKANGEYQKIYDKWMTK"
FT   gene            697358..698020
FT                   /locus_tag="D11S_0774"
FT   CDS_pept        697358..698020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0774"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82171"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005589471.1"
FT                   /protein_id="ACX82171.1"
FT                   /translation="MFSDYFSLMFTAALMTLGLAVCSLVLGLILGMLFAVLEANRFVGK
FT                   PMAVFVALLRGLPEILVVLLVYFGSSEVVEMITGDYIEFGAFGCGVFALSLIFAAYASQ
FT                   TLRGAIQAIAKGQWESGAALGLSKGYTFIHIVMPQVWRHALPGLSNQWLVLLKDTALIS
FT                   LIGVDDLMRQAQLINTNTHQPFTWYGIAALIYLLVTLVSQVGIRKLELRFTRFERGV"
FT   gene            698023..698706
FT                   /gene="artM"
FT                   /locus_tag="D11S_0775"
FT   CDS_pept        698023..698706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artM"
FT                   /locus_tag="D11S_0775"
FT                   /product="arginine transporter permease subunit ArtM"
FT                   /note="with ArtPQJI acts to transport arginine across the
FT                   inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82172"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546800.1"
FT                   /protein_id="ACX82172.1"
FT                   /translation="MFQEYLSVIAQGIPTSLLLTVVSLAIAFFLALVLTVLLTMGNKAV
FT                   KSAVNLYLTLFTGTPLLVQFFLIYAGPGQFQWIVNSPLWSVLSNAWFCAALTLALNSSA
FT                   YSTQLFHGAVKAIPKVQWESCEALGLSRLQTLKILIPYALKRALPSYSNEIILVFKGTA
FT                   LASTITIMDIMGYARQLYGTDYDALTIYGIAGGIYLIITGIATLLLRRLENKVLAFERL
FT                   AMKSV"
FT   gene            699248..700846
FT                   /locus_tag="D11S_0776"
FT   CDS_pept        699248..700846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0776"
FT                   /product="carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82173"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562080.1"
FT                   /protein_id="ACX82173.1"
FT                   /translation="MLWFFFCVLMLILGYFIYGKVVEKIFAINPKRQTPAYELTDGVDY
FT                   MPMSKTKIWLIQLLNIAGTGPIFGPILGALYGPVAMLWIVLGCIFAGAVHDYFCGMLSI
FT                   RHGGATMPYLAGKFLGRPVKVFINLLALILLLLVGVVFVASPAQLMGTITMDIFGVSQG
FT                   ALQLGDAEVLHHSVEAGGIQVWGMDKATVVSVWALAIFAYYILATLLPIDKIIGRIYPL
FT                   FGALLLFMSVGMVYGLVSAHFSAADPIEFFRTVDADGQGLTWDKFTQNFQVKGDVPIWP
FT                   LLFLTISCGALSGFHATQTPLMARCAENEKEGRFIFYGAMITEGIIALVWCTVGLAFYE
FT                   NPQALQDAITAGSPSKVVYDSSLHFLGFVGGIFAVLGVVVLPITSGDTAFRAARLQLAE
FT                   IFRVDQRVLSKRLLIALPLFALGYFVSTIDFSVLWRYFTWANQMTAMVMLWTAAAYLYR
FT                   YHKFHWVASIPAWFITTVCATYLYYNKIGFSLDYQLSVYLGFATTIVCVVLFFVLVKRS
FT                   GEPDPDALEDNFAKQ"
FT   gene            701110..701568
FT                   /locus_tag="D11S_0777"
FT   CDS_pept        701110..701568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0777"
FT                   /product="cell division protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82174"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588016.1"
FT                   /protein_id="ACX82174.1"
FT                   /translation="MFRGASAVNLDAKGRISIPTRYRAELLEQNQGQMVCTVDIRQPCL
FT                   LLYPLQEWEVIEQKLLELSNFDPVQRSLQRVMLGYATECELDSAGRILISGPLRQHAKL
FT                   EKSIMLVGQLNKFEIWSDAEWKAQVEQDMALGATDTFALSEKLKTLSL"
FT   gene            701678..702646
FT                   /locus_tag="D11S_0778"
FT   CDS_pept        701678..702646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0778"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82175"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577912.1"
FT                   /protein_id="ACX82175.1"
FT                   /translation="MTHLNTFSSTEHLTVLLHETVDGLALKENGIYIDGTFGRGGHSRL
FT                   ILSQLSVNGKLIAIDRDPQAVAEAQKIQDSRFHIEHNTFSEILPICEKFGLVGKVDGIL
FT                   LDLGVSSPQLDDAERGFSFMKDGPLDMRMDSSKGISAAEWLAQVSEQDLAWVLKTFGEE
FT                   RFAKRIAKVIVDYNKSAVQNGGEFLARTLQLAELITQAVPFKDKYKHPATRSFQAIRIY
FT                   INAELDELENVLQSALSVLAPKGRLSVISFHSLEDRMVKQFMRKQSQGEVIPKGLPLRE
FT                   DQIQRNRRLKVIGKAIMPSEAEIVQNPRARSAVLRIAERIN"
FT   gene            702646..702963
FT                   /locus_tag="D11S_0779"
FT   CDS_pept        702646..702963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0779"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82176"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557675.1"
FT                   /protein_id="ACX82176.1"
FT                   /translation="MLENNDRYPLQDIIMEDLFTSNKFVFILLFLIVITALGTVWITHK
FT                   TRSLVAEKGDLVLQHQALENEFLNLKLEEATQSDNTRIEAIAKQLGMQRATPEQEVVIL
FT                   E"
FT   gene            702981..704804
FT                   /locus_tag="D11S_0780"
FT   CDS_pept        702981..704804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0780"
FT                   /product="peptidoglycan synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82177"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588015.1"
FT                   /protein_id="ACX82177.1"
FT                   /translation="MVKFNKSVKPLKPKKTTKTSSKSGSAVKPNKPKQVYERSFLKGRY
FT                   FSALSFIVVGLTALIAQAAYIQIVNADPLVNEADKRSLRKQEVQFVRGSILDRNGQLLS
FT                   VSVPMYSVVADPKFIFDENSLKDKERWQKLAEALGISYSNLLKRVEKDPKSRFVYLSRQ
FT                   ISPTLASYVKDLKITGIVLKSESRRFYPRVEETAHLIGYTNIDGAGIEGIEKSFDSMLI
FT                   GKSGLRTYRKDKLGNIVENIADVKKYDAQDVTLSIDEKLQSMVYREIKKAVAENKAESG
FT                   TAVLVDVRTGEVLAMANAPSYNPNNRTGLKSELTRNRAITDTFEPGSTVKPFVVLTALQ
FT                   RGAVRRDEVINTGPLVLNGHAVKDVAPRDKLTLDGILENSSNRGVSRLALRMPPNALME
FT                   TYQNAGLGKATDLGLIGEQSGLLNAHRARWSDIERANVAYGYGINATPLQIARAYMTLG
FT                   SFGIYRPLSITKVDPPVVGNRVFSEKITREVVNMMEKVAIKNGRAMVDGYRVGVKTGTA
FT                   KKLENGRYVDKYVAYTAGIAPISDPRYALVVLINDPKAGQYYGGAVSAPLFSSIMGYAL
FT                   RANNIAPDGLGQEKTVKRTVRLSDKKASGVN"
FT   gene            704822..706288
FT                   /gene="murE"
FT                   /locus_tag="D11S_0781"
FT   CDS_pept        704822..706288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="D11S_0781"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="involved in cell wall formation; peptidoglycan
FT                   synthesis; cytoplasmic enzyme; catalyzes the addition of
FT                   meso-diaminopimelic acid to the nucleotide precursor
FT                   UDP-N-aceylmuramoyl-l-alanyl-d-glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82178"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539048.1"
FT                   /protein_id="ACX82178.1"
FT                   /translation="MHRLTALLGIDIAGDINLTEMTLDSRTAKAGCLFIAIKGHQTDGR
FT                   QYIPQALRNGASAVIFEADSAQQHLQVHYEQGIPLIAFYRLSENLSRLADVFYQYPSKH
FT                   LTLVGVTGTNGKTTTAQLLAQWTQLLGHTGAVMGTIGNGLFGQVKEAANTTGSAVEIQS
FT                   SLADFVAKGADFAAIEVSSHGLVQHRVESVHFSAAVFTNLSRDHLDYHHTMENYAAAKK
FT                   RLFTELDSRYQIIDADDPVGAVWLAEMPHAVAVSAKADFLPQQANWLKAVDVRFNHKGA
FT                   TIQFESSWGNGELQSPLIGAFNVSNLLLVTATLLTLDYPLSGLINSVHKLTGVCGRMEM
FT                   LHTPQKPTVIVDYAHTPDALEKALQAARLHCRGKLWCIFGCGGDRDSGKRPLMAKIAEQ
FT                   LADHVIATDDNPRTEEPKKIMADILNGFVHPQSVQVIHQRAQAIATAIKSAVENDVILI
FT                   AGKGHEDYQIIGKTKYHFSDQEVVRNYLSQ"
FT   gene            706295..707674
FT                   /gene="murF"
FT                   /locus_tag="D11S_0782"
FT   CDS_pept        706295..707674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="D11S_0782"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82179"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570023.1"
FT                   /protein_id="ACX82179.1"
FT                   /translation="MITLSLSQIAAILGAELMGDGTVIVENVSTDSRQAVNKGLFFALK
FT                   GENFDAHHYVAKAAEQGCVAAVVEHPTEGNIARLIVKDSRLALGRLAKWLREKINPKVV
FT                   AMTGSSGKTTVKEMVASILQQSAVDSDDVLFTQGNFNNDIGVPLTLLRLTEQHKFAVIE
FT                   LGANHIGEIAYTTSLAQPDVALVNNVMAAHLEGFGSLDGVATAKGEIFRGLTENGVAII
FT                   NLAHNYQQKWQADIGRHAVQYFAYDNPRADFYAEQIHFSEQGAYFLLHTPQGRVQINSP
FT                   YLGEHNISNALAATALAMNVGATTAQVKKGLETPSLVKGRLFPIQPCENLLLLDDTYNA
FT                   NVGSMKSAISVLQKYPAFRVFVVGDMGELGDNAQLCHQEVGEFAHAAKLDLVLSFGCSS
FT                   GVISAVNSGRHFTDKTELVTYLTPIIQQQLAQQKVVVLVKGSRSMKMEEVIDLLKGNFL
FT                   C"
FT   gene            707668..708753
FT                   /locus_tag="D11S_0783"
FT   CDS_pept        707668..708753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0783"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82180"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704247.1"
FT                   /protein_id="ACX82180.1"
FT                   /translation="MLVWIAEFLTKYYSSFHVISYITVRAILALLTALLVSLWIGPKVI
FT                   RRLQMLKFGQVVRNDGPESHFAKKGTPTMGGVMILFAIGVSTLLWADLRNPYVWFSLFV
FT                   LFGYGTVGFVDDYRKITRKSTDGLIARWKYFWLSVVALVAIFGMYAMGKDTDATRLVVP
FT                   FFKEFMPQLGVFYIVLSYFVIVGSSNAVNFTDGLDGLAIMPTVLVAGAFALVAWATGNI
FT                   NFAEYLHIPYIKFSAELVVFCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVIA
FT                   VLVRQEFLLLIMGGVFVMETLSVILQVGSYKLRNKQRIFLMAPIHHHFEKKGWPEPRVI
FT                   VRFWIISLMLVLIGLVTLKLR"
FT   gene            708780..710084
FT                   /gene="murD"
FT                   /locus_tag="D11S_0784"
FT   CDS_pept        708780..710084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="D11S_0784"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /EC_number="6.3.2.9"
FT                   /note="UDP-N-acetylmuramoylalanine--D-glutamate ligase;
FT                   involved in peptidoglycan biosynthesis; cytoplasmic;
FT                   catalyzes the addition of glutamate to the nucleotide
FT                   precursor UDP-N-acetylmuramoyl-L-alanine during cell wall
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82181"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573810.1"
FT                   /protein_id="ACX82181.1"
FT                   /translation="MQYQDKKVTVIGLGKTGLSCVDFLRAKQADVRVIDTRQHPAGAEQ
FT                   LDKAIPLHTGGLNQQWLLESDLIVISPGLAVKTPEIQTALQAGVEVVGDIELFCREADK
FT                   PIVAITGSNGKSTVTTLVAEMAKAAGLRVGMGGNIGIPALSLLNQQHDLYVLELSSFQL
FT                   ETTYSLKAVAATVLNVTEDHMNRYVDLQDYRHAKLNIYNHCQTAVINAEDALTLPTTQR
FT                   PQKQVSFGENHADYWLKTENNKTYLMAYDEAVLACDEMKLTGRHNYMNALAAIALAQAA
FT                   GINLTGIRTALCAFGGLEHRFQVAHIADGVRWINDSKATNVGSTVAALTGLQVAGKLHL
FT                   LLGGDGKGADFSELARLINQPHIYCYCFGRDGKQLAALSSQSQLFDTMEHAIAAIRPQL
FT                   QAGDMVLLSPACASLDQFSCFEARGDEFTRLSRLS"
FT   gene            710099..711289
FT                   /locus_tag="D11S_0785"
FT   CDS_pept        710099..711289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0785"
FT                   /product="cell division protein FtsW"
FT                   /note="integral membrane protein involved in stabilizing
FT                   FstZ ring during cell division"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82182"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539056.1"
FT                   /protein_id="ACX82182.1"
FT                   /translation="MGFWDRFKESSQNATTVAPTSLLYDRALLWLYLVLLLIGLLAVSS
FT                   ASIPVGTRLYNDAFYFVKRDIIYIILSCFTCYITLQISMEKWQKWHARLFWVAIILLVL
FT                   VMIPGIGREVNGARRWIPMGLFNFQPAEFAKLALTCFLASYFTRRYDEVRSRKLSAFKP
FT                   FVVMGVMGCFLIVQPDLGSTVVLFIITFGLLFIVGANFWQFIGLISMGVFMFVWLVLSS
FT                   AYRLKRIIGFMDPFKDPYDTGFQLSNSLMAFGRGGFFGEGLGNSILKLEYLPEAHTDFV
FT                   MAIVGEEFGFFGIFVIIILLGLLVFRAMKIGRESLMLEQRFKGFLAFGISFWIFFQGFV
FT                   NLGMALGMLPTKGLTFPLISYGGSSIIIMSVTIGMLLRIDHENRLMRGGQARLRDD"
FT   gene            711330..712394
FT                   /locus_tag="D11S_0786"
FT   CDS_pept        711330..712394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0786"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-UDP acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82183"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566714.1"
FT                   /protein_id="ACX82183.1"
FT                   /translation="MGKKLLVMAGGTGGHVFPAIAVAQELQQQGWEIRWLGTKDRMEAQ
FT                   LVPKHGIPIEFIQISGLRGKGIKSLLLAPFAILRAVCQARNIIKQYQPNAVLGMGGYVS
FT                   GPGGLAAKLCGVPVVLHEQNAIAGLTNSGLSKIATRVLQAFPNAFPHAEVVGNPVRRDL
FT                   FQTEAPQQRFAARNKTLRILVVGGSQGARVLNQTVPQVAVKLTAQGLDIYVRHQVGKGN
FT                   LAGIEEVYQANHNGVATEFIDDMAEAYAWADIVICRSGALTVCELAAVGTPAIFVPFQH
FT                   KDRQQFLNAKYLADAGAAVIIEQPEFTEERLLREITPLLADREKLLTMALNAKKMATPR
FT                   AAKRVAEVIEDVAS"
FT   gene            712465..713895
FT                   /gene="murC"
FT                   /locus_tag="D11S_0787"
FT   CDS_pept        712465..713895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="D11S_0787"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="Catalyzes the formation of
FT                   UDP-N-acetylmuramoyl-L-alanine from UDP-N-acetylmuramate
FT                   and L-alanine in peptidoglycan synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82184"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546777.1"
FT                   /protein_id="ACX82184.1"
FT                   /translation="MENYHQQIRNIIPEMRRVKQIHFIGIGGAGMCGIAEILLNEGYSI
FT                   SGSDIAESAVTQCLTKAGAKVFIGHQAENIVGASVVVISSAIHGDNPEVMAAKEARIPV
FT                   IQRAQMLAELMRFRHGIAVAGTHGKTTTTAMVSMIYAEAGLDPTFVNGGLVKSAGTNAH
FT                   LGCSRYLIAEADESDASFLHLQPMISIVTNIEPDHMDTYHGDFDEMKQTYVNFLHNLPF
FT                   YGLAVLCADDEVLMELVPLVGRQVITYGFSENADYRIEDYQQTGFQGHYTVICPNGERI
FT                   DVLLNVPGRHNALNATAALVVAKEEGIKNDAILAALADFQGAGRRFDQLGQFIRPNGKV
FT                   MLVDDYGHHPTEVGVTIQAARQGWENKRIVMIFQPHRYSRTRDLFDDFVQVLSQVDALI
FT                   MLDVYPAGEAPIVGADSKALCRSIRNLGKVDPILVSDTEQLGEVLDQIIQDGDLILAQG
FT                   AGSVSKLSRQLVECWTKE"
FT   gene            713908..714837
FT                   /locus_tag="D11S_0788"
FT   CDS_pept        713908..714837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0788"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82185"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539062.1"
FT                   /protein_id="ACX82185.1"
FT                   /translation="MSKTLKQEKIAVLLGGTSAEREVSLNSGEAVLNALRKQGYDAHPI
FT                   DPKTFPVATLKEQGFDRVFNILHGRGGEDGTMQGLLEQIGIPYTGCGVMTSALTMDKMR
FT                   TKMLWKAFGLPVAEMEIVTTENRVNLNPESVVKKLGLPLMVKPSLEGSSVGLTKVKAVD
FT                   ELESAVDFALKFDNTVLIEEWLAGDEFTVPVLDNEVLPSIKIVPEGEFYDYDAKYISDN
FT                   TQYFCPAGLSEEREQELRRLVKQAYDVVGCRGWSRIDVMADAEGKFRLVEVNTNPGMTS
FT                   HSLFPKSAATVGYSFAQLVEKILELSAE"
FT   gene            714834..715601
FT                   /locus_tag="D11S_0789"
FT   CDS_pept        714834..715601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0789"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82186"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717319.1"
FT                   /protein_id="ACX82186.1"
FT                   /translation="MNLLKRKTPQNIRYGEPKSKVFVQIKLLLVLLCVGILFYSCSNWQ
FT                   NFLEKLDSKPISAFALVGTPNFTDDADVREALLKMGELKGFFGQDADLIREQIETMPWI
FT                   KGAVVRKMWPNRLSIWVTEYQPVAIWNETEFLSKDGVVFQLPMNKLKEQHLPRLSGPDF
FT                   QSEKVLDAWNRIYADLKQKGLTLKAVAIDARGAWQVVLDNDVVLKLGRGEWKTKLDRFV
FT                   TIYPQIEVPENKKLSYVDLRYASGASVGMVDLN"
FT   gene            715626..716906
FT                   /gene="ftsA"
FT                   /locus_tag="D11S_0790"
FT   CDS_pept        715626..716906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="D11S_0790"
FT                   /product="cell division protein FtsA"
FT                   /note="ATP-binding involved in recruitment of FtsK to Z
FT                   ring; essential cell division protein; colocalizes with
FT                   FtsZ through direct interaction to the septal ring
FT                   structure; structurally similar to eukaryotic actin; binds
FT                   directly to the cell membrane"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82187"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005539067.1"
FT                   /protein_id="ACX82187.1"
FT                   /translation="MSKIVESKTIVGLEVGTSKVVAVVGEVLPDGVVNVLGVGSCPSKG
FT                   IDKGSITDLNAVVISIQRAIEAAESVADCRIMSVTLAITGEHIQSLNENGFVPIAEGEV
FT                   TQDEIDSAIHTASSVKMPEGLSLLHIIPQEFAVDKQMNIKNPLGLQGVRLKAQTHLIAC
FT                   HQDWLNNLKKAVERCKLKVDKIVFSGLASSYSVLTEDEKDLGVCLIDFGAGTMDIMVYI
FT                   NGALRFSKVIPYAGNRVTDDIAYACATSRMEAESIKVNHGSALTPPKYHADKKIEVSSI
FT                   GGRGPRTLTKEQLSLVTSARYKELLSLVKNELIYLKTDLEAKHIKFDLIAGVVITGGGA
FT                   QIEDLKDSAAEVFGQNAQVRIGSPLNITGLTDYVNKPQYATVIGLLQYEHSNEDEGPLN
FT                   DENSDSGFFSACGKVVKKIFNKVRSEF"
FT   gene            716990..718273
FT                   /locus_tag="D11S_0791"
FT   CDS_pept        716990..718273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0791"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82188"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005570039.1"
FT                   /protein_id="ACX82188.1"
FT                   /translation="MFEPVDYDLGEMNGALIKVVGVGGGGGNAVNHMVATMVKDDIGGA
FT                   LVDETMLNTDEHGKIMFYAINTDAQALRKSQVQQTVQIGANTTKGLGAGANPNVGRKAA
FT                   EDDQDAIRQMLEGADMVFIAAGMGGGTGTGAAPIVAQIAKELGILTVAVVTKPFAFEGK
FT                   KRMMFAEMGIKELSKHVDSLIIIPNEQLAKVMPKNATLMQAFSAANDVLRNSVTGISDM
FT                   ITSPGLINVDFADVRTVMSEMGQAMIGFGSALGSPGEGRAEDAAKIAVKSDLLERVDLS
FT                   GARGVLVNITAGMDLGLTEFQAVGDTIKAFASDEATVVVGTTLVPDMVDEIRVTIVATG
FT                   IGEPEAPEIQISPRPQAAPNNQPINTQFGAPRTNAPTYGHSAQDANNLSNNQQNVQRSR
FT                   DDLDTPITERLKDTNLFNVQGFMRNGDK"
FT   gene            718311..719228
FT                   /gene="lpxC"
FT                   /locus_tag="D11S_0792"
FT   CDS_pept        718311..719228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="D11S_0792"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="zinc-dependent; catalyzes the deacetylation of
FT                   UDP-(3-O-acyl)-N-acetylglucosamine to
FT                   UDP-3-O-(3-hydroxytetradecanoyl)-glucosamine in the second
FT                   step of lipid A biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82189"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577888.1"
FT                   /protein_id="ACX82189.1"
FT                   /translation="MIKQRTLKQSIKVTGVGLHSGDKVTLVLRPAMPNTGVVYCRTDLN
FT                   PPVTFPANANAVHDTMLCTCLVNEQGVRISTVEHLNAALAGLGIDNIIVEVDAPEIPIM
FT                   DGSASPFIYLLLDAGIEEQNAPKKFIRVKQKVRVEDGDKWAEFSPYNGFRLNFTIDFNH
FT                   PVISEDVRNYVMDFSAQAFVQQISRARTFGFMKDIEYLQSQGLALGGSLDNAIVLDDYR
FT                   ILNEDGLRFKDELVRHKMLDAIGDLYMCGYNIIGDFKAYKSGHGLNNKLLRAVLDNQEA
FT                   WELVTFEDKEQVPQGYISPAQILI"
FT   gene            719426..720587
FT                   /pseudo
FT                   /gene="pheA"
FT                   /locus_tag="D11S_02475"
FT                   /note="chorismate mutase; disrupted"
FT   gene            720721..722601
FT                   /locus_tag="D11S_0795"
FT   CDS_pept        720721..722601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0795"
FT                   /product="heat shock protein 90"
FT                   /note="molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0795"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82192"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167635.1"
FT                   /protein_id="ACX82192.1"
FT                   /translation="MSTNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAAD
FT                   KLRFKALSNPDLYAGDGELRVCISFDSEKGTLTVSDNGIGMTREQVIDHLGTIAKSGTK
FT                   EFLAALGSDQAKDSQLIGQFGVGFYSAFIVADKVTVKTRAAGEPADKGVLWESAGEGDY
FT                   TVADIEKKSRGTDVILHLRDDEKEFLNEWRLRDIIGKYSDHIGLPVEMLTKEYEDEGKE
FT                   IGEKWEKINKSDALWMRSKNEISDEEYKEFYKHLSHDFADPLLWAHNKVEGNQEYTSLL
FT                   YVPSKAPWDLFNREHKHGLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLNVSRE
FT                   ILQDNKVTAALRKALTKRSLQMLEKLAKDDAEKYQQFWKEFGLVLKEGPAEDFANKEAI
FT                   AKLLRFASTHNDSSEQNVSLEDYVSRMKEGQKAIYYITADSYVAARNSPHLELFNKKGI
FT                   EVLLLSDRIDEWMLSYLTEFDGKPLQSITKADLDLGDLADKEAEEQKAQDESFGSFVER
FT                   VKTLLGGRVKEVRLTHRLTDTPAVVSTDNDQMTTQMAKLFAAAGQPVPEVKYTFELNPE
FT                   HHLVKKVAEIADEAQFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG"
FT   gene            722667..723011
FT                   /locus_tag="D11S_0796"
FT   CDS_pept        722667..723011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0796"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82193"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546759.1"
FT                   /protein_id="ACX82193.1"
FT                   /translation="MIIVYGIKNCDTVKKALKWLADHQIEHKLHDYRVDGLDKASLQQA
FT                   EAQFGWENLVNKRSTTWRNLDEQIKKTLSKSTALSVLADNPTLIKRPIILQEGKALIGF
FT                   SEKEYQAAFN"
FT   gene            723148..724281
FT                   /locus_tag="D11S_0797"
FT   CDS_pept        723148..724281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0797"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0797"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82194"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549421.1"
FT                   /protein_id="ACX82194.2"
FT                   /translation="MKEKVVSLAQALIRLPSISPNDEGCQQLIAERLEKLGFQIEWLPF
FT                   NDTLNLWAKHGSGDPVIAFAGHTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGS
FT                   LAAMVVATEEYVKAHPNHQGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGE
FT                   PSSTQTLGDVVKNGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDN
FT                   GNDFFPPTSLQIANIHAGTGSNNVIPGELYVQFNLRYCTEVTDGMIKQKVAEMLEKHGL
FT                   KYRIEWNLSGKPFLTKPGKLVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVE
FT                   FGPLNATIHKVNECVSVEDLGKCGQIYHQMLVNLLEH"
FT   gene            724283..724963
FT                   /locus_tag="D11S_0798"
FT   CDS_pept        724283..724963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0798"
FT                   /product="peptidase M15"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82195"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005560555.1"
FT                   /protein_id="ACX82195.1"
FT                   /translation="MSLTPEMLCGKSREHLVNLPIPHSPNHFLQAQAAKAFQGLQKSAV
FT                   KNGFNLQPASSFRDFARQQLIWNGKFNAERKVHDDAGKALDLTKLNDWQKCQVILRWSA
FT                   LPGASRHHWGTEIDIFDPDLLPPGQALQLEPWEYEQGGYFFGLSEFLAENLPHFDFVLP
FT                   FMKMPEGKKIGHEPWHISYVPLAEKAKQQFSAAVLLQAWENEDIAGKAVLQQNLPQIFE
FT                   QYFV"
FT   gene            725209..725832
FT                   /gene="nudF"
FT                   /locus_tag="D11S_0799"
FT   CDS_pept        725209..725832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="D11S_0799"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="ADP-sugar pyrophosphatase; catalyzes the formation
FT                   of D-ribose 5-phosphate from ADP-ribose; can also act on
FT                   ADP-mannose and ADP-glucose"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0799"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82196"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546754.1"
FT                   /protein_id="ACX82196.1"
FT                   /translation="MYQFQQFTQSDIEIVKDETVYQGFFKLNKVQFRHKLFNGGWSGIV
FT                   TRELLLKGAASAVVAYDPVLDKVVLVEQVRIGAYDPKLQQSPWLLELIAGMVEEGETPE
FT                   NVALRESEEEAGAQISHLQHCLSVWDSPGGVLERIHLFVGNVDSTNIGGIHGLAEENED
FT                   IRVHVVSRETSYQWICEGKIDNGIAVMGLQWLELNYRKLQAQWL"
FT   gene            725883..726707
FT                   /locus_tag="D11S_0800"
FT   CDS_pept        725883..726707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0800"
FT                   /product="3',5'-cyclic-nucleotide phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0800"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82197"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005704224.1"
FT                   /protein_id="ACX82197.1"
FT                   /translation="MLNTYKYDTRQEVFRVIQITDPHLFKDATGELLGVNTQESFSQVL
FT                   SEIRQQSYDYDLVLATGDLVQDSSEEGYLRFCESVKPLEKTVFWIPGNHDFQPKMFDIL
FT                   KRDNICDKKHILLGENWQILLLDSQIAGVPHGQLGQYQLDWLMAKLKEHPQRYSLVVLH
FT                   HHILSTHSAWLDQHNLRNAHELAYTLAPFNNVKGILYGHIHQQVDGEWNGYKIMATPST
FT                   GIQFKPDSNTFALDTAQPGWREIELYADGRIETRVKRIQHKTFLPNLQEEGY"
FT   gene            complement(727215..728039)
FT                   /locus_tag="D11S_0802"
FT   CDS_pept        complement(727215..728039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0802"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82199"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546751.1"
FT                   /protein_id="ACX82199.1"
FT                   /translation="METQKPDNLITERDKHHEKLMVSILKNLTDTPLVLKGGTALYLGY
FT                   GLNRFSEDLDFDSSKKLNLLNKIKASAPHGIVIDDINVKKDTDTVSRYIVNYHIRDTGV
FT                   KDALKMEISYRTPASDDQITVKDGIRFSSVERIIDNKLHAAYDSDNTRTKGRDLFDLHF
FT                   LAKQYPEAFTPELAERLKGFAQDPDKLVSLYSQNIQADPLLNKIMDVEQIALELNKMAE
FT                   TIYFTQQMQNHPAMQASMPNAKKQFKALLDEAKNKKEETTQNVVPSSLKMKL"
FT   gene            complement(728012..728476)
FT                   /locus_tag="D11S_0803"
FT   CDS_pept        complement(728012..728476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0803"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82200"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542742.1"
FT                   /protein_id="ACX82200.1"
FT                   /translation="MLYIPQTNPGRYVSSIVALNVHSPNGTGDWHSAAALNDDAYPQDF
FT                   YIYGESQKRNTNHLLGNLGVIDGTQRLNEMGYYPENYPVWLADHPRACVDYLYTAVLQT
FT                   GSLGEVMLDEWFPSDEDKQSVYDLLNQLEPNLTEQERENLQLWKRKNPII"
FT   gene            728831..729535
FT                   /locus_tag="D11S_0805"
FT   CDS_pept        728831..729535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0805"
FT                   /product="7-cyano-7-deazaguanine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82202"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005588007.1"
FT                   /protein_id="ACX82202.1"
FT                   /translation="MSNQPNKALVIFSGGQDSTTCLFLAMQEFGAENVEVITFQYGQRH
FT                   VIELEKARWIAQDLKVKQTVLDTSVIKAITHNALMDPNAPISQKDNELPNTFVDGRNAL
FT                   FLLYAAIYAKSQGIRVIYTGVCETDFSGYPDCRDVFVKSMNVTLNLAMAYPFEIRTPLM
FT                   WLDKKETWALADQLGAFDYIRRHTHTCYNGVEGGCGECPSCVLRERGLKAYLPEREEKC
FT                   LRKQPHFRGSNI"
FT   gene            729653..730867
FT                   /locus_tag="D11S_0806"
FT   CDS_pept        729653..730867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0806"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0806"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82203"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546745.1"
FT                   /protein_id="ACX82203.1"
FT                   /translation="MYLSRQIQPLVSRLLKQFPAVLVTGARQVGKSTLLKHIAKDYAYL
FT                   TFDDPLLLEQAKQEPRLFFLNHAGNVILDEVQYAQELFSLLKLEIDKQQKNGMFLLSGS
FT                   QAFELMQNVSETLAGRIAILKLQGLSLREILNVEFYLPFIPSRDYLASREKMLKSPENI
FT                   WQIIHKGDMPRLYQQETDWEIYYSSYVSTYIERDVRQLTNITNTTDFTRFMVALASRSG
FT                   ELLNYSNVAQEVGVSNETIKRWTAILQTSGIIYLLQPYSNNHLKRTIKTPKIYFLNTGL
FT                   MAYLTKWLTPETISKGAKSGQFFESFVVSEIIKSFTNNGIEPPLYFYRNTNQKEIDLII
FT                   EYDRTIYPIEIKTTANPNKKMAKSFALLNSLGKESTIGLGVIINQYPNKHYLAENLVAL
FT                   PVRYL"
FT   gene            complement(730946..731974)
FT                   /locus_tag="D11S_0807"
FT   CDS_pept        complement(730946..731974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0807"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0807"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82204"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546742.1"
FT                   /protein_id="ACX82204.1"
FT                   /translation="MIPKTYLAMQTTPQGDLVLTEKQTVLPTAHQVLIQVEACGVCGAD
FT                   LGDIKHNLQTPRVIGHEVVGWLLAKGEAVSKRWQVGQRVGVGRLGGHCHECDACRAGQF
FT                   VHCAHQSYIGASRDGGYAELMIVNQTGLVAIPESLNSTDAAPLLCAGLATFNALRNSDT
FT                   KAGDTVAVLGTGGLGHLAVQYAQKMGFEVVSIGRQDLSEKMTSLGAHHYVNLAKQSAVD
FT                   FLRELGGADLILSTITDAETIGDVAKSLKARGKLLLLGASGEPLALPLNRIVGKEQRIQ
FT                   GSLTGTPFDAECTLKFSVLSGVKPQVEIFPLTKANEAIARLKSGKARFRIVLNVNQNKT
FT                   TP"
FT   gene            732245..734392
FT                   /gene="rlmL"
FT                   /locus_tag="D11S_0808"
FT   CDS_pept        732245..734392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmL"
FT                   /locus_tag="D11S_0808"
FT                   /product="23S rRNA methyltransferase"
FT                   /note="catalyzes the N2-methyl guanosine modification of
FT                   the G2445 residue of 23S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82205"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546739.1"
FT                   /protein_id="ACX82205.1"
FT                   /translation="MKQLFATTARGFEELLKSELTDLGARDAKVTQGGVHYWADDETLY
FT                   RTLLWSRLSSRILLPIVQAKVFSDLDLYSAVVGVNWLDYFDEKVHFFVDFNGTNQEIRH
FT                   TQFGAMRVKDGIVDYFERHGRARPNVDKEQPDIRIHAYLNRDEVVLSLDLSGDALHMRG
FT                   YREDTGKAPLRETLAAAIVMRSGWQQGTPLVDPMCGSGTLLIEAAQMEAKIAPQLYRLH
FT                   WGFDFWRGHNQAVWEKVKEEALALVDAEKQRENPLHFYGFDLDHRVLQKAKQNAKSAGV
FT                   AHLMQWQQGDVAALKNPSPNTTGTVICNPPYGERLGTTPALIALYSVFGQRLKQQFAGW
FT                   NASVFSGEPSLLDCLRLRSHRQFKAKNGPLDCVQKNYQLAERAAQSAVENAAEFDRTSA
FT                   ASAHVAPGFANRLQKNIKKIEKWAKQQGLDAYRLYDADLPEYNLAVDRYADHIVVQEYA
FT                   APKNIDENKARQRLLDAVNATLNVTGVETNKLILKVRQKQKGTNQYEKLANKGEYFYVN
FT                   EYGAKLWVNLTDYLDTGLFLDHRLTRKMLGEMAQGKDFLNLFAYTGSATVHAALGGAKS
FT                   TTTVDMSNTYLNWAEQNLLLNDIEGKQHKLIQADCLQWLEKCDRQFDLIFVDPPTFSNS
FT                   KRMEDSWDVQRDHIKLMTNLKRILRPNGTIVFSNNKRGFKMDFVGLEALGLSAVEISRK
FT                   TLPLDFERNKQIHNCWVVQAK"
FT   gene            complement(734489..734833)
FT                   /locus_tag="D11S_0809"
FT   CDS_pept        complement(734489..734833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0809"
FT                   /product="fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0809"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82206"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557615.1"
FT                   /protein_id="ACX82206.1"
FT                   /translation="MVNQNPKRSNEPPVWLMFSAGGMVSGLAFPVLILIIGLLLPFGLV
FT                   SPDNIIAFAHHWFGKLVILVLTIFPMWAGLHRVHHGMHDIKVHVPAGGFIFYGLATLYS
FT                   IIVLFAVCNI"
FT   gene            complement(734843..735235)
FT                   /locus_tag="D11S_0810"
FT   CDS_pept        complement(734843..735235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0810"
FT                   /product="fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0810"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82207"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717357.1"
FT                   /protein_id="ACX82207.1"
FT                   /translation="MTTTVTKRKKYVREITPTWWKSWDFYKFYMVREATALPTVWFSLV
FT                   LLYGVICLGKADGFIASFIPFLQNPIVVILNIISLAALLLHAVTLFDMTGEVMSGSTGL
FT                   PPTLIKNALRGLFVAVTVLALVLVFI"
FT   gene            complement(735247..736017)
FT                   /locus_tag="D11S_0811"
FT   CDS_pept        complement(735247..736017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0811"
FT                   /product="fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0811"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82208"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542716.1"
FT                   /protein_id="ACX82208.1"
FT                   /translation="MAEQPIMNVEILRYNSEVDKEPHLKTYQVPFDSQTSLLDALGYIK
FT                   DKLEPELSYRWSCRMAICGSCGMMVNNIPKLACKTFLRDYSGHMRIEPLANFPIERDLV
FT                   VDLSHFIESLEAIKPYIIGNKMPELDGKPHPSKELAKSRTKQTPAQLEKYRQFSMCINC
FT                   GLCYAACPQFGLNPEFVGPAALTLAHRYNLDNRDHGQAERMKIMNGENGVWSCTFVGAC
FT                   SEVCPKHVGPATAINQGKLESAKDYLISMLKPKA"
FT   gene            complement(736022..737830)
FT                   /locus_tag="D11S_0812"
FT   CDS_pept        complement(736022..737830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0812"
FT                   /product="fumarate reductase"
FT                   /note="part of four member fumarate reductase enzyme
FT                   complex FrdABCD which catalyzes the reduction of fumarate
FT                   to succinate during anaerobic respiration; FrdAB are the
FT                   catalytic subcomplex consisting of a flavoprotein subunit
FT                   and an iron-sulfur subunit, respectively; FrdCD are the
FT                   membrane components which interact with quinone and are
FT                   involved in electron transfer; the catalytic subunits are
FT                   similar to succinate dehydrogenase SdhAB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0812"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82209"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542714.1"
FT                   /protein_id="ACX82209.1"
FT                   /translation="MQTVNVDIAIVGAGGGGLRAAIAAAQANPNLKIALISKVYPMRSH
FT                   TVAAEGGAAAVIKEEDSYDKHFHDTVAGGDWLCEQDVVEYFVEHSPVEMTQLERWGCPW
FT                   SRKTDGDVNVRRFGGMKIERTWFAADKTGFHLLHTLFQTSIQFPQIIRFDEHFVLDILV
FT                   DDVHARGMVAMNMMEGTLVQINANAVVIATGGGCRAFRFNTNGGIVTGDGLSMAYRHGV
FT                   PLRDMEFVQYHPTGLPNTGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPIGKPENK
FT                   YMELGPRDKVSQAFWQEWRKGNTLKTAKGVDVVHLDLRHLGEKYLHERLPFICELAKAY
FT                   EGVDPAQAPIPVRPVVHYTMGGIEVDFNSETRIKGLFAVGECASSGLHGANRLGSNSLA
FT                   ELVVLGRVAGKYAAQRAVETTPANQAAVDAQAQDIVNRLNALYDQEGTESWSDIRDEMG
FT                   QAMEEGCGIYRTQESMQQAVDKIAELKERYKHIRITDRSSVFNTNVLYTVELGYILDVA
FT                   QSIANSAIERKESRGAHQRLDYTERDDVNYLKHTLAFYNENGAPRIEYSPVKITKSQPA
FT                   KRVYGAEAEAAEAAAKAKEQAQAGKE"
FT   gene            738138..739109
FT                   /locus_tag="D11S_0814"
FT   CDS_pept        738138..739109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0814"
FT                   /product="elongation factor P--(R)-beta-lysine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0814"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82211"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005720696.1"
FT                   /protein_id="ACX82211.1"
FT                   /translation="MLEQEQWQPTASIKNLLARAKFMAEIRRFFTDRGLLEVETPVLSE
FT                   FGVTDVHLATFSTEFISPFGEQSKKLWLSTSPEYHMKRLLAAGSGPIFQIGKVFRNEEA
FT                   GNRHNPEFTMLEWYRPHFDMYRLINEVDDLLQQILECPPAESMSYQFAFQQYVGLDPLS
FT                   AEHEELVEKAKKYQLMNAEEENRDTLLQFLFSAVVEAQIGQESPVVVYHFPASQAALAQ
FT                   ISSEDLRVAERFEFYYKGLELANGFHELSDAREQLRRFEQDNHQREKMGLPPQTIDTRL
FT                   LSALQAGIPNCSGVALGVDRLLMIAMGAESIKEVISFAIDNA"
FT   gene            complement(739175..739942)
FT                   /locus_tag="D11S_0815"
FT   CDS_pept        complement(739175..739942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0815"
FT                   /product="iron ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0815"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82212"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005571279.1"
FT                   /protein_id="ACX82212.1"
FT                   /translation="MSIVINNLQLGYQNKIIVQDLSLDFPHNQVIALIGPNGCGKSTTL
FT                   KAIARLLKPRTGKITHHGKDIWQSTPKEYAKALSFLPQQHLVPEGIKVRELIAYGRSPY
FT                   LNLWGKLNDKDEALVTWSMEQTHTTELANRLVSDLSGGQQQRVFLAMTLAQDAELVLLD
FT                   EPTTYLDLNRQAELMGMMRQMQQNGKTVITVLHDLNQACRYCDYLVVLKDGNLMAKGTP
FT                   DEVMSEELLKTVFDLDVEIHRDPVSQTPMFILK"
FT   gene            complement(739942..740925)
FT                   /gene="fecD"
FT                   /locus_tag="D11S_0816"
FT   CDS_pept        complement(739942..740925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD"
FT                   /locus_tag="D11S_0816"
FT                   /product="iron-dicitrate transporter subunit FecD"
FT                   /note="Ferric citrate binds FecA and is transported across
FT                   the outer membrane while transmits a signal across the
FT                   cytoplasmic membrane protein FecR. FecR transmits a signal
FT                   across the membrane and activates the cytoplasmic FecI that
FT                   directs the RNA polymerase to express the fecABCDE operon
FT                   (which encodes the ferric citrate outer membrane receptor
FT                   and the ferric citrate ABC transporter), as well as fecIR.
FT                   FecD is one of two (along with FecC) integral membrane
FT                   protein components of the iron dicitrate ABC transporter."
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0816"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82213"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005590448.1"
FT                   /protein_id="ACX82213.1"
FT                   /translation="MKNAYHKLLSLGFYPFAVVAVIALFILSLRLGTYTLSFSEIVAAF
FT                   NSDDKNHFTLIEYRLPRALLAIFIGGTLAISGVLVQSVVRNPLASPDILGINNAAGLVA
FT                   IAILIFLPNLAFYWIPFFAFIGGILSFILLWVICGFNFRPIRMAIIGVAISALWAAINH
FT                   YVMLTNPVEINTAMLWLTGSLWGRSWTYANVVLPWLFLLLPLPFIFCRDLDTLGLGENK
FT                   AATLGIHVNKTQIFVLVLAVALSTTAVAICGPIAFLGLVAPHLARKLVGGRHRTLLPAA
FT                   LLIGALLLQISDILARVIDPPTELPAGILTAIIGAPYFFYLLMRTK"
FT   gene            complement(740925..741914)
FT                   /gene="fecC"
FT                   /locus_tag="D11S_0817"
FT   CDS_pept        complement(740925..741914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecC"
FT                   /locus_tag="D11S_0817"
FT                   /product="iron-dicitrate transporter permease subunit"
FT                   /note="part of the FecBCDE citrate-dependent iron (III)
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0817"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82214"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005549771.1"
FT                   /protein_id="ACX82214.1"
FT                   /translation="MLSTTVRWGLPIILLAFLLWGSLFLYYPIAIAPLDALNAFLPDGD
FT                   DLAKITVVGLRFPRALVAIALGANLAVAGALLQTVTRNPLASPSLLSVNSGAGLAMVIA
FT                   SVLSPSLLSGYSIALIASIGGGISWLTVMLISNAWHDNSGDRSRVILAGIAVSLLCAAA
FT                   TKLLLIVADDNAFGVMSWLAGGISHARWKEWHIIWPFLLSSALFCLFFASKLNLLNLSD
FT                   ESARSLGINLFRLRWYANIMALLIVGSAVSVAGPVAFIGLLIPHLARYWIGYDLRKSLP
FT                   MSMLLGAMLMLIADTMARAVNFPNEVPAGAVLALIGAPVFVLFARGRR"
FT   gene            complement(741914..742807)
FT                   /gene="fecB"
FT                   /locus_tag="D11S_0818"
FT   CDS_pept        complement(741914..742807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecB"
FT                   /locus_tag="D11S_0818"
FT                   /product="iron-dicitrate transporter substrate-binding
FT                   subunit"
FT                   /note="part of the ABC transporter involved in the uptake
FT                   of citrate-dependent Fe(3+)"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0818"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82215"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546719.1"
FT                   /protein_id="ACX82215.1"
FT                   /translation="MKNFLKATFASLLFIGSTHAGAVTVTDAKGEFTIDQTPTRIVALE
FT                   YSFVDALAQVGVSPVGVADDNNKERILKEVRDKIKPWQSVGTRSQPSLEAIAALKPDLI
FT                   IADPSRHTAVYGELKKIAPTMMFDSRHESYQENLETAQKIGDVLGKGGEMKLQINKHNQ
FT                   YIDNIAKSINVKGQKGVFGTSREDKFNLQNDNGYVASFLGVLGFETPKLPNSTQAFVEI
FT                   NLEQLVMEKPDYLFIAHYRQESIARKWESEPLWQAIPAVKAKQVLSVDADMWARGRGMA
FT                   ASEIMAKQVEQFVQQK"
FT   gene            complement(742877..743947)
FT                   /locus_tag="D11S_0819"
FT   CDS_pept        complement(742877..743947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0819"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0819"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82216"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542697.1"
FT                   /protein_id="ACX82216.1"
FT                   /translation="METRYYITMLAAMLALQFMLFGFSQTLNWIFNLNGKTRRTLTIVL
FT                   FLGLNALVLSAPLRLYTESFRVSALILTLLLFSTFSSLIVGFLYSLRKKWRHSLKWLYP
FT                   ILFLSFITVGLYNAYTPVVRHYQVHLDKSMKPLRIGMASDTHLGKFFGGKQLDKLADIM
FT                   QREKVDIILLPGDIMDDNVNAYLAEKMQPHLAKLKAPLGVYATLGNHDFFGDQARIERE
FT                   IRKAGIIPLMDESLVVDNRFVLIGRNDDLVTNRPSTEQLLKGVDTNLPIILLDHRPSEI
FT                   EQHAKLPIDIQLSGHAHNGQIFPANLIVKFIYRLSYGYEQINGVHFFVTSGYGFWGVPM
FT                   RLGSQSEVMIIDVVGG"
FT   gene            744132..744461
FT                   /locus_tag="D11S_02480"
FT   CDS_pept        744132..744461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_02480"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005762749.1"
FT                   /protein_id="ANN81537.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQDRMQKMQEEIAQLEVTGESGAGLVKIT
FT                   INGAHNCRRVEIDPSLMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMSLPPG
FT                   FKMPF"
FT   gene            744546..745148
FT                   /gene="recR"
FT                   /locus_tag="D11S_0821"
FT   CDS_pept        744546..745148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="D11S_0821"
FT                   /product="recombination protein RecR"
FT                   /note="involved in a recombinational process of DNA repair,
FT                   independent of the recBC complex"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0821"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82218"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012771666.1"
FT                   /protein_id="ACX82218.1"
FT                   /translation="MQTSPLLENLIESLRVLPGVGPKSAQRMAYHLLQRNRSGGMRLAQ
FT                   GLTEAMSKIGHCEHCRTFTEEDVCNICSNPRRQNSGLLCVVETPADILAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPREIGLDLLQKRLQTESFNEVILATNPTVEGDATANYIAELCLQ
FT                   QNVKVSRIAHGIPVGGELEMVDGTTLTHSFLGRREIG"
FT   gene            745180..747117
FT                   /locus_tag="D11S_0822"
FT   CDS_pept        745180..747117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0822"
FT                   /product="DNA topoisomerase III"
FT                   /note="decatenates replicating daughter chromosomes"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82219"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567881.1"
FT                   /protein_id="ACX82219.1"
FT                   /translation="MRLFIAEKPSLGRAIADVLPKPHQRGDGFIKCGENDCVTWCVGHL
FT                   LEQAEPDAYDARFKQWRLEDLPIVPQKWQLIPKKETHKQLKTVEKLVQQADVLVNAGDP
FT                   DREGQLLVDEVFSYLNLSAEKRNAIQRCLISDLNPSAVEKAIKKLQPNRDFVPLATSAL
FT                   ARARADWLYGINMTRAYTIHGRQAGYDGVLSVGRVQTPVLGLIVRRDLEIEHFQPKDFF
FT                   EVLAWVRDPKGEKTPEKPTALFSALWQPSKACEDYQDDDGRVLSRALTENVVKRIADQP
FT                   AEVTDYTDKREKETAPLPYSLSALQIDAAKRFGMSAQEVLDTCQRLYETYKLITYPRSD
FT                   CRYLPQEHFADRMAVMNAISSHLSQFQPLPEIIDPEQKNRCWNDKKVEAHHAIIPTAKN
FT                   RPVGLTSAEQNVYFLIARQYLMQFCPDAEYRKCKITLNIAGGTFVAQARNLQIAGWKQL
FT                   WGKEDSDDEQQDALLPVVKKGQILHCEKGEIVSKKTQPPKPFTDATLLSAMTGIARFVQ
FT                   DKELKKILRETDGLGTEATRAGIIELLFKRGFLYKKGRNIHSTEAGRILINALPDVATQ
FT                   PDMTAHWESQLDGISRKQASYQQFMENLTQLLPELLHYINFSALRELSRHNSGVKKQGI
FT                   KKKTSRITKS"
FT   gene            747278..747628
FT                   /locus_tag="D11S_0824"
FT   CDS_pept        747278..747628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0824"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0824"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82221"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005557589.1"
FT                   /protein_id="ACX82221.2"
FT                   /translation="MYSALLIIYLVVSIALIAFILLQQGKGADAGASFGGGASGTVFGS
FT                   AGAGNFLSRTTAILATIFFIISIVIGNINSHRNNVKQGAFDDLSGTAEQIQQQQQQQAP
FT                   AALDTKNNDIPQ"
FT   gene            747644..747729
FT                   /locus_tag="D11S_0825"
FT   tRNA            747644..747729
FT                   /locus_tag="D11S_0825"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:747678..747680,aa:Leu,seq:gag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            748008..748691
FT                   /locus_tag="D11S_0826"
FT   CDS_pept        748008..748691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0826"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0826"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82222"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019518142.1"
FT                   /protein_id="ACX82222.2"
FT                   /translation="MARLTKPLTNTEVNNAKPKAKEYTLSDGNGLYLLVKPNGSKLWRF
FT                   NYYKPFTQPKKRALIGVGKFPDISLQQAREIREKYLSLLAQNIDPQQHKIRTEQAEQTR
FT                   LLSTFRAVAEHWKESKASNIKALTLKKYWAIVEHYLLPVLADYPVSDITPATAKIALEI
FT                   PYRQGKAEMYRKSVKLLNAILNHAVYFHHQHRRTTPLHDRAFKRAPAQHKRIATNGNLL
FT                   PTLTD"
FT   gene            748714..748965
FT                   /locus_tag="D11S_0827"
FT   CDS_pept        748714..748965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0827"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82223"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573780.1"
FT                   /protein_id="ACX82223.2"
FT                   /translation="MIDTFYREETDSTGLTHRVNGGGKLFNELAKGTNLTQEQTALLKA
FT                   FNQVNGYLIYKFSEVAEQIDQLNIERVEEQKTTDSKMN"
FT   gene            749546..749800
FT                   /locus_tag="D11S_0828"
FT   CDS_pept        749546..749800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0828"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82224"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546555.1"
FT                   /protein_id="ACX82224.1"
FT                   /translation="MKKLSVSLILAGSLLALAGCEEKNMTIYDYLQNEELLNKTSNECI
FT                   SGALNDEHKCQTVKGAYANIDSFKNGSLSEEHLKMLGKK"
FT   gene            complement(750056..750829)
FT                   /locus_tag="D11S_0829"
FT   CDS_pept        complement(750056..750829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0829"
FT                   /product="peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0829"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82225"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167644.1"
FT                   /protein_id="ACX82225.1"
FT                   /translation="MSKKKITKSPLEWLNLRNLKLRRFTFFRKFSTKSAVRFLCRFLLA
FT                   MAVITFAFRFIPIPYSTYMLQQKAAHLFSGDFGYETRYDWVSLDEISWQMQLAVIAAED
FT                   QNFPEHYGFDFSAIKSAFSHNQKSTRIRGASSISQQTAKNLYLWHGQSWLRKAIEVPTT
FT                   LMLETLWSKKRILEVYLNIAEFGNGIYGVEAASRFYFKKSAKNLSQNEAALLAAVLPNP
FT                   IIYKVDAPGLYTKRRQIWIQRQMNQLGKSYLENIN"
FT   gene            complement(750807..751115)
FT                   /locus_tag="D11S_0830"
FT   CDS_pept        complement(750807..751115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0830"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0830"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82226"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546559.1"
FT                   /protein_id="ACX82226.1"
FT                   /translation="MYISRNLEQWNAFLNILQTAFEQGKAQDVLTLLLTPDERDALGLR
FT                   LQIVARLLNKNLPQREIQQNLNTSAATITRGSNMLKTMDPAFVDWIKTQLNEQEKNH"
FT   gene            complement(751148..753364)
FT                   /locus_tag="D11S_0831"
FT   CDS_pept        complement(751148..753364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0831"
FT                   /product="septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0831"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82227"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567875.1"
FT                   /protein_id="ACX82227.1"
FT                   /translation="MRYLKQTTISLLILTALSSSFANQHKATTHKANVAHTHAKPEQHH
FT                   AELERLKQRATFLQLESLLKSAVKNNGVFINQTVFLKLIEDLKGYPLQTDAIAAYFDAC
FT                   IKSVNHDTSKGEVKALKQDIEQFIEKHPTHFLREKLEQRLFTLFINTEDLEGLVGHAQR
FT                   VKPKELETQLAVLNAEYQLGRKRAESDKNPNANVSKIIARYEQLWLNNSELPNDAQLRE
FT                   KWYSDGGRMAEKVYQKAENLFIKNNVKGLELLATELKKAGNVKENEIVASRLQRLQKLL
FT                   KTPASLPELAKLPPVEANNKIMLKFAVLQSFTRYLRTLPENMKEPNFAAYAQWAKDWQL
FT                   SEAEIREWKIAFLGRFFDNESPSFQLWRDVEVAKLNADNLTERRLRMAIRQKTDLTPWL
FT                   NSLSAEGKQKQEWRYWQAKNMAKTNSKKTQEILTALSHERGFYPMLAAAKLDPKTRGSG
FT                   YDFGQPKLLIAPSITDATWADTYKAVNPTLDEIAELRQLDRLGAAKQRWRFLLENLSGE
FT                   NKKEKQIALSQYANQQNWFDLGVDGSIMAKAFNYIQLRLPNAYSDYFDIALSPKFINNN
FT                   KPQAVANNNVTKTFAMAIARQESAWNPQAQSSANARGLMQLLPSTAKATANNAKLPYTG
FT                   EGDLFKPLNNILLGTAHLAELNAKYPNNRILIASAYNAGAHRVEKWLARANGKLAMDEF
FT                   VASIPFYETRGYVQNVLTYDFYYQILQKKEDPQTFSNEEYDRLY"
FT   gene            complement(753570..753866)
FT                   /locus_tag="D11S_0832"
FT   CDS_pept        complement(753570..753866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0832"
FT                   /product="hypothetical protein"
FT                   /note="unknown function; YciI from Haemophilus influenzae
FT                   presents crystal structure similarity to a muconolactone
FT                   isomerase, but does not seem to catalyze any of the
FT                   predicted reactions based on sequence and structure
FT                   similarity"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0832"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82228"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717394.1"
FT                   /protein_id="ACX82228.1"
FT                   /translation="MYYVIFAQDKPNTLAQRLSVREQHLARLTQLQAENRLLTAGPNPA
FT                   IDDENPGDAGFSGSTVIAQFDSLQAAKDWAAQDPYVEAGVYGEVIVKPFKKVF"
FT   gene            complement(753869..754339)
FT                   /locus_tag="D11S_0833"
FT   CDS_pept        complement(753869..754339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0833"
FT                   /product="acyl-CoA thioester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0833"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82229"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542674.1"
FT                   /protein_id="ACX82229.1"
FT                   /translation="MVHQPVDPRSTQPHGTLLLRTLAMPSDTNANGDIFGGWIMSQMDM
FT                   GGAILAKEIAHGRVVTVAVESMNFIRPVTVGDVVCCYGRCLYVGRSSLKIKVEVWVKKV
FT                   ASEPIGERYCVTEAVFTFVAVNNEGKSRAIPRENNHELDNALAQIQAHQTEK"
FT   gene            complement(754343..754894)
FT                   /locus_tag="D11S_0834"
FT   CDS_pept        complement(754343..754894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0834"
FT                   /product="septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0834"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82230"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564069.1"
FT                   /protein_id="ACX82230.1"
FT                   /translation="MKQLLEFIPLILFFAMYKLMGIRAAAVTLVIATIVQFIILKVKYG
FT                   KIEAQQKFVAGAVIFFGTLTAYFNDLEFLKWKVTIIYALFALVLLIAQFGFKKLLIKQL
FT                   LGKEIELPEAVWKNVNLGWSGFFILCMLVNIYISQYLSDDIWVDFKSFGIIGMTFVATL
FT                   ITGLYIYRYLPKNEQEQTKE"
FT   gene            complement(754900..755658)
FT                   /locus_tag="D11S_0835"
FT   CDS_pept        complement(754900..755658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0835"
FT                   /product="beta-methylgalactoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0835"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82231"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542670.1"
FT                   /protein_id="ACX82231.1"
FT                   /translation="MPINFTQIIKDSFHFIQNEKQSVTILSALYFFANIAIALLQSSML
FT                   PNEVIISLTEKQISPAMSEGQAIDLVIFFFLKQFIYIFISAWCLVSIHQISLRHFNTLQ
FT                   HSFSITLKRIWGAILISFVICIPIFIGLAEAIIAIQQKIQPSIISLLAIIIGIGLYIRL
FT                   CLAPVHYLLTDDTVNTCGKTIWHAAIGRVSMLVIFCLLIYFLIPIAENFLVSFSTNSIM
FT                   ALITGIMVAFLNIFALIVTYRFYTRFLPKV"
FT   gene            755930..756154
FT                   /locus_tag="D11S_0836"
FT   CDS_pept        755930..756154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0836"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82232"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006251664.1"
FT                   /protein_id="ACX82232.1"
FT                   /translation="MQKHKIILGLASVLAMGAVNAHEAGSFIVRGGGIFVSANSSSATK
FT                   TPINVNLDVGDNAQLGLTGTYMFTDNFGI"
FT   gene            756158..756577
FT                   /locus_tag="D11S_0837"
FT   CDS_pept        756158..756577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0837"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0837"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82233"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005552791.1"
FT                   /protein_id="ACX82233.1"
FT                   /translation="MGATPFSHKISATVPALKLGLGDVVKLKQLPPSLYAQYYFLDQDS
FT                   GSRPYVGAGINYTRFFSAKPMVNAVTDLDVKKHSFSPILNAGIDIKLTDNVYLNTAMWY
FT                   TKIKTTAKFKALGAAHEVKIKLDPLVFFTGLAYRF"
FT   gene            complement(756644..758320)
FT                   /locus_tag="D11S_0838"
FT   CDS_pept        complement(756644..758320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0838"
FT                   /product="recombination and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0838"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82234"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564065.1"
FT                   /protein_id="ACX82234.1"
FT                   /translation="MLTQLTINNFAIVRHLNIELMQGMSVITGETGAGKSIAIDALGVC
FT                   LGQRIEASMLREGQERADICATFQISRNNPAYQFLLEHDLQDQDNPEECILRRMINHDG
FT                   RSKSFINGIPVAAAQLKEIGQHLIQISGQHASQLLLKNEYQLQLVDSFCHHPALLQQMQ
FT                   TDYQRWRDLQQQMKTFQQKCAGNEARKQLLQYQVSELDEFNLKANEYAELEADHNRLSN
FT                   SEELTQLSQSVLQLLSENETVSVDSLLYRATKHLDELCKLDSRYAEVQNLLNEAMIQVQ
FT                   EATGEIQSLSSNIEQDPSLLANIEQRIGQAVQLARKHNVKPQELVELHHQLKAELNALE
FT                   AFSDSEEELIKQAEAAHEKMLASATALHQSRQSGAQKLAQQVTKSIKQLAMEHAEFFIT
FT                   LDTDYDKIGANGADFATFTLQSNLGQTAQPLAKIASGGELSRIALAIQVQASNQTAIPT
FT                   LIFDEIDVGISGATANVVGKLLRKLSEKCQVICVTHLPQVACHGTHHFSVEKSAVDQKT
FT                   ETRMTALSAQQRVKALAKLLGGSKITDAVLANAQEMLDTSI"
FT   gene            complement(758394..759311)
FT                   /gene="ppnK"
FT                   /locus_tag="D11S_0839"
FT   CDS_pept        complement(758394..759311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="D11S_0839"
FT                   /product="inorganic polyphosphate kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="catalyzes the phosphorylation of NAD to NADP"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0839"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82235"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005564063.1"
FT                   /protein_id="ACX82235.1"
FT                   /translation="MNTLNAVKPHSLHTSFQTIGLVGKPRNDLNLQMHKNLFFWLLEHG
FT                   YHVLVEREIGEKIELPPKHLASVDEIGSEAQLAIVIGGDGNMLGRARILAKYDIPLIGI
FT                   NRGNLGFLTDIDPKNAYAQLQACLEHGEFFVEERFLLKASIERDNEIVASGIAVNEVVI
FT                   HPAKIAHMIDFHVHINNQFAFSQRSDGLIISTPTGSTAYSLSAGGPILTPKLDAIALVP
FT                   MFPHTLTSRPLVIDGNSKISMRFAEYNTSQLEVGCDSQITMPFSPYDVVHIQKSEHKLR
FT                   LLHLKNYNYYKVLSSKLGWLRNKS"
FT   gene            759452..760030
FT                   /locus_tag="D11S_0841"
FT   CDS_pept        759452..760030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0841"
FT                   /product="molecular chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0841"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82237"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542650.1"
FT                   /protein_id="ACX82237.1"
FT                   /translation="MTNHQSADNQHELEQEIQPEDVVDELKEQGEDPLEEAIARVQELE
FT                   AQLAETSKKEQDLLLRTRAEIDNIRRRTEQDIEKAHKFALEKFAKDILNTIDNLERALA
FT                   TPANTEDDSVKALFDGVELTLKELLATVARFGIEPVGAVGEVFDPELHQAISMQPAEGF
FT                   QSNQITAVLQKGYLLNGRVIRPAMVMVAA"
FT   gene            complement(760141..763212)
FT                   /locus_tag="D11S_0842"
FT   CDS_pept        complement(760141..763212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0842"
FT                   /product="ligand-gated channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0842"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82238"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542649.1"
FT                   /protein_id="ACX82238.1"
FT                   /translation="MSKLKLGYLSSHIIFLALSVSTAYAQNDTQEKLNEIVVSGSSEGN
FT                   GNSDDRTPPKIGETVKSAKKLEKQQAQDVKDLVRYDTGVTVVEAGRFGNSGFAVRGVEE
FT                   NRVAIQIDGLAQAETISSQGFKELFEGYGNFNNTRNSAEIETLKQVTIRKGADSLKSGS
FT                   GALGGSVSFETKDARDYLTDKNYYASYKRGYNTADNQNLNTLTLAGRYKYFDAIAVFTS
FT                   RKGHELENFGYKNYNERVQGKTREKADPYRRTLDSKLLKFAFQPTDNHRFSVMADLYKQ
FT                   TSKGHDFSYTLKPNTQFRTYDEEELRHTNDKVERKNFAFTYENFTTTPLWDTLKITYSQ
FT                   QKITTRARTDDYCDGNDKCPTSQNKLGMKYNEDNKLVGNDNKLAKYTNTPAQTKTIKEQ
FT                   VPLDPSSTAKYRWQKAQWHVLEQKYPGVKYSKYCEEDETDPSNFCTVELKIPGAPAKKS
FT                   FEINGKEYDLKSEEVIGDEQTLTTNTSHILSCDAINCNKKTIGGFQRDGTPVDIPFEVF
FT                   ERDGKKYAKTKVMSKDQLSGPVFFMPNKSGYQENLWTQRDLTTKTKQINIDLTKHIEIS
FT                   GTEHDLFYGGLWAESKKEMINISGISARNIKWWAQYPKDCSPSINNPDRYNALCNRKNV
FT                   YSFLIPVKTKTGALYFIDDFKLNDYFSFGVGYRYDRVKYNPEYIPGVTPKIPDDLVTNL
FT                   YITDPKFDPSDLTSPENQARREANANANIKKIAQPKKFSASSYSLNTTVDPLDWLRLQA
FT                   KYSKAFRAPTGDEIYFTFKHPDFSVLPNKDLEQETAKTKELSVTLHNDMGYISTSVFET
FT                   RYNNFIDLVYKGNKQLQGHSKLRPFNVYQNINRPNAKVTGFEIVSQISLNDLAKILNGF
FT                   NLSYKYTYQKGRMDGDIPMNAIQPRTAVYGIGYVHSDDKFGLDLYITHAGAKQAKDTYN
FT                   MYHKEEGKKDSSIKWRSNSYTTIDLLGYIKPIKNLTLRAGVYNLTNRKYITWDSARSIR
FT                   PFGTSNLIDQKSGLGINRFNAPGRNYRLSMQLEF"
FT   gene            complement(763402..765420)
FT                   /locus_tag="D11S_0843"
FT   CDS_pept        complement(763402..765420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0843"
FT                   /product="FAD-dependent cmnm(5)s(2)U34 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82239"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167651.1"
FT                   /protein_id="ACX82239.1"
FT                   /translation="MRVITHADITFNQENTPVSNQFDDVYFSNQDGLEESRHVFQQGNQ
FT                   LWQRWQSHEPAHFVIAETGFGTGLNFFAVTMLFREFRQQFPQAKLRRLFFLSFEKYPLT
FT                   SEALKRAHQHYPQFFALAEQLQAYWLEPIEGCYRFHFEETTLDLWFGDIHTNLPQLGDY
FT                   MREKIDAWFLDGFAPSKNPEMWNDGLYAQMYRYTKSHGTFATFTAASAVRKGLENAGFS
FT                   VQKRKGFGKKRECLAGEKTFIKPTALFTPWYLPQAAQFQEKADVAIIGGGVASVFTALS
FT                   LIQRGTKVTLYCEDPQPAMNASGNKQGAFYPQLSDDDERNIRFYIHAFAYGLQLLHEAE
FT                   KHIDFEHEFCGVALCGYNEKSAVKLHHISQYHLPTDLYQALTQAELSEKVGLPLPCGGG
FT                   FIPQGAWLAPQQLVQNLFAHLQQQGLILKTQEKMTALSWLGDHWQLTNEQGERFQHQIV
FT                   VLANGHQLPQFLQTQHLPLYAVRGQVSQIPTSANLLKLKSVLCYDGYLTPADQAKTSHC
FT                   IGASHVRDCADRTFSEQEQQENQAKIQRNLAEMPWVNDVDTSANLARIGVRCAVRDRIP
FT                   MMGNVPDFDRQCADYKNLFNLRRRKQSIPPAAHYPNLYLIGALGSRGLTSAPILGETLA
FT                   SLIHNEPLPLSEDLIHHLSASRSWIRKLLKGTSIENL"
FT   gene            765590..766810
FT                   /locus_tag="D11S_0844"
FT   CDS_pept        765590..766810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0844"
FT                   /product="3-oxoacyl-ACP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0844"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82240"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005701034.1"
FT                   /protein_id="ACX82240.1"
FT                   /translation="MKRVVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFIEMKMR
FT                   SHVAGTVKLNPSELIDRKIYRFMGDAAAYAYLSMKEAIEDAGLTEDQVSNERSGLVIGA
FT                   GTGSAHNQLIACDAVRGPRGVKAIGPYAVTKTMASSVSACLATPYKIKGVSYSISSACA
FT                   TSAHCIGNAYELIQLGKQDIVFAGGAEELSWECATEFDAMGAVSTKYNDTPTKASRAYD
FT                   ANRDGFVIAGGGAVVVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMK
FT                   QAMAGLDAPIDYINVHGTSTPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAH
FT                   EAIYTLLMLHNDFIAPSINIETLDEQAQGCNIVTETVENAGLQTVMSNSFGFGGTNASL
FT                   VFKRYNG"
FT   gene            766951..768810
FT                   /locus_tag="D11S_0846"
FT   CDS_pept        766951..768810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0846"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82242"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546582.1"
FT                   /protein_id="ACX82242.1"
FT                   /translation="MKNLKDFVRDFVRRYVDWVIRLGRIRFSLLGVMVLAVLALCTQIL
FT                   LSLLVMGKILWADVARSIVFGLISAPFVIYFFTVLVEKLEHSRQALSCSVEELRREVQE
FT                   RVSAEKKLSEALDNLEKINRDKTTLMTTISHELRTPLNGIIGLSRILLEENPSERQQNY
FT                   LKTINSSALSLAHIFSDIIDLEKIDAKRIELNRKATDLYALLNDIANFALLMTEEKHLQ
FT                   FQLVCPPTLPNWLMLDGVRLNQVLWNLINNAVKFTQQGSVTLSVEQTAEEEFALRVTDT
FT                   GIGIVEQDLQKIFELYYQAGSDANKSLGSGIGLSVSKTIAQLMGGDLTVSSEVGKGSTF
FT                   LFTFKARQAIKPVEEDEHLPLKLNILLVEDIEVNVVVAKSMLEKLGYQIDIAMTGAEAI
FT                   RKFEQNYYDLVFLDIQLPDMSGFDIAAHFRQNYENGVYDFLPPLIALTANVVQKKQEYL
FT                   AQGMDDVIHKPLSLEELRHCLHDYFGEELTQFNLPSNKPQAESVELDTKMLTELVEMLG
FT                   ADFVKNNLILFEQTMQDYVAELQQAYQAYLNDPHTQPEVLSIVHKIKGALASVGLKRLQ
FT                   WIAAQAQNADTADWQGNIAHWVNLLAKEWQTDVAKLREWLAGY"
FT   gene            complement(768884..769894)
FT                   /gene="mglC"
FT                   /locus_tag="D11S_0847"
FT   CDS_pept        complement(768884..769894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglC"
FT                   /locus_tag="D11S_0847"
FT                   /product="beta-methylgalactoside transporter permease"
FT                   /note="ABC transporter; functions in galactose transport;
FT                   part of MglA2C2B transporter complex"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0847"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82243"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018355241.1"
FT                   /protein_id="ACX82243.1"
FT                   /translation="MSALEKNKSFDFLKQNAIYFVLLILLGIIIAQDPSFLNLMNFSNI
FT                   LTQSSVRLIIALGVAGLLVTQGTDLSAGRQVGLAAVISATMLQSMENINRVFPDLGEIP
FT                   IPVVILAVCAVGAVIGLVNGLVIAYLNVTPFIATMGTMIIVYGFNSLYYDTVGGSPIAG
FT                   FSENFSTFAQGFFRIGSFKLSYITIYAAICAFLVWVMWNKTRFGKNIFAIGGNPEAAKV
FT                   SGVNVARNLVVIYIIAGMFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFAG
FT                   GVGTVIGVITGVIIFTVINYGLTYIGVNPYWQYIIKGSIIILAVAIDSLKYAKKK"
FT   gene            complement(769913..771451)
FT                   /locus_tag="D11S_0848"
FT   CDS_pept        complement(769913..771451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0848"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0848"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82244"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005566063.1"
FT                   /protein_id="ACX82244.1"
FT                   /translation="MTEQNQSPSGNQSQSGEVLLTMKDVSKSFPGVKALDQANLTVRSH
FT                   SVHALMGENGAGKSTLLKCLFGIYAKDEGDILFLGKPVNFKTSKEALENGISMVHQELN
FT                   LVRQTSVMDNLWLGRYPLKGPFVDHAKIYRDTKAIFDELDIDIDPKEKVAKLSVSQMQM
FT                   IEIAKAFSYNAKIVIMDEPTSSLSEKEVEHLFKIIQKLKDRGCGIIYISHKMDEILKIC
FT                   DEITILRDGKWINTVPVKGSTMEQIVSMMVGRELTQRFPEKTNTPKEVILTVENLTALN
FT                   QPSIQDVSFDLRKGEILGIAGLVGAKRTDVVEAIFGVRELKSGTITLHGKTVKNHTALE
FT                   AINNGFALVTEERRSTGIYSNLSIEFNSLISNMKSYLTSWKLLSNKKMRSDTQWVIDSM
FT                   NVKTPSHKTTIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDIGAKFEIYQLIQEL
FT                   AKKDKGIIMISSEMPELLGVTDRILVMSNGKVAGIVETANTSQEEILQLAAKYL"
FT   gene            complement(771526..772518)
FT                   /locus_tag="D11S_0849"
FT   CDS_pept        complement(771526..772518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0849"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0849"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82245"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005594511.1"
FT                   /protein_id="ACX82245.1"
FT                   /translation="MKKTVLSAVVFSIVFGIGISTTQAETRIGVTIYKYDDNFMSLMRK
FT                   EIQKNAEQLQNVKLLMNDSQNAQSIQNDQVDVLLSKGVKALAINLVDPSAAPTIIGKAK
FT                   PDNIPVVFFNKDPGAKVIGSYENAYYVGTDPKESGLIQGDLIAKQWKAMPALDLNKDGK
FT                   IQYVLLKGEPGHPDAEARTKYVIEQLNAQGIPTEQLFIDTGMWDAALAKDKMDAWLSSS
FT                   KANDIEVIISNNDGMAMGALEATKAHGKKLPIFGVDALPEVLQLIKKGDIAGTVLNDGA
FT                   TQGKAIVDLSNNLANGKPATEGTKWELKDRVVRISYVGVDKDNLSQFLK"
FT   gene            complement(772733..773746)
FT                   /locus_tag="D11S_0850"
FT   CDS_pept        complement(772733..773746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0850"
FT                   /product="transcriptional regulator"
FT                   /note="controls transcription of galETKM"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0850"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82246"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573744.1"
FT                   /protein_id="ACX82246.1"
FT                   /translation="MVTIRDVANQAGVSVATVSRVLNNHPSTKDKTRHLVLNAIEQLGY
FT                   RPNANAQALASQSSDTLGVVVTDVTDSFFAILVKAVDHVAMEHGKNILIGMGYHQAEKE
FT                   RDAIDTLLRKRCNCLVVHSKALDDQTLAEYLDSVPGMVIINRCIKGYESRCVSLDNRKG
FT                   TFIATNTLIQAGHRHIGYIGSNHKINDETERKQGYLNALTEHHIPIVENAIVHNSPDFE
FT                   GGEEAMINLLSYNDNLTAVVAYNDSMAAGALSVLNENNIKVPKQFSIIGFDDMPIARYL
FT                   VPKLTTIRYPIDLMANYAAKLALGLVDMDICLPINPQFNPTLVQRFSVENIHHTGE"
FT   gene            773998..775041
FT                   /locus_tag="D11S_0851"
FT   CDS_pept        773998..775041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0851"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="catalyzes the interconversion of UDP-galactose and
FT                   galactose-1-P with UDP-galactose and glucose-1-P"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0851"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82247"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562855.1"
FT                   /protein_id="ACX82247.1"
FT                   /translation="MSTVFDPTEHPHRRYNPLINQWVLVSPHRAKRPWQGQREKVSEEQ
FT                   KPSHDPSCYLCPCNKRITGEPNPDYHKPYVFKNDFSALLEDTPAPQQNDNPLFQSSQAR
FT                   GESRVICFSPDHSKTLPLLTALEIEEVIKVWQEQLRELGQKYQWVQIFENKGAAMGCSN
FT                   PHPHGQIWANSFLPNEVAREDKAQCQYYEKHGAVLLVDYVQQELERKERIVVETAHWLA
FT                   VVPYWAVWPFEILLLPKAHVKRLTELSDAQAKDLAVILKKLTTKYDNLFETSFPYSMGF
FT                   HAAPFNGEENAHWQLHAHFYPPLLRSATVRKFMVGYEMLGESQRDLTAEQAAERLRALS
FT                   EVHYKVR"
FT   gene            775108..776262
FT                   /locus_tag="D11S_0852"
FT   CDS_pept        775108..776262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0852"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="catalyzes the formation of alpha-D-galactose
FT                   1-phosphate from D-galactose in galactose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0852"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82248"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005546593.1"
FT                   /protein_id="ACX82248.1"
FT                   /translation="MLPIEKSQYIFTQKHHKQSELTVYAPGRVNIIGEHTDYNDGFVMP
FT                   CAINYGTAIAGAKRSDHIWNVYAADLDLSDEFSLDGQLPQSEQKWANYVRGVVKFIQER
FT                   CPNFKQGADLVISGNVPHSSGLSSSAALEVATGKFCQQLGDLPLSHTELALIGQQAENK
FT                   FVGANCGNMDQLISALGQQDHLLMIDCRSLETLPTPVPHDVAVIIVNSNVPHDLVTGEY
FT                   NTRRQQCECAAAFFGVKALRDVSVAQFKEREAELTALYPLAAKRARHVVTENQRVLDAV
FT                   EALKRNDLTRLGELMGQSHDSMRDDFEITVPQIDYLVELAQLVIGKNGGARMTGGGFGG
FT                   CIVALAPHDKVDAVRKIIAENYEKQTGLKEDFYVCTASQGVCVC"
FT   gene            776256..777287
FT                   /gene="galM"
FT                   /locus_tag="D11S_0853"
FT   CDS_pept        776256..777287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="D11S_0853"
FT                   /product="galactose-1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="mutarotase; catalyzes the conversion of
FT                   beta-galactose to the alpha-anomer; links the metabolism of
FT                   lactose and galactose"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0853"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82249"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567842.1"
FT                   /protein_id="ACX82249.1"
FT                   /translation="MLEQRAQSTAPDGLPFNLFILQNAQGMRVQFTDWGATWISCCLPV
FT                   NGELREVLLGCKLEDYPVQQAYLGVSVGRYANRIANAQFPLNGKVVRLTANQGKHQLHG
FT                   GNGFDKRRWTLEKCGENFVCFSLYSADGDQGFPGNVKATVTYTLTEDNAVKIEYAAQSD
FT                   QDTALNLTNHAYFNLENAMQGADVRNHSLRLNADFYLPVDSEGIPNSPLKHVVGTGFDF
FT                   RIAKPIKQDFLQGEQLAAKGYDHSFIVNKAWQKPCVLLTCPNGDLSLEVLTSQAALQVY
FT                   TGNFLAGTPTREGAQYADYHGIALETQCLPDTPNHPEWQNYGGIVKAGEEYYQWTEYRF
FT                   KGN"
FT   gene            777387..777473
FT                   /locus_tag="D11S_0854"
FT   tRNA            777387..777473
FT                   /locus_tag="D11S_0854"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:777421..777423,aa:Leu,seq:cag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(777552..779051)
FT                   /locus_tag="D11S_0855"
FT   CDS_pept        complement(777552..779051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0855"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0855"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82250"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005542626.1"
FT                   /protein_id="ACX82250.1"
FT                   /translation="MNEKIFNGILSLSALSIATVLGVASFYLGFIDKESPCILCWAHRM
FT                   LMFAEVMFTFLIIRYGPKPKYIGWVIFIAVFGIFAGFRHSSGSFAWDIHQGWWAEILGA
FT                   HTYSWPMVIHAVVLIFVALIFCFTKDIYNFVSQSHKQLNILSKTCMAIFMIVICGNMVQ
FT                   AFISTGLPPNMGVSNPARLSFNSDYWYWTTESWKRLSRPTSLRNTWHVEAPDLPSQPTT
FT                   AMQFTTDARQAPLSSTGKLVIQKQEAITIPLNAPATDIAYNGKDKYFISTEKWGLYLLN
FT                   DTLSEIQRFSVLDHLNGANGRIPVGSAFFNEDEFGVLGWNKIFVFFKEDANRTAKENYP
FT                   SFIEGLNNYVVTARGAYNTVRSRLFHVLSMAYLPENNSIYTATVPNSKNQKLIISRFDK
FT                   SDNILSEEFTPKVKKGIALTEGKSIGDYYITGLTAYNGNLYAVSKQFSQVLEINPITRE
FT                   ITHVYEFNGIENPQGITFKHGVMQILSYEKGKNLLYSLTEE"
FT   gene            complement(779330..780763)
FT                   /locus_tag="D11S_0856"
FT   CDS_pept        complement(779330..780763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0856"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0856"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82251"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167656.1"
FT                   /protein_id="ACX82251.1"
FT                   /translation="MALSKNAKLAILVAIPLVTFILPAPEGLSLIAWRLLGVYIATIVG
FT                   LVLKPYSEPVILLAAVAVSGAIIGNTSGAAEFLKAGDILNGYKSGTTWLIFTAFTLSSA
FT                   FVITGLGKRIAYHMIGAMGSTTLRLGYVTMFLDLLLSPATPSNTARSGGIIFPIINSVA
FT                   VALGSDPEKSPKKAGRYLMMNVYMVVKTTSYIFLTAMAPNALALSLMAPILGFNIDWLH
FT                   WFLAASVPGLLCLFVIPLICYWVSSPEMKEVDNKAISKKGLEELGPMSFREKALIVLFV
FT                   IALFGWIFSSALNVNATIVALIVMVCCIVLNIVSWDDILKSKGGWNTLIWYGGIIGMSG
FT                   LLEKAKFFDWLAESLKSVLQFEGQGTLALIVILTLSVAVRYLFASGGAYVAAMVPVFAT
FT                   VGHVAGAPTELLALGLLFANSYGGSVTHYGGGPGPIAFGAGYNDIKSWWTAGAIIAFGS
FT                   LIVHLTIGMAWWEFLFNLA"
FT   gene            complement(780750..782162)
FT                   /locus_tag="D11S_0857"
FT   CDS_pept        complement(780750..782162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0857"
FT                   /product="2-(5'-triphosphoribosyl)-3'-dephospho CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0857"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82252"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005555722.1"
FT                   /protein_id="ACX82252.1"
FT                   /translation="MTISLKNFSTTGTEISLEQLLSAREARALLQQKLLAQYGQTLLCV
FT                   TLTAVGGVKKNALLDYVFAKTLEKLTALFTQLAITPSAERIRPLETGHEAFFVLPMYAK
FT                   ALKAAMIELEESLPLARLWDLDVFDHEGNLLSRSDFGMPPRTCLVCGADAKVCARSRAH
FT                   GVAEILAEMHKRAQQHDLAEQIGNAVCSALIQEARLSPKPGLVDAINNGAHKDMNLQTF
FT                   EQSAVSLAPFFTAFVLKGMQTASLPPSQILAQVRPLGVLAEKAMFKATHGVNTHKGAIF
FT                   SFGLVCTAIGRLLQQQDLSQSAVVFAVKSICDLVAQFAQGLTAELQHYPDHLPITAGVR
FT                   LFRQFGLTGARGEAESGFQQIQTLLPLLDEDHQRDWEHRLLILLLHLMATNADTNVVHR
FT                   GGMEGLHFVQQTAKDLLADQTVVSDKAKLTQALMKFDVACIARNLSAGGSADLLALMIF
FT                   FQTLRGNSHGII"
FT   gene            complement(782356..783858)
FT                   /locus_tag="D11S_0858"
FT   CDS_pept        complement(782356..783858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0858"
FT                   /product="citrate lyase subunit alpha"
FT                   /note="citrate-ACP transferase, the alpha subunit catalyzes
FT                   the formation of (3S)-citryl-CoA from acetyl-CoA and
FT                   citrate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0858"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82253"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005552842.1"
FT                   /protein_id="ACX82253.1"
FT                   /translation="MTTREQRIAKFNANRPVYQAVPKAESLARTAKDRKICDSLEDAIK
FT                   RAGLKDGMTVSFHHAFRAGDFVVNMVMDKIAEMGFKNLTLASSSLIDSHSPLIEHIKNG
FT                   VVTKIYSSGLRGQLAEEISRGLLDEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDKF
FT                   GNANGFSGKSKCGSLGYARVDAEFADKVVLLTEEFADYPHHPISIGQDKVDLIVQVDAV
FT                   GDPKKIGGGATRMTTNPRELLIARKCAEVIFACGYFKDGFSLQTGTGGASLAVTRFLEE
FT                   KMARDNIKADFALGGITASMVDLHEKGLIKKLIDVQSFDAVAAESLARNPNHIEVSANQ
FT                   YANYSSKGASVERLDVVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTASSAQVAII
FT                   VAPLVRGRIPTVVENVITCVTPGENIDILVTDHGVAVNPKRPDLIEALTAAGIPLFTIE
FT                   QLCERAYSLTGKPKEIEFTDKPVAVVRYRDGTVIDTVYQVKE"
FT   gene            complement(783873..784748)
FT                   /locus_tag="D11S_0859"
FT   CDS_pept        complement(783873..784748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0859"
FT                   /product="citrate lyase subunit beta"
FT                   /note="citryl-ACP lyase; catalyzes the formation of acetate
FT                   and oxaloacetate from citrate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0859"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82254"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005562840.1"
FT                   /protein_id="ACX82254.1"
FT                   /translation="MKLRRSMLFVPGSNAAMLSNSFIYKPDSIMFDLEDAVALKEKDTA
FT                   RLLVAHALQHPLYKDIETVVRVNPLDSEFGLADLNAVVRAGVDVVRMPKTETAQDVIDM
FT                   DREITEIEKTYGREVGSTKMLAAIESPLGITQANQIATASKRLIGIALGAEDYVRNLKT
FT                   ERSPEGIELLFARCSILQAARAAGIQAFDTVYSNANNEEGFLKEAALIKQLGFDGKSLI
FT                   NPRQIELLHNLFAPTQKDVDQAKRIIEAAEEAERQGSGVVSLNGKMIDAPIIDRAKLVL
FT                   ERAKSGIREE"
FT   gene            complement(784745..785032)
FT                   /locus_tag="D11S_0860"
FT   CDS_pept        complement(784745..785032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0860"
FT                   /product="citrate lyase subunit gamma"
FT                   /note="acyl carrier protein; with CitE and CitF catalyzes
FT                   the formation of oxaloacetate from citrate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0860"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82255"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005573737.1"
FT                   /protein_id="ACX82255.1"
FT                   /translation="MKITKAAVAGTLESSDAQVRIQPFDSLDIEINSSVAKQFGEQIDA
FT                   TVRAVLNKLNVTAAQVIIEDKGALDCVLQARVKAAVLRATDENINWEAVL"
FT   gene            complement(785072..786079)
FT                   /locus_tag="D11S_0861"
FT   CDS_pept        complement(785072..786079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0861"
FT                   /product="citrate (pro-3S)-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82256"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005572311.1"
FT                   /protein_id="ACX82256.1"
FT                   /translation="MQFERLSTAHKDLSAIREFLAKNELNLDAQIEYFIVGYDEAQQIA
FT                   VCGGLAGNIIKCVAIDESQRGNGVALQLGTELVNLAYELHRPHLFIYTKPEYEKLFNAC
FT                   GFYTISDAYPYVVLLENSATRLQKQCEKWRAMRVSGQHIGAIVMNANPFTLGHRYLIEQ
FT                   ALQQCDHLHLFVVGEDASQFSYEERFTLTQQGIADLTNITLHSGSDYIISRVTFPDYFL
FT                   KDQKITDDSYFAVDLKLFRRYIAPALGINRRFVGTEPTCAVTAEYNRQMFYWLMEAEMD
FT                   APKIDVIEIPRKTINGQAISASVVRKLLAEKHWTALAEFVPSSTLNYLQKCGRF"
FT   gene            786325..787221
FT                   /locus_tag="D11S_0863"
FT   CDS_pept        786325..787221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0863"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0863"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82258"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567825.1"
FT                   /protein_id="ACX82258.1"
FT                   /translation="MNEEHSTNQSEVTKKSFFQSLFGRFFQGELKNRDDLVEVIRDSEQ
FT                   NDLIDQNTREMIEGVMEIAELRVRDIMIPRSQIVFIETDQDLDSCLDTIIESAHSRFPV
FT                   IADADDRDNIVGILHAKDLLKFLRANAEEFNLLTMIRPTMIVPESKRVDRMLKDFRSER
FT                   FHMAIVVDEFGAVSGLVTIEDVLEQIVGDIEDEFDEEEVADIRQLSRHTYAVRALTDIA
FT                   DFNQQFNTQYADEEVDTVGGLVMQAFGYLPKRGEEITLDNLHFKVTSADSRRIIQLRVT
FT                   VPDEHLPEMEKEEEVVA"
FT   gene            787613..789157
FT                   /locus_tag="D11S_0864"
FT   CDS_pept        787613..789157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0864"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0864"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82259"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567823.1"
FT                   /protein_id="ACX82259.1"
FT                   /translation="MNKYFTYLIALISGAAGVFAFAPFYYWGLSYISLFGLIWVIKTPQ
FT                   KSTALLSAFLWGLSFFTFGVNWLHVSIHQFGGAPLALSYFLVVLLAAYLSLYPLLFAYL
FT                   VRRLQVQRAVLYPVLWTFTEFLRGWVFTGFPWLQFGYTQIDSPFAGVAPIFGVTGLTFF
FT                   VMFISAVIFNIVSALTTPPKKANVAVTNGLILAVIGGVAAYTSQLNYVKENAEKALNIT
FT                   LVQGNIEQNLKWDPNYLYQTMENYGRLIGDNLGKTDLIILPEVAFPTYENDIQPFFQAL
FT                   QSLAEKADTEVMAGTLYQDESVGKSLNSIVVVGSKSAPYHMQTDNRYSKHHLVPFGEYV
FT                   PLESILRSLGSVFNLPMSAFQSGDAVQKPLQAKNLNFTAAICYEIILGAQLQQNLTANS
FT                   DFIVTISNDAWFGNSIGPWQHLQMAQMRALEFGKPVIRATNTGVTAFIDAQGKIVAQAP
FT                   QFVETVLTRKIAPTEGKTPYAMFGDMPLYALSAVFFLLHLLGMWLQRIMLRKAQKD"
FT   gene            complement(789220..789438)
FT                   /locus_tag="D11S_0865"
FT   CDS_pept        complement(789220..789438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0865"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0865"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82260"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q5PGJ4.1"
FT                   /protein_id="ACX82260.1"
FT                   /translation="MSKEDSIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYI
FT                   RILTGDKVTVEMTPYDLSKGRIIFRSR"
FT   gene            789658..790965
FT                   /locus_tag="D11S_0867"
FT   CDS_pept        789658..790965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0867"
FT                   /product="aminopeptidase B"
FT                   /EC_number="3.4.11.23"
FT                   /note="catalyzes the removal of an N-terminal amino acid
FT                   from a peptide or arylamide"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0867"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82262"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567820.1"
FT                   /protein_id="ACX82262.1"
FT                   /translation="MSMQVLLSNQPASAAWGEKALISFNEDKATIHLTDFSDRTSVQKA
FT                   ARKLQNQGISNVTLSGEHWQLENCWAFYQGFYNAKKHFKVQFPTLSAAQQQELNHRIQC
FT                   GDFVREIINLPAAILTPEELAQRAAKFIVQTAEQQGKKSAVGFSIVSREELLERGYHGL
FT                   WQVGKGSQNLPAMLQLDFNPTGSPDAPVLACLVGKGITFDSGGYSIKPSDGMSTMRTDM
FT                   GGAALLTGALGLAILRGLNQRVKLFLCCAENLVSSRAFKLGDIIQYRNGVTVEILNTDA
FT                   EGRLVLADGLIDADAQQPQFIVDCATLTGAAKVAVGNDYHSVLSMDDNLVGELFRSAEQ
FT                   EQEAFWRLPFAELHRGQIKTAFADIANTGTVPIGAGASTATAFLSYFVKNYQQHWLHID
FT                   CSATYRKTPSDLWATGATGIGVQTLANLLITKANQQ"
FT   gene            790977..791402
FT                   /locus_tag="D11S_0868"
FT   CDS_pept        790977..791402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0868"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="catalyzes the formation of nucleoside triphosphate
FT                   from ATP and nucleoside diphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0868"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82263"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005567819.1"
FT                   /protein_id="ACX82263.1"
FT                   /translation="MSLQRTLSIIKPDAVKRHLVGAILACFEQQGFKIVAAKMLHLTQE
FT                   QAEGFYVEHQGKPFFVSLVEYMTSAPVLVSVLEKENAVQDYRTLIGSTNPENAAKGTIR
FT                   RDFALSQQENSVHGSDSPESAAREIAYFFVSDEISHY"
FT   gene            791538..792683
FT                   /locus_tag="D11S_0869"
FT   CDS_pept        791538..792683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0869"
FT                   /product="molecular chaperone TorD"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0869"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82264"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005541862.1"
FT                   /protein_id="ACX82264.1"
FT                   /translation="MNYIKKIILSLFLLGLFSVLNCCVKGNSIYPQKISTKQTGLMLDI
FT                   ARHFYSPEVIKSFIDTISLSGGNFLHLHFSDHENYAIESHLLNQRAENAVQGKDGIYIN
FT                   PYTGKPFLSYRQLDDIKAYAKAKGIELIPELDSPNHMMAIFKLVQKDRGVKYLQGLKSR
FT                   QVDDEIDITNADSIAFMQSLMNEVIDIFGDTSQHFHIGGDEFGYSVESNHEFITYANKL
FT                   SYFLEKKGLKTRMWNDGLIKSTFEQINPNIEITYWSYDGDTQDKNEAAERRDMRVSLPE
FT                   LLAKGFTVLNYNSYYLYIVPKASPTFSQDAAFAAKDVIKNWDLGVWDGRNTKNRVQNTH
FT                   EIAGAALSIWGEDAKALKDETIQKNTKSLLEAVIHKTNGDE"
FT   gene            complement(792773..793885)
FT                   /locus_tag="D11S_0871"
FT   CDS_pept        complement(792773..793885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0871"
FT                   /product="sodium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0871"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82266"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005577783.1"
FT                   /protein_id="ACX82266.1"
FT                   /translation="MATLFSENLTEQQKKRIVRLFKDFQHPTLQKDLISLNTLKKVEKG
FT                   GDTLRIEITMPFAWNTAFADLKNALTAPLKQIADAKNAKWQLNYQIATLKRANNHPAVK
FT                   GVKNIIAVSSGKGGVGKSTISVNLAIALHLQGARVGILDADIYGPSIPHMLGAPHQRPT
FT                   SPDNKHITPIQAHGLYANSIGFLMDEDNATIWRGPMASSALSQLLQETLWPDLDYLVID
FT                   MPPGTGDIQLTLSQQIPVTGAVVVTTPQDIALLDAVKGIAMFERVSVPVLGIVENMSMH
FT                   ICSNCGHQEAIFGTGGAECIADKYNIKVLGQQPLHIRLRQDLDRGEPTVIAAPDSEIAH
FT                   SFLQLAEKVASELYWQGSVIPSEIMFREVN"
FT   gene            794058..796118
FT                   /gene="metG"
FT                   /locus_tag="D11S_0872"
FT   CDS_pept        794058..796118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="D11S_0872"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="methionine--tRNA ligase; MetRS; adds methionine to
FT                   tRNA(Met) with cleavage of ATP to AMP and diphosphate; some
FT                   MetRS enzymes form dimers depending on a C-terminal domain
FT                   that is also found in other proteins such as Trbp111 in
FT                   Aquifex aeolicus and the cold-shock protein CsaA from
FT                   Bacillus subtilis while others do not; four subfamilies
FT                   exist based on sequence motifs and zinc content"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0872"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82267"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014167661.1"
FT                   /protein_id="ACX82267.1"
FT                   /translation="MSNNKRKILVTCALPYANGPIHLGHMLEHIQADIWVRFQRMRGNE
FT                   IHFVCADDAHGTPIMLKADQMGITPEQLIDDVRQKHMADFAGFNISFDNYHSTHSEENR
FT                   ELSELIYNRLKENGFIKSRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCA
FT                   ATYSPTELISPRSVVSGATPVMKDSEHFFFDLPSFEAMLKNWLGSGSLQSEVVNKMQEW
FT                   FEAGLQQWDISRDAPYFGFQIPNEEGKYFYVWLDAPIGYMASFKNLCKRESHIDFDGLW
FT                   RKDSDAELYHFIGKDIMYFHSLFWPAMLEGADFRKPSNIFVHGYVTVNGEKMSKSRGTF
FT                   IQAATYLKYLDPECLRYYYAAKLSNRIDDLDLNLEDFVQRVNTDLVNKLVNLASRNAGF
FT                   IQKRFDGKLAASLDDQALFDEFIAQSEQIAAYYENREFGKAIREIMALTDKANKYIDDK
FT                   VPWVIAKEAGKDAELQAVCSMGIQLFRVLMGYLKPVLPKLAERAEAFLQSKLTWANLAQ
FT                   PLLNHPIAPFKALFSRLDGKQIEAMIEASKAENAQVNAPATAKSAVKNTGESAGGIEPI
FT                   AETITIDDFAKLDLRVAKVLKCEAVPESNKLLRFELDLGDHKRQVFSGIKAAYDKPEEL
FT                   EGRFVIMVANLAPRKMKFGVSEGMILSAGTGGADLFLLSADEGVTAGMQVK"
FT   gene            complement(796252..796446)
FT                   /locus_tag="D11S_0873"
FT   CDS_pept        complement(796252..796446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0873"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0873"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82268"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717448.1"
FT                   /protein_id="ACX82268.1"
FT                   /translation="MKWTDTQQIAETLYDNNPDLDPKTVRFTDLHRWICELDNFDDDPQ
FT                   KSNESILEAILLKWLEEYE"
FT   gene            complement(796446..796787)
FT                   /locus_tag="D11S_0874"
FT   CDS_pept        complement(796446..796787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0874"
FT                   /product="2Fe-2S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0874"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82269"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717450.1"
FT                   /protein_id="ACX82269.1"
FT                   /translation="MPKVIFLPNEEFCPEGMVVDAAAGDNLLEVAHNAGVEIHHACDGS
FT                   CACTTCHVVVREGGDSLNEPCDQEEDMLDKAWGLEIDSRLSCQCIIGDEDLVVEIPKYN
FT                   INHANEAAH"
FT   gene            complement(796799..798658)
FT                   /gene="hscA"
FT                   /locus_tag="D11S_0875"
FT   CDS_pept        complement(796799..798658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /locus_tag="D11S_0875"
FT                   /product="chaperone protein HscA"
FT                   /note="involved in the maturation of iron-sulfur
FT                   cluster-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0875"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82270"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012771627.1"
FT                   /protein_id="ACX82270.1"
FT                   /translation="MALLQIAEPGQSAAPHQHKLAVGIDLGTTNSLIASVRNGHSEILL
FT                   DGQDRPLLPSVVHFGGDDKIIVGYEAAELAVHDPQNTVISVKRLIGRSLADIQQRYPNL
FT                   PYQFVASENGLPLLQTTQGARSPIEISAEILKKLTALGEQRLGGSLVGAVITVPAYFDD
FT                   AQRQSTKDAAKLAGLNVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDISILRLS
FT                   RGVFEVLATGGDTALGGDDFDLLLANWIIEQSAMKPENDSQYRELIELANQLKLTLSHE
FT                   TETQIHYRNWLGNITREQFNELIQPLVKRSLLACRRALKDAGVEADEVHKVVMVGGSTR
FT                   VPYVREQVGKFFQKQPLTSIDPDKVVALGAAIQADILAGNKPDSDLLLLDVIPLSLGIE
FT                   TMGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSVHIVQGEREMVTDCRSLARFTLRG
FT                   IPPMAAGAAHIRVTYQVDADGLLSVTAMEKTTGVQSSIQVKPSYGLTDDEIANMLKASM
FT                   ENAKEDIQARLLAEQRVEAERVLESVRSALAQDYDLLDDDELSAVKNTIISLEQLKQQE
FT                   DYIAIKQGIKALDLATQDFAARRMDKSIRAALAGQSVEDIVGK"
FT   gene            complement(798679..799200)
FT                   /gene="hscB"
FT                   /locus_tag="D11S_0876"
FT   CDS_pept        complement(798679..799200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="D11S_0876"
FT                   /product="co-chaperone HscB"
FT                   /note="J-type co-chaperone that regulates the ATPase and
FT                   peptide-binding activity of Hsc66 chaperone; may function
FT                   in biogenesis of iron-sulfur proteins"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0876"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82271"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005559982.1"
FT                   /protein_id="ACX82271.1"
FT                   /translation="MNNPFALFDLPVAFQVDAALLNERYLALQKSLHPDNFSAASAQEQ
FT                   RLAIQKSAEINDALRILKDPIARADSIIDINTGETENVEEKSTSDIAFLMQQMEWRETL
FT                   ENIEQQKNANELTAFSQEIQQTRGAILTELSTALNEQQWQTARAITDKLRFIKKLQAEI
FT                   ERVEENLFDL"
FT   gene            complement(799212..799535)
FT                   /gene="iscA"
FT                   /locus_tag="D11S_0877"
FT   CDS_pept        complement(799212..799535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA"
FT                   /locus_tag="D11S_0877"
FT                   /product="iron-sulfur cluster assembly protein"
FT                   /note="forms iron-sulfur clusters of ferredoxin [2FE-2S];
FT                   binds iron in the presence of the thioredoxin reductase
FT                   system; forms homodimers and tetramers; similar to SufA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0877"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82272"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717456.1"
FT                   /protein_id="ACX82272.1"
FT                   /translation="MSITLTESAADRVKTFLAKRGKGIGLRLGVKTSGCSGLSYMLEFV
FT                   DALNEDDQVFEQHGVKVIVDTKSLVYLDGTQLDFTKEGLNEGFKFANPNVKDECGCGES
FT                   FNV"
FT   gene            complement(799667..800050)
FT                   /locus_tag="D11S_0878"
FT   CDS_pept        complement(799667..800050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0878"
FT                   /product="scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0878"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82273"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005700961.1"
FT                   /protein_id="ACX82273.1"
FT                   /translation="MTYSNKVIDHYENPRNVGSMDRKDSAVGTGMVGAPACGDVMQLQI
FT                   RVNDDGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLEEAGAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKKGS"
FT   gene            complement(800110..801324)
FT                   /locus_tag="D11S_0879"
FT   CDS_pept        complement(800110..801324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="D11S_0879"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="catalyzes the removal of elemental sulfur from
FT                   cysteine to produce alanine; involved in NAD biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:D11S_0879"
FT                   /db_xref="EnsemblGenomes-Tr:ACX82274"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006717464.1"
FT                   /protein_id="ACX82274.1"
FT                   /translation="MKLPIYLDYAATCPVDERVAKKMMEYLTINGVFGNPASRSHKFGW
FT                   QAEEAVDVARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITCKTEH
FT                   KAVLDTCRQLEREGFEVTYLEPESDGLIDLEKFKAALRPDTILASIMHVNNEIGVIQDI
FT                   KAIGELCRANKTIFHVDATQSVGKVEINLAELPVDLMSMSGHKLYGPKGIGALYVRRKP
FT                   RIRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEIPRIKALRDRLYNGL
FT                   KNIEETYVNGSMEHRVANNLNISFNYVEGESLIMALRDIAVSSGSACTS