(data stored in SCRATCH3701 zone)

EMBL: CP001734

ID   CP001734; SV 1; circular; genomic DNA; STD; PRO; 2864304 BP.
XX
AC   CP001734; ABTO01000000-ABTO01000032;
XX
PR   Project:PRJNA29199;
XX
DT   13-SEP-2009 (Rel. 102, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Desulfohalobium retbaense DSM 5692, complete genome.
XX
KW   .
XX
OS   Desulfohalobium retbaense DSM 5692
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfovibrionales;
OC   Desulfohalobiaceae; Desulfohalobium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2864304
RX   PUBMED; 21304676.
RA   Spring S., Nolan M., Lapidus A., Glavina Del Rio T., Copeland A., Tice H.,
RA   Cheng J.F., Lucas S., Land M., Chen F., Bruce D., Goodwin L., Pitluck S.,
RA   Ivanova N., Mavromatis K., Mikhailova N., Pati A., Chen A., Palaniappan K.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Munk C., Kiss H., Chain P., Han C.,
RA   Brettin T., Detter J.C., Schuler E., Goker M., Rohde M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Desulfohalobium retbaense type strain
RT   (HR(100))";
RL   Stand Genomic Sci 2(1):38-48(2010).
XX
RN   [2]
RP   1-2864304
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Munk A.C., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Spring S., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Desulfohalobium retbaense DSM 5692";
RL   Unpublished.
XX
RN   [3]
RP   1-2864304
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Munk A.C., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Spring S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (08-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; cd4612dca0c1f0e18225f42924e8e23b.
DR   BioSample; SAMN02598459.
DR   CABRI; DSM 5692.
DR   EnsemblGenomes-Gn; Dret_R0001.
DR   EnsemblGenomes-Gn; Dret_R0002.
DR   EnsemblGenomes-Gn; Dret_R0003.
DR   EnsemblGenomes-Gn; Dret_R0004.
DR   EnsemblGenomes-Gn; Dret_R0005.
DR   EnsemblGenomes-Gn; Dret_R0006.
DR   EnsemblGenomes-Gn; Dret_R0007.
DR   EnsemblGenomes-Gn; Dret_R0008.
DR   EnsemblGenomes-Gn; Dret_R0009.
DR   EnsemblGenomes-Gn; Dret_R0010.
DR   EnsemblGenomes-Gn; Dret_R0011.
DR   EnsemblGenomes-Gn; Dret_R0012.
DR   EnsemblGenomes-Gn; Dret_R0013.
DR   EnsemblGenomes-Gn; Dret_R0014.
DR   EnsemblGenomes-Gn; Dret_R0015.
DR   EnsemblGenomes-Gn; Dret_R0016.
DR   EnsemblGenomes-Gn; Dret_R0017.
DR   EnsemblGenomes-Gn; Dret_R0018.
DR   EnsemblGenomes-Gn; Dret_R0019.
DR   EnsemblGenomes-Gn; Dret_R0020.
DR   EnsemblGenomes-Gn; Dret_R0021.
DR   EnsemblGenomes-Gn; Dret_R0022.
DR   EnsemblGenomes-Gn; Dret_R0023.
DR   EnsemblGenomes-Gn; Dret_R0024.
DR   EnsemblGenomes-Gn; Dret_R0025.
DR   EnsemblGenomes-Gn; Dret_R0026.
DR   EnsemblGenomes-Gn; Dret_R0027.
DR   EnsemblGenomes-Gn; Dret_R0028.
DR   EnsemblGenomes-Gn; Dret_R0029.
DR   EnsemblGenomes-Gn; Dret_R0030.
DR   EnsemblGenomes-Gn; Dret_R0031.
DR   EnsemblGenomes-Gn; Dret_R0032.
DR   EnsemblGenomes-Gn; Dret_R0033.
DR   EnsemblGenomes-Gn; Dret_R0034.
DR   EnsemblGenomes-Gn; Dret_R0035.
DR   EnsemblGenomes-Gn; Dret_R0036.
DR   EnsemblGenomes-Gn; Dret_R0037.
DR   EnsemblGenomes-Gn; Dret_R0038.
DR   EnsemblGenomes-Gn; Dret_R0039.
DR   EnsemblGenomes-Gn; Dret_R0040.
DR   EnsemblGenomes-Gn; Dret_R0041.
DR   EnsemblGenomes-Gn; Dret_R0042.
DR   EnsemblGenomes-Gn; Dret_R0043.
DR   EnsemblGenomes-Gn; Dret_R0044.
DR   EnsemblGenomes-Gn; Dret_R0045.
DR   EnsemblGenomes-Gn; Dret_R0046.
DR   EnsemblGenomes-Gn; Dret_R0047.
DR   EnsemblGenomes-Gn; Dret_R0048.
DR   EnsemblGenomes-Gn; Dret_R0049.
DR   EnsemblGenomes-Gn; Dret_R0050.
DR   EnsemblGenomes-Gn; Dret_R0051.
DR   EnsemblGenomes-Gn; Dret_R0052.
DR   EnsemblGenomes-Gn; Dret_R0053.
DR   EnsemblGenomes-Gn; Dret_R0054.
DR   EnsemblGenomes-Gn; Dret_R0055.
DR   EnsemblGenomes-Gn; Dret_R0056.
DR   EnsemblGenomes-Gn; Dret_R0057.
DR   EnsemblGenomes-Gn; Dret_R0058.
DR   EnsemblGenomes-Gn; Dret_R0059.
DR   EnsemblGenomes-Gn; Dret_R0060.
DR   EnsemblGenomes-Gn; EBG00001186906.
DR   EnsemblGenomes-Gn; EBG00001186907.
DR   EnsemblGenomes-Gn; EBG00001186908.
DR   EnsemblGenomes-Gn; EBG00001186909.
DR   EnsemblGenomes-Gn; EBG00001186910.
DR   EnsemblGenomes-Gn; EBG00001186911.
DR   EnsemblGenomes-Gn; EBG00001186912.
DR   EnsemblGenomes-Gn; EBG00001186913.
DR   EnsemblGenomes-Gn; EBG00001186914.
DR   EnsemblGenomes-Gn; EBG00001186915.
DR   EnsemblGenomes-Gn; EBG00001186916.
DR   EnsemblGenomes-Gn; EBG00001186917.
DR   EnsemblGenomes-Gn; EBG00001186918.
DR   EnsemblGenomes-Gn; EBG00001186919.
DR   EnsemblGenomes-Gn; EBG00001186920.
DR   EnsemblGenomes-Gn; EBG00001186921.
DR   EnsemblGenomes-Gn; EBG00001186922.
DR   EnsemblGenomes-Gn; EBG00001186923.
DR   EnsemblGenomes-Gn; EBG00001186924.
DR   EnsemblGenomes-Gn; EBG00001186925.
DR   EnsemblGenomes-Gn; EBG00001186926.
DR   EnsemblGenomes-Gn; EBG00001186927.
DR   EnsemblGenomes-Gn; EBG00001186928.
DR   EnsemblGenomes-Gn; EBG00001186929.
DR   EnsemblGenomes-Gn; EBG00001186930.
DR   EnsemblGenomes-Gn; EBG00001186931.
DR   EnsemblGenomes-Gn; EBG00001186932.
DR   EnsemblGenomes-Gn; EBG00001186933.
DR   EnsemblGenomes-Gn; EBG00001186934.
DR   EnsemblGenomes-Gn; EBG00001186935.
DR   EnsemblGenomes-Gn; EBG00001186936.
DR   EnsemblGenomes-Gn; EBG00001186937.
DR   EnsemblGenomes-Gn; EBG00001186938.
DR   EnsemblGenomes-Gn; EBG00001186939.
DR   EnsemblGenomes-Gn; EBG00001186940.
DR   EnsemblGenomes-Gn; EBG00001186941.
DR   EnsemblGenomes-Gn; EBG00001186942.
DR   EnsemblGenomes-Gn; EBG00001186943.
DR   EnsemblGenomes-Gn; EBG00001186944.
DR   EnsemblGenomes-Gn; EBG00001186945.
DR   EnsemblGenomes-Gn; EBG00001186946.
DR   EnsemblGenomes-Gn; EBG00001186947.
DR   EnsemblGenomes-Gn; EBG00001186948.
DR   EnsemblGenomes-Gn; EBG00001186949.
DR   EnsemblGenomes-Gn; EBG00001186950.
DR   EnsemblGenomes-Gn; EBG00001186951.
DR   EnsemblGenomes-Gn; EBG00001186952.
DR   EnsemblGenomes-Gn; EBG00001186953.
DR   EnsemblGenomes-Gn; EBG00001186954.
DR   EnsemblGenomes-Gn; EBG00001186955.
DR   EnsemblGenomes-Gn; EBG00001186956.
DR   EnsemblGenomes-Gn; EBG00001186957.
DR   EnsemblGenomes-Gn; EBG00001186958.
DR   EnsemblGenomes-Gn; EBG00001186959.
DR   EnsemblGenomes-Gn; EBG00001186960.
DR   EnsemblGenomes-Gn; EBG00001186961.
DR   EnsemblGenomes-Gn; EBG00001186962.
DR   EnsemblGenomes-Gn; EBG00001186963.
DR   EnsemblGenomes-Gn; EBG00001186964.
DR   EnsemblGenomes-Gn; EBG00001186965.
DR   EnsemblGenomes-Gn; EBG00001186966.
DR   EnsemblGenomes-Gn; EBG00001186967.
DR   EnsemblGenomes-Gn; EBG00001186968.
DR   EnsemblGenomes-Gn; EBG00001186969.
DR   EnsemblGenomes-Gn; EBG00001186970.
DR   EnsemblGenomes-Gn; EBG00001186971.
DR   EnsemblGenomes-Gn; EBG00001186972.
DR   EnsemblGenomes-Tr; Dret_R0001-1.
DR   EnsemblGenomes-Tr; Dret_R0002-1.
DR   EnsemblGenomes-Tr; Dret_R0003-1.
DR   EnsemblGenomes-Tr; Dret_R0004-1.
DR   EnsemblGenomes-Tr; Dret_R0005-1.
DR   EnsemblGenomes-Tr; Dret_R0006-1.
DR   EnsemblGenomes-Tr; Dret_R0007-1.
DR   EnsemblGenomes-Tr; Dret_R0008-1.
DR   EnsemblGenomes-Tr; Dret_R0009-1.
DR   EnsemblGenomes-Tr; Dret_R0010-1.
DR   EnsemblGenomes-Tr; Dret_R0011-1.
DR   EnsemblGenomes-Tr; Dret_R0012-1.
DR   EnsemblGenomes-Tr; Dret_R0013-1.
DR   EnsemblGenomes-Tr; Dret_R0014-1.
DR   EnsemblGenomes-Tr; Dret_R0015-1.
DR   EnsemblGenomes-Tr; Dret_R0016-1.
DR   EnsemblGenomes-Tr; Dret_R0017-1.
DR   EnsemblGenomes-Tr; Dret_R0018-1.
DR   EnsemblGenomes-Tr; Dret_R0019-1.
DR   EnsemblGenomes-Tr; Dret_R0020-1.
DR   EnsemblGenomes-Tr; Dret_R0021-1.
DR   EnsemblGenomes-Tr; Dret_R0022-1.
DR   EnsemblGenomes-Tr; Dret_R0023-1.
DR   EnsemblGenomes-Tr; Dret_R0024-1.
DR   EnsemblGenomes-Tr; Dret_R0025-1.
DR   EnsemblGenomes-Tr; Dret_R0026-1.
DR   EnsemblGenomes-Tr; Dret_R0027-1.
DR   EnsemblGenomes-Tr; Dret_R0028-1.
DR   EnsemblGenomes-Tr; Dret_R0029-1.
DR   EnsemblGenomes-Tr; Dret_R0030-1.
DR   EnsemblGenomes-Tr; Dret_R0031-1.
DR   EnsemblGenomes-Tr; Dret_R0032-1.
DR   EnsemblGenomes-Tr; Dret_R0033-1.
DR   EnsemblGenomes-Tr; Dret_R0034-1.
DR   EnsemblGenomes-Tr; Dret_R0035-1.
DR   EnsemblGenomes-Tr; Dret_R0036-1.
DR   EnsemblGenomes-Tr; Dret_R0037-1.
DR   EnsemblGenomes-Tr; Dret_R0038-1.
DR   EnsemblGenomes-Tr; Dret_R0039-1.
DR   EnsemblGenomes-Tr; Dret_R0040-1.
DR   EnsemblGenomes-Tr; Dret_R0041-1.
DR   EnsemblGenomes-Tr; Dret_R0042-1.
DR   EnsemblGenomes-Tr; Dret_R0043-1.
DR   EnsemblGenomes-Tr; Dret_R0044-1.
DR   EnsemblGenomes-Tr; Dret_R0045-1.
DR   EnsemblGenomes-Tr; Dret_R0046-1.
DR   EnsemblGenomes-Tr; Dret_R0047-1.
DR   EnsemblGenomes-Tr; Dret_R0048-1.
DR   EnsemblGenomes-Tr; Dret_R0049-1.
DR   EnsemblGenomes-Tr; Dret_R0050-1.
DR   EnsemblGenomes-Tr; Dret_R0051-1.
DR   EnsemblGenomes-Tr; Dret_R0052-1.
DR   EnsemblGenomes-Tr; Dret_R0053-1.
DR   EnsemblGenomes-Tr; Dret_R0054-1.
DR   EnsemblGenomes-Tr; Dret_R0055-1.
DR   EnsemblGenomes-Tr; Dret_R0056-1.
DR   EnsemblGenomes-Tr; Dret_R0057-1.
DR   EnsemblGenomes-Tr; Dret_R0058-1.
DR   EnsemblGenomes-Tr; Dret_R0059-1.
DR   EnsemblGenomes-Tr; Dret_R0060-1.
DR   EnsemblGenomes-Tr; EBT00001765272.
DR   EnsemblGenomes-Tr; EBT00001765275.
DR   EnsemblGenomes-Tr; EBT00001765278.
DR   EnsemblGenomes-Tr; EBT00001765280.
DR   EnsemblGenomes-Tr; EBT00001765282.
DR   EnsemblGenomes-Tr; EBT00001765283.
DR   EnsemblGenomes-Tr; EBT00001765285.
DR   EnsemblGenomes-Tr; EBT00001765287.
DR   EnsemblGenomes-Tr; EBT00001765290.
DR   EnsemblGenomes-Tr; EBT00001765291.
DR   EnsemblGenomes-Tr; EBT00001765293.
DR   EnsemblGenomes-Tr; EBT00001765295.
DR   EnsemblGenomes-Tr; EBT00001765297.
DR   EnsemblGenomes-Tr; EBT00001765299.
DR   EnsemblGenomes-Tr; EBT00001765302.
DR   EnsemblGenomes-Tr; EBT00001765305.
DR   EnsemblGenomes-Tr; EBT00001765307.
DR   EnsemblGenomes-Tr; EBT00001765309.
DR   EnsemblGenomes-Tr; EBT00001765311.
DR   EnsemblGenomes-Tr; EBT00001765312.
DR   EnsemblGenomes-Tr; EBT00001765313.
DR   EnsemblGenomes-Tr; EBT00001765314.
DR   EnsemblGenomes-Tr; EBT00001765315.
DR   EnsemblGenomes-Tr; EBT00001765316.
DR   EnsemblGenomes-Tr; EBT00001765317.
DR   EnsemblGenomes-Tr; EBT00001765318.
DR   EnsemblGenomes-Tr; EBT00001765319.
DR   EnsemblGenomes-Tr; EBT00001765320.
DR   EnsemblGenomes-Tr; EBT00001765321.
DR   EnsemblGenomes-Tr; EBT00001765322.
DR   EnsemblGenomes-Tr; EBT00001765324.
DR   EnsemblGenomes-Tr; EBT00001765325.
DR   EnsemblGenomes-Tr; EBT00001765326.
DR   EnsemblGenomes-Tr; EBT00001765328.
DR   EnsemblGenomes-Tr; EBT00001765331.
DR   EnsemblGenomes-Tr; EBT00001765333.
DR   EnsemblGenomes-Tr; EBT00001765337.
DR   EnsemblGenomes-Tr; EBT00001765342.
DR   EnsemblGenomes-Tr; EBT00001765346.
DR   EnsemblGenomes-Tr; EBT00001765348.
DR   EnsemblGenomes-Tr; EBT00001765350.
DR   EnsemblGenomes-Tr; EBT00001765351.
DR   EnsemblGenomes-Tr; EBT00001765353.
DR   EnsemblGenomes-Tr; EBT00001765355.
DR   EnsemblGenomes-Tr; EBT00001765357.
DR   EnsemblGenomes-Tr; EBT00001765359.
DR   EnsemblGenomes-Tr; EBT00001765361.
DR   EnsemblGenomes-Tr; EBT00001765362.
DR   EnsemblGenomes-Tr; EBT00001765366.
DR   EnsemblGenomes-Tr; EBT00001765368.
DR   EnsemblGenomes-Tr; EBT00001765370.
DR   EnsemblGenomes-Tr; EBT00001765372.
DR   EnsemblGenomes-Tr; EBT00001765375.
DR   EnsemblGenomes-Tr; EBT00001765379.
DR   EnsemblGenomes-Tr; EBT00001765382.
DR   EnsemblGenomes-Tr; EBT00001765384.
DR   EnsemblGenomes-Tr; EBT00001765386.
DR   EnsemblGenomes-Tr; EBT00001765389.
DR   EnsemblGenomes-Tr; EBT00001765391.
DR   EnsemblGenomes-Tr; EBT00001765393.
DR   EnsemblGenomes-Tr; EBT00001765395.
DR   EnsemblGenomes-Tr; EBT00001765396.
DR   EnsemblGenomes-Tr; EBT00001765398.
DR   EnsemblGenomes-Tr; EBT00001765400.
DR   EnsemblGenomes-Tr; EBT00001765404.
DR   EnsemblGenomes-Tr; EBT00001765406.
DR   EnsemblGenomes-Tr; EBT00001765407.
DR   EuropePMC; PMC6491731; 31068923.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP001734.
DR   SILVA-SSU; CP001734.
DR   StrainInfo; 159390; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082992
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Desulfohalobium retbaense DSM 5692
CC   Culture Collection ID :: DSM 5692
CC   GOLD Stamp ID         :: Gi02246
CC   Greengenes ID         :: 10400
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Saline sediment from Retba Lake in Senegal
CC                            Africa
CC   Isolation Country     :: Senegal
CC   Latitude              :: 14.833333
CC   Longitude             :: -17.233333
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 35C
CC   Salinity              :: Halophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Phenotypes            :: Sulfate reducer
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2864304
FT                   /organism="Desulfohalobium retbaense DSM 5692"
FT                   /strain="DSM 5692"
FT                   /mol_type="genomic DNA"
FT                   /country="Senegal:Lake Retba"
FT                   /db_xref="taxon:485915"
FT                   /culture_collection="DSM:5692"
FT   gene            31..321
FT                   /locus_tag="Dret_0001"
FT   CDS_pept        31..321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0001"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_00120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67303"
FT                   /db_xref="GOA:C8WZ28"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR027588"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ28"
FT                   /inference="similar to AA sequence:KEGG:DMR_00120"
FT                   /protein_id="ACV67303.1"
FT                   /translation="MHLKKVKSSMEPLFERMKTGVADGELPSHDDVSQFVRLCRQMYDF
FT                   AEEEWLMEAEDFLHLANQLSRAVKNGELPEVVQLVDSLEDACAYCHRTFRD"
FT   gene            703..1515
FT                   /locus_tag="Dret_0002"
FT   CDS_pept        703..1515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0002"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   dde:Dde_0031 chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67304"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ29"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACV67304.1"
FT                   /translation="MMATMQQIIVLANQKGGVGKTTTAINLAASLAAMEKRVLVVDCDP
FT                   QANASSGLGIASDTGKGSIYEALFSPERITDAIYPSQLDYLDVVPSTPDLVGAELELVD
FT                   RIGREFYLREALQNIGQGYEYILLDCPPSLGLVTVNALCAANALLVPLQCEYYALEGIA
FT                   HLMRTYELVRKRLNPGLDFLGVVLTMFDRRNRLSTQVRNEVRNYFAGKAFETIIPRNVR
FT                   LSEAPSYGKPALCYDHRSKGTQAYLALASELTRRYADAEKQNTEPVSA"
FT   gene            complement(1715..2137)
FT                   /locus_tag="Dret_0003"
FT   CDS_pept        complement(1715..2137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_00140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67305"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ30"
FT                   /inference="similar to AA sequence:KEGG:DMR_00140"
FT                   /protein_id="ACV67305.1"
FT                   /translation="MSESFEPVQPLYDGNGRLLGIFISAPIWDQVDVQVKPILEKALGN
FT                   QGVGSDPKPLKEPMEDWQNLLHFWDFKYPVDTSVHCEHCGNSTENWETDDPRKFILKAA
FT                   NLGGLAAFECCQCQARITKRHFKDHIAVETDPPADS"
FT   gene            2671..3615
FT                   /locus_tag="Dret_0004"
FT   CDS_pept        2671..3615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0004"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: dvu:DVU3360 ParB family protein; TIGRFAM:
FT                   parB-like partition protein; PFAM: ParB domain protein
FT                   nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67306"
FT                   /db_xref="GOA:C8WZ31"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ31"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACV67306.1"
FT                   /translation="MASMSRGLGKGLDALLNSSASEPDDALAASAANTTDVQLLDLTQI
FT                   KPNPQQPRRTFTEESLEELAQSITEQGVLQPILVRPVADGYQIVAGERRWRASRLAGLE
FT                   QVPALVRSLSDKESLVLALLENLQREDLNPLEEAQALERLQGEMGVSQSELAKHVCKSR
FT                   SAVANSLRLLQLDEEIRQAVLDGSLSAGNARTLMGVNDAAARMDLFEIVLMHELTVRQT
FT                   EKIVSYWKEHGQFPAPYGGKSQHRAPAAAQRDRFLQDLQQVLKDHLPAKIQLRGGREKG
FT                   KISMHYDSPEQLEQILSMLGVPAEGVSRETPSA"
FT   gene            3740..4756
FT                   /locus_tag="Dret_0005"
FT   CDS_pept        3740..4756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0005"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein; PFAM: PfkB
FT                   domain protein; KEGG: dde:Dde_0028 D-alpha,beta-D-heptose
FT                   7- phosphate 1-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67307"
FT                   /db_xref="GOA:C8WZ32"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ32"
FT                   /inference="protein motif:TFAM:TIGR02198"
FT                   /protein_id="ACV67307.1"
FT                   /translation="MPNQLTSSLLEGALPRLHGKRVLVVGDVMLDHYQQGSVERISPEA
FT                   PVPVVHVESEEYRLGGAGNVARNIKSLGGEPTLLSCVGRDAARERLTELLKAEAVQHSL
FT                   ISDPHWRTTRKTRVMAAGQQIVRIDHERMGQARDSGRERFAALVGETLPDFDVVILSDY
FT                   GKGALDHSLLEAVRRKAHHTGAKILIDPKIQNFHLYAEPYLITPNRKEAGEGAGMRVET
FT                   REDVLMAGRRLLRRNNCANVLITLGGDGMALFLESGEVWHLPTSGQKVFDVTGAGDTVI
FT                   GVTALGLSAGLELAHACALANFAAGVVVAQVGAASVTAEELGQTLQEKHGLAFSRWE"
FT   gene            4842..7070
FT                   /locus_tag="Dret_0006"
FT   CDS_pept        4842..7070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0006"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: dvl:Dvul_0018 ribonucleotide-diphosphate
FT                   reductase subunit alpha; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67308"
FT                   /db_xref="GOA:C8WZ33"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ33"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ACV67308.1"
FT                   /translation="MQMPDDLPDLSLSENAELVLRKRYVRKGPEGEEMETPQELFWRVA
FT                   AAIAASETAYEQTPFSQEALARRFYDLMASCRFFPNSPTLMNAGTELGQLAACFVLPVG
FT                   DSMEEIFDAIKYAALIHKSGGGTGFSFSRLRAADSRVGSTGGVASGPISFLRIFNTATE
FT                   QVKQGGTRRGANMGILRVDHPDILEFIRVKEREGELNNFNLSVALTEDFMRRVEADAEY
FT                   PLIAPQSEKEVGRLRAREVFTLLVQKAWESGDPGIIFLDRINRDNPTPQLGDIEATNPC
FT                   GEQPLLPYEACNLGSINLSRFADAPAQELDWEGLRESVHLAVRFLDNVIDASVYPLPQI
FT                   TDQVKRNRKIGLGIMGWADLLYQLRIAYDSRQALSLGEKVMDFIQKEARSASKDLARER
FT                   GPFPAYADSVFGKQNLGPYRNATTTTIAPTGTLSILAGCSSGIEPLFALSFVREVMDGE
FT                   RLVETNPIFRQAMEEAGCASQRLLDEVARKGTVRDMELVPDDMRNVFVTAMDIDGEAHL
FT                   RMQAAFQKYTDNAVSKTVNLPHEATQEDIRHIYWLAYEQGCKGVTVYRDGCKSVQVLST
FT                   EESRSQRQAEEEGKAPVRQRPDVVYGFTQKVKTGLGELYLTVNEVDGRPFEVFATIGRS
FT                   GRSITAKAEAIGRLVSLALRSGVPVREVVKQLKGIGGEHPVFQEKGLLLSIPDAVGRVL
FT                   EQRYLQDELATSGSGKDLTKRSCPECGGELVFQEGCFLCQACGYTKCG"
FT   gene            7122..7817
FT                   /locus_tag="Dret_0007"
FT   CDS_pept        7122..7817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0007"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: dde:Dde_0114 cell division ATP-binding protein
FT                   FtsE; TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67309"
FT                   /db_xref="GOA:C8WZ34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ34"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ACV67309.1"
FT                   /translation="MVEIEHLSYAFGRSWALQDVSFRIDPGDFLFLTGPSGAGKTTLLR
FT                   MLHGSLPVQRGRARVAGFELNTLKRRHIPKLRRHVSVVFQDFKVLPRRTVFANVAIALE
FT                   VRGMQREQLRRRVRAVLRSLGLEAKQHRPCGELSGGEQQRVAIARAVVVNPDLLLADEP
FT                   TGNLDARLSARLLDVFRRFHAHGTTVILATHNRQVLESEPQAKIVCLKEGKMVGDNFLK
FT                   GQSEAEQGL"
FT   gene            7814..8689
FT                   /locus_tag="Dret_0008"
FT   CDS_pept        7814..8689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0008"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dde:Dde_0115 cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67310"
FT                   /db_xref="GOA:C8WZ35"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ35"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACV67310.1"
FT                   /translation="MIGLWWRLLVRGVRDIGLDKWVQLFTLGAVTLVTFLAGGFLLLVH
FT                   NLDTQLVQRQGSVQFQVYWQRNATLETVQQDWRSLEGWSGLRSLQEFTPRQAALSLDGA
FT                   LEGEVELKSERSHILPATALLRFRVPGENAQQWAQQRLDRLRALPRVAEVHYNPLQLQT
FT                   AGSWVQISQRLVWPVIGFLVLVLALVVGNTFRLALLHRRDEVELLQLVGAGRWYIQMPL
FT                   LVGGALQGAAGAGLALGLLKGAQLGLESILNTAPLWIQVHYLPWHLVGGVVAGVTAVGA
FT                   VSSWIAVKEE"
FT   gene            8770..10440
FT                   /locus_tag="Dret_0009"
FT   CDS_pept        8770..10440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0009"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: dvl:Dvul_0024 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67311"
FT                   /db_xref="GOA:C8WZ36"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ36"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACV67311.1"
FT                   /translation="MRSRKMTQGLERAPHRSLLYATGMTREEMDRPLIGVVNAANDIVP
FT                   GHIHLGTISQAVKDGVRMGGGTPLSFPAIGVCDGLAMGHEGMRMSLPSREIIADSIELM
FT                   ATAHPFDGLVLIPNCDKIVPAMLMAMLRLNIPAILVSGGPMLAGKSKGQATDLIKVFEG
FT                   VGQVKRGTMPSEELDELEQSACPGCGSCSGMFTANSMNCLAEAIGLALPGNGTIPAVAA
FT                   GRVRLAKAAGQQVLHLVEKQITPRSIVTAESVANAVTVDMALGCSTNTVLHLPAIFREA
FT                   KLELGLDIFDAISSKTPNLCRLSPAGPDHIEDLDQVGGIPAVMQELASGGLLNTGVATV
FT                   TGRTLQENLASVQRPGHQEVVRSLDNPYSERGGIAILRGNIAPDGAVVKQSAVHPDMMV
FT                   RSGPARVFDSEEDAVEAILGDAISAGDVIVIRYEGPKGGPGMREMLSPTSAIAGMGLDA
FT                   DVGLITDGRFSGGTRGAAIGHVSPEAAEGGVIGLIEEGDTIHINIPERRLQLEVEASEL
FT                   QRRREVWQPVHKEVQSPVLRRYRKLATSAAQGAVYRDDE"
FT   gene            10491..11237
FT                   /locus_tag="Dret_0010"
FT   CDS_pept        10491..11237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0010"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methionine
FT                   biosynthesis MetW protein; Methyltransferase type 12; KEGG:
FT                   dvl:Dvul_0026 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67312"
FT                   /db_xref="GOA:C8WZ37"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ37"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV67312.1"
FT                   /translation="MADSVCWGKEELERLRAWEHSFPGRYALGMERSLLFRLMSGWPRR
FT                   RQRLLEVGCGTGFFLEAAWESGFSVSGLDRSPLMLQATRERLGPRADLHLGTAEDLPFW
FT                   DNDFDFVLVLTVLECVSNPQAVLAEACRVARKGVVVSFLNPFSVYYLTHGLPWPGVRNS
FT                   LLRRAKWLSWPRLRCMIFQEAGPRPMTCRSVLPGPMVSWRNNRVCNTLNARIYPPNIGA
FT                   YQGVRIDLVGQPVGTPLLGWTHQPAA"
FT   gene            complement(11297..12538)
FT                   /locus_tag="Dret_0011"
FT   CDS_pept        complement(11297..12538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0011"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: dde:Dde_0230 molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67313"
FT                   /db_xref="GOA:C8WZ38"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ38"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACV67313.1"
FT                   /translation="MQHGFFNVVSTQWLLEQFTALGRVAGVESCSLTNAHGRVLAQDIV
FT                   AKENLPPFTRSSMDGYAVNAQDTFGASESNPGYLECVQEIAIDRLPDFTLHPGQCAALV
FT                   TGAGLPDGADSVIMVEHTQEMGTGTIEIRRSVAPGENTMLEGEDQAVGSTALHEGRRLR
FT                   PQDVGLLAALGVTDCEVIPRPKTALLSTGDEIVDVAATPRPGQIRDVNTSTLGALIQRA
FT                   GGEVTSTARVPDDLEAISTALQSGLDVADLVLISGGSSIGARDHTLTALTRLPQCTILA
FT                   HGVAMSPGKPTIVATVGETMVMGLPGQVTSAQMVMEVLGLPLLKQLGGEDPDLAPFKAT
FT                   VPAVLTRNIASRQGREDYVRARLATGQSGRIEATPVLGKSGLLKTMLQANGYLRIPAHA
FT                   EGMQKGQTVTVHLF"
FT   gene            complement(12543..13250)
FT                   /locus_tag="Dret_0012"
FT   CDS_pept        complement(12543..13250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0012"
FT                   /product="Fe-S cluster domain protein"
FT                   /note="PFAM: Fe-S cluster domain protein; KEGG:
FT                   dvl:Dvul_2363 molybdopterin-guanine dinucleotide
FT                   biosynthesis MobB region"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67314"
FT                   /db_xref="GOA:C8WZ39"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ39"
FT                   /inference="protein motif:PFAM:PF04060"
FT                   /protein_id="ACV67314.1"
FT                   /translation="MQAAVALVGYKKSGKTSLAVALAREFQSRGFSVAAAKCAHTPLDK
FT                   TQTDTGQLHEVCDVVAGLGPAETTVSWSSRHYLADLLPLLQADVLLVEGCKDQKWLPRI
FT                   LLSSPEQPADAALEPELALGCWGTPHFTGMPVFTEVPELAQHVLEHGFLLPGLDCGACG
FT                   REDCAGLTRDIVAGKVTPAACQARKADLSVKVNGQELGLNPFVRDIIGGSIRGMLSQLK
FT                   GYAPGTIDITMEA"
FT   gene            13779..15038
FT                   /locus_tag="Dret_0013"
FT   CDS_pept        13779..15038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0013"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: dvl:Dvul_0027 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67315"
FT                   /db_xref="GOA:C8WZ40"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ40"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ACV67315.1"
FT                   /translation="MSTIKKIKGFNDLFPPVSAIYSRMEQTAREVFSRYGYYEIRVPLL
FT                   EKTELFARSIGDETDVVQKEMYTFPDRKGRSLTLRPEATASVVRAYIENKRYASESVSR
FT                   MFTFGPMFRYERPQKGRQRQFHQVNCELLGAEAPQSDAELILMLWEYLQALGLDGLHLD
FT                   LNSLGCRECRPAYHETLGSYLAGVDADELCDDCRRRKTTNPLRVLDCKVEGCRSVMQQA
FT                   PRLADHLCSGCQSHFASVRTILDRAGIPYTINPRLVRGLDYYQRTTFEVVAENIGAQTA
FT                   VAGGGRYDGLVSDLGGPALPGTGFACGMERLALLLQEQEQPGTPVDFFLAVLDDEARDE
FT                   AILQAQQLRKQGLAGEVGYEAKSPKSHLRHANKAGAAYCLLLGGQELQEKAFVVKNMQS
FT                   GAQETVSWEETGRALRQQRV"
FT   gene            15251..17059
FT                   /locus_tag="Dret_0014"
FT   CDS_pept        15251..17059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0014"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); GAD domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase- type; KEGG:
FT                   dde:Dde_0012 aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67316"
FT                   /db_xref="GOA:C8WZ41"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ41"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ACV67316.1"
FT                   /translation="MEERKGKDLLQSVGGWKRTHHLAALTSENLGQEVCLMGWVQFRRD
FT                   HGGLIFIDLRDRRGLTQIVFSPEINEQAHAEAHVLRPEYVLAVKGTVRERPEGMVNPRL
FT                   ATGEIEVVVTEWKLLNVAQTPPFVLEERAEVSENVRLAHRYLDMRRPGLGSNLVVRHKA
FT                   TQAIRNYLDQLDFLEIETPVLTKSTPEGARDFLVPSRLNQGEFYALPQSPQLFKQLLMY
FT                   GGMDRYYQIVRCFRDEDLRADRQPEFTQIDMEMSFAEEEDVMGVAEGLVAEVFAKTLGV
FT                   DLPNPVPRMTYAEAVDKYGLDRPDTRFELLLEEVTELVRGSEFKLFAQAEMVKALRVPQ
FT                   GSELTRKEIDDLTEFVKIYGAKGLAWIKIKDDGWQSPIAKFLSDAECTALTDHLGLQSG
FT                   DIVFFQAGGADMVNTALGQLRLRLGERFDLVPADRFDLVWITDFPLMEWDDEAQRWVAR
FT                   HHPFTATREEDIAAMLEDPGAVIARSYDLVLNGNEIGGGSVRIHRSEDQWRMFDALGID
FT                   RAEAEEKFGFLLRALEYGAPPHAGIAFGLDRLIMILCGAESIRDVIAFPKTQKATCLLT
FT                   DAPSAVASTQLRELGLRLREKKKSEA"
FT   gene            17076..17579
FT                   /locus_tag="Dret_0015"
FT   CDS_pept        17076..17579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0015"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: dde:Dde_0013 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67317"
FT                   /db_xref="GOA:C8WZ42"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ42"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACV67317.1"
FT                   /translation="MTLSICTYPDPVLARRAEPVAEISEEVRQLASDMVETMYANQGIG
FT                   LAAPQVGKSWRLITVDISGPENQTELVTLVNPEIQWRDGETETEEGCLSVPEFRSKVQR
FT                   AAKVRVTGQDLDGNAVDMEADGLLAVCLQHEIDHLEGTIILDHVSRLKRSMYTKKVSKW
FT                   QKQD"
FT   gene            17561..18529
FT                   /locus_tag="Dret_0016"
FT   CDS_pept        17561..18529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0016"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: dde:Dde_0014
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67318"
FT                   /db_xref="GOA:C8WZ43"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ43"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACV67318.1"
FT                   /translation="MAETGLTPLRIVFMGTPEFAAVPLSALAAWDQAEIVGVYTQPDRP
FT                   CGRGRVCRPCAVKEKAQELGIPVFQPQDFKSEASREELHSLKPDVLVVAAYGLILPQTV
FT                   LDIAPMGAVNIHASLLPKYRGAAPIQRALLHGEPVTGITIMQMEAGLDSGPILLQRALG
FT                   VGVNDTAADLHDELADLGSRLVIEALAKLRQERIAPVEQDPSLATYAPKLVKTEGVVDW
FT                   NRPAQEVHNQLRALYPWPGSYFIWHPPDGGEPIRLTVFPGAIGREKKDTETPGQFLGIE
FT                   DGHLALACVDKIYLVPRIQPAGRKALDPKGFFCGYLSRCAE"
FT   gene            18603..19499
FT                   /locus_tag="Dret_0017"
FT   CDS_pept        18603..19499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0017"
FT                   /product="protein of unknown function DUF116"
FT                   /note="PFAM: protein of unknown function DUF116; KEGG:
FT                   dvl:Dvul_0031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67319"
FT                   /db_xref="GOA:C8WZ44"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ44"
FT                   /inference="protein motif:PFAM:PF01976"
FT                   /protein_id="ACV67319.1"
FT                   /translation="MQHNDDSSLSSIEQDIRASFVARKRLFIGLITGTSLLVCLVLVLL
FT                   WVVPYVGLSELHPAAPWVWGAIIAVGIGLIGWSSLAMVLNILFKRPILFSKRLRGLTIK
FT                   LFLPVMTLVGRAVGLSKEKIRSSFIKVNNELVLSEGKRYAPEKVLMLMPHCLQNSMCKY
FT                   RLTYNVENCKRCGLCPIAGLLELRDRYGVHLTVATGGTIARRIVVQTRPKVIIAVACER
FT                   DLASGIQDTYPLPVYGVLNERPHGPCLDTQVSLQRTEWALRRFVRSEALPAEKVFPEAL
FT                   PDPGRRKPKPDSSVAAG"
FT   gene            19568..20857
FT                   /locus_tag="Dret_0018"
FT   CDS_pept        19568..20857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0018"
FT                   /product="NusB/RsmB/TIM44"
FT                   /note="PFAM: NusB/RsmB/TIM44; Fmu (Sun) domain protein;
FT                   KEGG: dma:DMR_00320 rRNA (cytosine-C(5)-)-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67320"
FT                   /db_xref="GOA:C8WZ45"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ45"
FT                   /inference="protein motif:PFAM:PF01029"
FT                   /protein_id="ACV67320.1"
FT                   /translation="MSRSPALPPARQAALSCLEGVLLRDQELQASLDGVLDSASLEPRD
FT                   RALATELVYGVCRHKTHLETAITRFVHPKTRLKPRLRLILSVAAYEMLYLDRIPAYASV
FT                   DWAVNAVKKRVAVQRAGVANAVLRRLADDLHNRGRPAVVHELQAVRGSNDQAWAKAYSC
FT                   PEWIVRLWRRAYGDQTAASLLQASLQVPPVGLRFAPGPQGDQAWQRWRHRPECLQAVAR
FT                   GVAVHNVDAAAVEELEAQGSAARQSLAAQEALWALEPSAWEGPLWDGCCGRGGKTLFCR
FT                   ELGFTVYSSDPHRQRVQLLAQQSSRICLADAAYPPFRSGELRTVLLDVPCSGLGVLSRR
FT                   PDSKWKRAPEDLQGLVRLQRRMLEAAFALLPPGGRLVYMTCTCNPEENEDQIQWLCHRE
FT                   PGGVLERQWQTAWDSRLFEFFYAASVVRES"
FT   gene            complement(20979..21893)
FT                   /locus_tag="Dret_0019"
FT   CDS_pept        complement(20979..21893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0019"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate oxidase; KEGG: dvm:DvMF_2143
FT                   dihydroorotate dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67321"
FT                   /db_xref="GOA:C8WZ46"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ46"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ACV67321.1"
FT                   /translation="MDMQVAFAGLDLKNPIMTASGTFGYGTEFMPYGKLEELGAIVVKG
FT                   ISLAPRKGNPQPRITETACGMLNAIGLQNIGVEAFLRDKLPQLPWRTTPVIVNLYAQAV
FT                   EEFAELTDRLATAKGVAGLEVNISCPNVREGGVQFGQDPVLAARVTEAVKKRAGALPVM
FT                   VKLSPNVTDVTVMARAVADGGADCISCINTLTGMAVDIHSRRPCLANVVGGLSGPAIKP
FT                   VALRMVHQVVRAVDVPVVGLGGISSAEDVLEFLLVGAHAVQLGTANFVRPDTAFKLVDE
FT                   VRRLAEEMGISAWEDFRGTLELP"
FT   gene            complement(21893..22672)
FT                   /locus_tag="Dret_0020"
FT   CDS_pept        complement(21893..22672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0020"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain protein"
FT                   /note="PFAM: Dihydroorotate dehydrogenase, electron
FT                   transfer subunit, iron-sulphur cluster binding domain;
FT                   Oxidoreductase FAD-binding domain protein; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; KEGG: dvm:DvMF_2142
FT                   dihydroorotate oxidase B, electron transfer subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67322"
FT                   /db_xref="GOA:C8WZ47"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ47"
FT                   /inference="protein motif:PFAM:PF10418"
FT                   /protein_id="ACV67322.1"
FT                   /translation="MPEPQCLELRVTSLESPDNDLFYHLSLESPQWQWRPGQFAMLRPT
FT                   SWRHEPLWARPFSISDQDTNGLHFFFQRMGSGTDLLSQLRPGDVVTVWGPLGNGFTISH
FT                   TTPTMILAGGMGLAPFMGLIRHHPIPQNLELFFGHRQPLANYPFSEIEDRILAWQVREQ
FT                   GPEDLEKLFRAIEVKIKGYSIDGNLLACGPLPFLRRIQKLALDHNANTQLSLENRMACG
FT                   VGACLGCTVPTKSGELVQACTQGPVFKADAVDLSGEL"
FT   gene            complement(22750..24351)
FT                   /locus_tag="Dret_0021"
FT   CDS_pept        complement(22750..24351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0021"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: dvm:DvMF_0923 SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67323"
FT                   /db_xref="GOA:C8WZ48"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ48"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ACV67323.1"
FT                   /translation="MLELLRIRNLALIQDLEMEFDPGLNVLTGESGAGKSFILRALDFI
FT                   LGEKLQTNHVRPGADKAVVEAIFHLEGQEYVLRRELNSATGRSRVYINDDLSSQAKIRA
FT                   LRPSLIIHTSQHGQQQLLNPNFHTRLLDGDIPRELLGTKEDLLSRYKDILRRLEQLDQS
FT                   TQDLDAKRELLEYQQQQIDQVGPERGEEEQLLERKTTLREQAASQQAVQNCLEILNGAG
FT                   QPGALDLAGDLQRASQSLQSINEGLGEHAQHLQEWYEYLKELETELRSQPLPFDSTQEL
FT                   EGIEARLWELAQLQRRLNRNLDQICDLHEEIEATLSHRDQIGLERQQLERQSQEMHAEL
FT                   IQAVQEVNAAREHTASRLAEQLRQELVQLGFAEEIQIFFALHDHEVAPGIWEKRARLQW
FT                   VPNPGQPVQALDEIASGGELSRFLLGLVCLQSTRELPTLLFDEVDAGVGGVTLNSVGQR
FT                   LTELSRRQQVVLISHWPQLASRGQRHFQVAKEIVDGETFTTCHELDAQARFDELARMAG
FT                   GDEQGLAFAQQLLHNQ"
FT   gene            complement(24475..25167)
FT                   /locus_tag="Dret_0022"
FT   CDS_pept        complement(24475..25167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67324"
FT                   /db_xref="InterPro:IPR021409"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ49"
FT                   /inference="similar to AA sequence:KEGG:Dole_1611"
FT                   /protein_id="ACV67324.1"
FT                   /translation="MSAACAVLLALGPAPVKAQSELREDFASLKRWRPLFFDNIDAHST
FT                   YSIEHNASSSWLRGVADNSASALVSTEHFNPYEFPHLSWRWKVSNVYQKGDATSKSGDD
FT                   YPLRVYVLFEYDPSTASGWQKIKYGLAKAVYGDYPPDSTLNYIWANQPHDARVLINAYT
FT                   DRARMIPLRQGTRDVGKWVDESVHIIEDYREAFGESPPANATLAVMSDADNTGERAIGF
FT                   IDYLRLSP"
FT   sig_peptide     complement(25111..25167)
FT                   /locus_tag="Dret_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.989 at
FT                   residue 19"
FT   gene            25202..25597
FT                   /locus_tag="Dret_0023"
FT   CDS_pept        25202..25597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0023"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   dde:Dde_3175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67325"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ50"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ACV67325.1"
FT                   /translation="MLEITVSTSKREEFVDITEQVRRVCGDKGWQDGVVLLHCAHTTAG
FT                   LTVNESADPSVCRDILAHLRQSVPHMAGYEHGEGNSDAHIKSSLMGCSQQVLVANGRLA
FT                   LGTWQGIFFTEFDGPRQRRVWLQWIPA"
FT   gene            complement(25691..27022)
FT                   /locus_tag="Dret_0024"
FT   CDS_pept        complement(25691..27022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0024"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: dvm:DvMF_1427 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67326"
FT                   /db_xref="GOA:C8WZ51"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ51"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACV67326.1"
FT                   /translation="MPQPLKDAIALCKTIRRNGYDAYVISAALQERLLENEEHGEVDIA
FT                   TDMQPSELRKLFPLLDSSDENADLGSLQEGDMLMRFYPMDTLASSHPEVAASRLTPRLM
FT                   KKLEDRGELPTALACPYIPEVPDAYAGFCDFSDGVVNLIGVPDATLRRNYLLGVRALRF
FT                   AANYDLPMEPNTWVAILRSASRILDYVPVSDIVDEWKKVEAENMAQFFELLYETQILHG
FT                   LIPELAALSKIKQRKSEDEPELETAWQHTLDKMRLYPETLPYDWLGTTACLFHDVGKLY
FT                   TAEYTDGEWTFHQHPWVGAKITRKILKRLRFPTEDLEVICHLVRHHKRFDSMLTDRGIR
FT                   RFKALDEYPRIIEMARADVKARGGNYTAFNHNMKYLERADVPEEMLEPLLNGKEIMDFT
FT                   GLNPGPAVGIIRQALLQAQVAGDVTSIPEAVEFIRTYYEKEIRN"
FT   gene            27177..28058
FT                   /locus_tag="Dret_0025"
FT   CDS_pept        27177..28058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0025"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   dvl:Dvul_1725 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67327"
FT                   /db_xref="GOA:C8WZ52"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ52"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACV67327.1"
FT                   /translation="MRLYLWISALLAVLVWTGGAGWATAAELTVTVSILPQKAIVEAIG
FT                   GEDVQVQVMVQPGASPATYEPSPRQMAELQRSSVYFAIGVPFEKAWLPRLRQGHSDLEV
FT                   VHLEDEVVRRSMAREVGAKGHDHGSGMPDPHIWLSPPLVRTFSASIAEHLAEALPSQAA
FT                   QIRSRYVRFAASVAALDAELASKLAPLAANHPHFLVFHPSWGYFAKAYGLVQTPVQIEG
FT                   KQPSPRALQELVRLAEELDLQTVFVQPQFSRKTAQVVADQIGGQVVELDPLAADWASNL
FT                   RRVAEVMLRELS"
FT   sig_peptide     27177..27254
FT                   /locus_tag="Dret_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            28055..28876
FT                   /locus_tag="Dret_0026"
FT   CDS_pept        28055..28876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0026"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_2209 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67328"
FT                   /db_xref="GOA:C8WZ53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ53"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV67328.1"
FT                   /translation="MRHASSPKPPEVRDSQVVADIQGVDFAYTNGPKVLENVSLRILQG
FT                   QYLAVLGPNGGGKTTLIKILLGLLKPQQGQISVFGQTPAQARPRIGYLPQYAENRDDFP
FT                   VSVLDTVLMGVRTKKRWGMRYSAREREKALQSLEEVGLSGYTDRLLGHLSGGERQRVFI
FT                   ARALAADPELLILDEPTSNIDPQAKFCFYEFLAELKASVSIIVVSHDLSITTAHIDSIA
FT                   CVNKTLLYNARPEVTQEMFDLLYGMHERHTCPMAGFGPSHPGFLNRLQPRS"
FT   gene            28876..29703
FT                   /locus_tag="Dret_0027"
FT   CDS_pept        28876..29703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0027"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: dvm:DvMF_0117 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67329"
FT                   /db_xref="GOA:C8WZ54"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ54"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACV67329.1"
FT                   /translation="MLDALSYPFMQNALLAGLFASVACGIIGSLIVVNRMVFLAGGVAH
FT                   MAYGGVGLAFYAGWPVLPSTIGFTLLASLGLAGLTLNRRSRTDTVIGVFWAAGMALGIL
FT                   LLDLAPGYNVDLMSYLFGSILTVPLRDVIWMAGIVLVLLLVIGLYYRDLKAMSFDPEFA
FT                   RTRGVPVTFLHFLLVALLGVSVVMVIQVVGLILVIALLTIPSYLAQRKAQSLGRMMIAA
FT                   AGWAAVFCLFGLMAAYYFDLTSGASIIAVGTVCFFLVLVWDKCVGALRSHPSA"
FT   misc_binding    29713..29908
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 109.36"
FT   gene            30016..31941
FT                   /locus_tag="Dret_0028"
FT   CDS_pept        30016..31941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0028"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: sfu:Sfum_2744 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67330"
FT                   /db_xref="GOA:C8WZ55"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ55"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACV67330.1"
FT                   /translation="MRSVLAAALCVAVVCVGTSVGAQNATQLSEIVVTATAAPATEQDV
FT                   PVSTQIVDREAIERSGARDLEGLLQREMAADFEIQPGGYSSFGIRGFESYESLGAGFDS
FT                   GVLVLLDGTRIATGTLSLIPLDLVQRVEIVHGPGSALYGGSAMGGVVNVITRTGGQETA
FT                   GQVGVGYGSWEEKTAHVGVSGCSSEETFGYVLAGSKRTRDDYAIGGGKTYPNTAIDMQS
FT                   WGGKLTAGPGQQHQLHGVYLESRNNDLGSPGPLDDNVAENYIDDTLRHLLVTYQGESTD
FT                   GKQSWRLQPFHSEHEYAFYSNDMSKYITQMAGVRGQYNHQTARLGTLSLGAEYTQIQDE
FT                   RSGSLVYEPNSEYDVTAVFAEHRFGSGPWDLWVGARYDHYRARIEKTSELKNVETGTET
FT                   YDALTWRVGGKYWLTANLGLHAAVGTAFRPPMAKELTGKFTSYGTTYIGNPNLKSEHSV
FT                   TYETGMEWGGQHGRIEGTVFHTKYTDKIEGPSFGETGKYVNIDGWTVQGLELQGQTAFD
FT                   WSEMLIVRPHATARYYTKREQEDSGGSSQTIFQLPEYEGQIGLAVDLGAKLSLDSWLEI
FT                   RGPWEGKNVGRQTEFAVFGSRISYRPVVDLQVYLDVENLFDKRYSYKNGYPMPGRSVAA
FT                   GIEYTF"
FT   sig_peptide     30016..30084
FT                   /locus_tag="Dret_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.718 at
FT                   residue 23"
FT   gene            31973..32836
FT                   /locus_tag="Dret_0029"
FT   CDS_pept        31973..32836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0029"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dol:Dole_2060 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67331"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ56"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACV67331.1"
FT                   /translation="MALAGPVHAGPVLTDQAGRQAAVPEDPQRVVCLAPSLTETVFALK
FT                   QGERVVGVSQFSDYPPQAAKLPRVGSYVRPELERILARKPDLCLAVKDGNPRQVVDRLE
FT                   QFGIPVYAFAPYSLKQVLEMVPRLGQILNCPDQAEILHRRLSHSIDAARARAEAASSRP
FT                   RVLYLAGLAPLIGVGGDTYLHELIATAGGSNVTVDSAGYPRLSYEDILRLAPDVVLLPS
FT                   MGGRERAVEAKKRLQRWEHLPAVTQGRVHIVDADRFNRPGPRLVQALETLTALLHPGAE
FT                   AVMESK"
FT   gene            32833..32988
FT                   /locus_tag="Dret_0030"
FT   CDS_pept        32833..32988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67332"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67332.1"
FT                   /translation="MIGFVQGGPGPGILLQLGKGARWCCIAVFARKVLPLQRTAMAHGR
FT                   RSVAKP"
FT   gene            33426..34427
FT                   /locus_tag="Dret_0031"
FT   CDS_pept        33426..34427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0031"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   dol:Dole_2061 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67333"
FT                   /db_xref="GOA:C8WZ58"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ58"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACV67333.1"
FT                   /translation="MPSPVFPFRLIVICCTGLVFVLCSGVIGVCSGPAGLDLAQVWAAL
FT                   WGYAEPTTVSIVREVRLPRVLLAGLAGAGLALGGLVLQVLLRNPLAEPYILGVSGGAGV
FT                   GAVFGLLLGWPFFPGVAGGAFAGGLGIVALVLALAGRRVVQREGLLLTGVMANAFCSAI
FT                   ILFLLSLSPQLQLQSALYWLMGHFSLPPGNHLALLAGTVVLGGGVLFGLAPTLNVLLLG
FT                   HHGALGLGIPVRRVIALLLVLVAWMVSGVVALCGLIGFVGLVVPHILRLVLGTDHRELV
FT                   PACFCGGAGFVMLCDVLARTVPPQEIPVGVVTALIGAPLFIVLLVREDRWRL"
FT   gene            34415..35209
FT                   /locus_tag="Dret_0032"
FT   CDS_pept        34415..35209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0032"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dol:Dole_2062 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67334"
FT                   /db_xref="GOA:C8WZ59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ59"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV67334.1"
FT                   /translation="MAFVEARGITFGYRPGESAVVSGVDLAAEKGRLHVCIGPNGAGKS
FT                   TLLALLAGWLQPESGRVLIEGGDVHRMGRRRLARQVAVLEQDQAVVPHLTVEQLVLLGR
FT                   TPFLGWLGWEGQRDRKLAEEAMVFTHVDHLAARRLEELSGGERQRVHLARALCQQPQLL
FT                   LLDEPTASLDPAHQVRIMDLLQRLCREQGLCVCLVSHDLHLAALYADHVVLLQEGRVLG
FT                   QGPPGETMTFSLLEQAYGCVMLVEQSRLGVPLVTPVPKRFLE"
FT   gene            complement(35457..36686)
FT                   /locus_tag="Dret_0033"
FT   CDS_pept        complement(35457..36686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0033"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dat:HRM2_34570 NarK"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67335"
FT                   /db_xref="GOA:C8WZ60"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ60"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV67335.1"
FT                   /translation="MSISPSPAQPQFTRLVGPLVLISTIFFLNFISRVALGPVLLPLQE
FT                   DLGISLSRTGLIFLTLQAGYSVALLNAGWVSSRLTHRRTILLSIWAIGAGWICVGLSPS
FT                   FPVMLACLFATGLGGGLYLPSGVASITDITPSCHWGKGFAIHEMAPSLSFILAPLLVEA
FT                   LLFLGSWRLVYIVLGLSCFVVGAIYRKHSTAGRFSGQPPRLKALRAILTRPAFWAMTLF
FT                   FVLVVGGEIGVYNLAPAYLVKSHGIPREWANFILSASRLLSLGTAFGAGWCIDKLGLKR
FT                   SLTVILSAGGLATIGFAWGSSLWVAAMLVLQPIFLVAYFPAGFSALTSISEDKQNDLTV
FT                   SLTVTSASLLGAGGIPALLAYLGEHVSFSLGFTGLGVCLAASALLVPFLDFRNAAAVQE
FT                   GQECRHTEGG"
FT   gene            37283..39274
FT                   /locus_tag="Dret_0034"
FT   CDS_pept        37283..39274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0034"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: geo:Geob_1218 alpha
FT                   amylase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67336"
FT                   /db_xref="GOA:C8WZ61"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ61"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACV67336.1"
FT                   /translation="MGKKTRQRVCIERVRPSVDGGRFPAKRVQGETVTIQADIFTDGHD
FT                   TLAAEVLLALPGERHWQRHALQARPNDVYTTSIFLEHRGEYVFRIQAWRNVYQTWLSDV
FT                   LKKYDAGQDVAVELQAGGELVRAMSDRLNGADQAFALEQAGVMERFADSSPEDAFAAAQ
FT                   GDRLRRLLRYAGRSEEHGGLSPRFVIDVDRPRAGFSAWYEFFPRSFGEFPGAHGTLTDA
FT                   AAMLPHIAHMGFDVVYLPPVHPIGHTFRKGRNNAPEAEPGDPGSPWAIGSGSGGHKAVH
FT                   PDLGTLEDFEGFVREAERQGLEVALDLAFQCSYDHPYVREHPEWFSWLPDGSIRYAENP
FT                   PKKYQDVVPLNFDCADWENLWEELKSVVLFWCERGVRIFRVDNPHTKPLRFWDWCIAEV
FT                   RKVYPDTLFLAEAFTRPKVMYRLAKGGFNQSYTYFTWRNSKTELRDYLEDLVEGAPRDF
FT                   FRPNFWPNTPDILPEFLQHGGRPAFVLRLVLAATLSSNYGMYGPAFELCEAEAVPGREE
FT                   YAHSEKFELKAWDWNRPGHLREVITAVNRIRRANPALHSTWNVRFVDTDSDQVLAYVKT
FT                   DAEAENIILVVASLDPFQPQTSTVSLPLDDLGVSRDAPYLVHDLLGEEYFFWQGDHSRL
FT                   TLYPQSQPARIFRLHKRMRREQDFDYFM"
FT   gene            39394..42723
FT                   /locus_tag="Dret_0035"
FT   CDS_pept        39394..42723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0035"
FT                   /product="trehalose synthase"
FT                   /note="KEGG: gbm:Gbem_0136 trehalose synthase; TIGRFAM:
FT                   trehalose synthase; trehalose synthase- fused possible
FT                   maltokinase; PFAM: alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67337"
FT                   /db_xref="GOA:C8WZ62"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ62"
FT                   /inference="protein motif:TFAM:TIGR02456"
FT                   /protein_id="ACV67337.1"
FT                   /translation="MALQKMIPVTQDPQWYKDAVIYEVPVKSFCDSNGDGIGDFRGLLH
FT                   KLDYLERLGVTALWLLPFYPSPLKDDGYDIAEYFSVHKDYGQLQDFKAFLREAHQRGLK
FT                   VITELVINHTSSDHLWFKKSRQAEPGSYWRDFYVWSDTPNRYEDARIIFKDFEQSNWTW
FT                   DPVAGAYYWHRFYSHQPDLNFDNPEVQKAVFEALDFWLDMGVDGLRLDAIPYLYEREGT
FT                   NCENLPETHAFLKKLRAHVDARHRNKMLLAEANQWPEDAVAYFGDGDECHMSFHFPIMP
FT                   RIFMSLWMEDRFPLIDMIEQTPEIPAGCQWALFLRNHDELTLEMVSDEERDYMYRVYAS
FT                   DPRARINLGIRRRLAPLMHNNRRKLELLTLLLLSLPGTPVLYYGDEIGMGDNFFLGDRN
FT                   GVRTPMQWTPDRNAGFSTANPQQLYLPVIHDPEYHFQSINVENQEKNPSSLLWWMRRVI
FT                   AMRRRFRAFSRGAIDFLLPDNEKVLTFIRSYGEEHILVVVNLSRFSQSVRLDLSEYAGR
FT                   VPEELFSGNRFPEIGEDPYPLTLGFNDYFWFVLREPQSRLQTPQGPPRLEMDTDWKHLL
FT                   HGTFREYLEMEVLPRFLRQSRWFGSKAKTMRHLQVVEDVNMGHNGEKTHLLVVRVDYTE
FT                   GGMEHYLLPLSYTDRAEAESLLQEHPQAVIAYLELQDSSGVLYDGLFSASFRTVLLEMI
FT                   LGQRKKSGPGGEVHGVRGRCLKSLIKDGHHIPASRVLAAEQSNSSILYGQSVILKLYRR
FT                   LEQGTNPDAEITRHLGRLRHGPKVPGFAGLLEYRREDQEPVTLGLAQQYVPSRGDAWTF
FT                   VLSELDSFWDRVARDETRWQGPEPGWLPRAGNAAMPEELLDRVGQEFLDKIELLGRRTG
FT                   ELHRALTDSDPESPFAPEPFSKLYQRSLYQSVRYQVRKTLHSVRRHLDELPEAIRPQAE
FT                   ALLVNEHLVLERLGGLTAHRVEAQKIRIHGDYHLGQVLYTGEDFWIIDFEGEPARPLSE
FT                   RRLKRSPLRDVAGMLRSFDYAVHTSLSRQESGVTSAVGRSWTAPWYAAVCRTYLRGYLD
FT                   QVEDAAFVPRDPEDIWRLLEGFLIEKAVYEVGYEANNRPHWIWLPLGGLLRLLGKEPDV
FT                   DS"
FT   gene            42778..44685
FT                   /locus_tag="Dret_0036"
FT   CDS_pept        42778..44685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0036"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: sfu:Sfum_3451 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: alpha
FT                   amylase all-beta; glycoside hydrolase family 13 domain
FT                   protein; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67338"
FT                   /db_xref="GOA:C8WZ63"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ63"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACV67338.1"
FT                   /translation="MTRMRYDHTLLTDMDIYLFKQGRHYKLYDKLGAHPMQLDGQDGVQ
FT                   FGVWAPNATAVAVMGDFNDWQTASHPLQVRGDGSGIWEGFVPGLGQGELYKYAIIGQDG
FT                   QMFSKTDPFAFFWETAPQTASVVWDLDYRWQDETWMEQRHERNHLNAPMSVYEVHPGSW
FT                   RQRDGRFLSYRELAEELATYVQECGFTHVEFMPVMEHPFYGSWGYQTLGFFAPSSRYGT
FT                   PQDFMYLMEYLHQEGIGVILDWVPSHFPQDAHGLVYFDGTHLFEHADPKLGFHPEWKSA
FT                   IFNYARYEVQSFLISSANFWIDRYHADGLRVDGVASMLYLDYAREDGEWIPNEYGGREN
FT                   LGAIDFLRNLNSALYGEHPDIITAAEESTDWPMVTRPVHVGGLGFGLKWNMGWMHDTLD
FT                   FLANDPVYRKYHHNQLTFSIMYAFSENFILPLSHDEVVYGKGSLINKMPGDDWQKRANL
FT                   RLMLGYMYTHPGKKLLFMGGEIGQWNEWNHDTELDWWLLDNPDHQGLRRWVGDLNRVYR
FT                   DYPALSDLDFQSGGFAWIDCSDWEQSVISYLRWDASGQRPLLVVANFTPMPRANYRIGV
FT                   PFAGLWHELLNSDAPLYGGSGQGNMGGVTSVPVPAHGFYDSLTLTLPPLAVEVFTPEGA
FT                   "
FT   gene            44682..46526
FT                   /locus_tag="Dret_0037"
FT   CDS_pept        44682..46526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0037"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /note="KEGG: sfu:Sfum_2349 malto-oligosyltrehalose
FT                   trehalohydrolase; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: alpha amylase catalytic region;
FT                   glycoside hydrolase family 13 domain protein; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67339"
FT                   /db_xref="GOA:C8WZ64"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ64"
FT                   /inference="protein motif:TFAM:TIGR02402"
FT                   /protein_id="ACV67339.1"
FT                   /translation="MNVVQELGAWYAPEATRFTVWAPLRSSVELRLFDPEERRVEMAFA
FT                   AGDGCWRAEVPDVAPGTRYSFVLDGDLERPDPASFAQPDGVHGPSVVVDHFSETRSAAS
FT                   WAGPQWEESVFYELHVGTFTEQGTFEAIIGRLPSLKDLGVTCLSLMPVAHFPGQRNWGY
FT                   DGVYPFAAHTTYGGVQGLKRLADACHSLGLGIVLDVVYNHFGPEGNYLRDFGPYFTDVY
FT                   HTPWGEAVNFDGPYSDGVRKYCIENALYWLKTCDLDGLRLDAVHAIYDAAAVPFLEELT
FT                   REVDALSLDSGRQRWLIAESDRNDARFLRPSEQGGLGLHAQWNDDFHHALHALVTGERH
FT                   GYYQDFGRVEDLGQAWRQNYVYSGQYSPFRKRRHGNCAVDRAKSQFVVCSQNHDQVGNR
FT                   LRGDRLSTMVSFETLKVVAAALCLSPFQPMLFMGQEYGEKRPFPYFIDHTDPKLVQAVR
FT                   QGRKKEFQAFWRGTPLDPKAETTFTSAVLNWETQDERARQLWAWYKRLLALRRSHPVLG
FT                   PDMAVAREVRESATPACLWVHARRAETEVVLYFAFGDQPEAPAPWELPEGTWQRLEDSS
FT                   ARRWGGPGTHGPEELCHPQAPQFHARQVQLWERVARKE"
FT   gene            47020..49443
FT                   /locus_tag="Dret_0038"
FT   CDS_pept        47020..49443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0038"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   sfu:Sfum_2350 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67340"
FT                   /db_xref="GOA:C8WZ65"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ65"
FT                   /inference="protein motif:PFAM:PF03065"
FT                   /protein_id="ACV67340.1"
FT                   /translation="MSGSICIHGHFYQPPRENPWLEEVELQESAHPYHDWNDRVTDECY
FT                   APNTAARILDGKRRIIDLVNTYAHISFNFGATLLSWMERHRPEVYEAILEADRQSLQRF
FT                   GGHGSALAQVYNHMIMPLANKRDKATQVYWGLRDFERRFDRTPEGMWLPETAADTDSLD
FT                   VLAEMGIQFTILAPSQAKKVRLLDETSWEDVDGGRVDPKFPYRCHLPSGRSIVVFFYDG
FT                   PISQDVAFGGLLHNGEEFAHRLLGAFDPKEENGQLVHIATDGETYGHHHRLGDMALAYC
FT                   LHYIREYTDTEVTIYGAHLAQHPPQREAMIKEQSSWSCVHGVERWRGNCGCHSGLNPGW
FT                   QQKWRKPLRQGLDWVRDSVAPVYAAEASRIFLDPWQARDAYIERLFDKDWDATAVFLEE
FT                   QAGRILTQQERVQALKLLEMQRYAMLMYASCGWFFDEISGIETTQILMYADRVLQLAEE
FT                   TAGLDLENGFLEYLEQAPSNVLAYGHGAEVFRRLVAPAKLDLLRVGAHYAISSLFESDL
FT                   EQIRIYCYSVQCEDFQRQEAGALKLGTGRARIVAEITGESASFGFAALHLGDHNVIAGI
FT                   RQARESGDFEAMRKDLGAAFSRSDVPELVRSMDAHFEDRYTLWHLFKDPQQKVLDEIMR
FT                   ATLDEVGVNLRQIVDANYTLINFLRDMPRPLPKPLAVSAEYVLNEDLRWILEQDLPDLE
FT                   RFEELVQQMQRWEIPLARQDLRYRASWRIGALFERLREKPQDTVLLTDIERLIRLLREL
FT                   GLQVDLWKAQNVYFSLTQDWLEAMRQRVQDGEPEAKSWVAVVERLGGLLEVCAA"
FT   gene            49440..52169
FT                   /locus_tag="Dret_0039"
FT   CDS_pept        49440..52169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0039"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /note="KEGG: sfu:Sfum_2351 malto-oligosyltrehalose
FT                   synthase; TIGRFAM: malto-oligosyltrehalose synthase; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67341"
FT                   /db_xref="GOA:C8WZ66"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ66"
FT                   /inference="protein motif:TFAM:TIGR02401"
FT                   /protein_id="ACV67341.1"
FT                   /translation="MIRSTYRVQLHPERGFASLDKDLEYLRDLGIHAVYASPVFEARPG
FT                   STHGYDIFDPTRIRGELGGADGFEAVLENARDLGLAWVQDIVPNHMALDSRNPFVRDVL
FT                   AKGTESRYSGLFAINWEHPDPVFNGRLSLPVLGEPYGEALHSGRLHFEIENGHLVLAYF
FT                   EHRFPLGPKGVRAILRETLPRLERGEVATLVTRALHLLADARFDQAAQWLAEQCAAKPD
FT                   LEKALDRTCSEMAVGSRHSVIANEAYAPVWWKTAAVCLNYTRFFSINDLIRVRVEDPDV
FT                   FQTTHTLLRDLLRRNRVQGLRVDHIDGLRAPKEYLHRLQTLGAGPVWVEKILGPEERLS
FT                   QDWPIAGSTGYDFLAWTQGVLTDPAGAEAMRDDFARLNGDREPEALAFEAKEQVLYEEF
FT                   EGDLHNVAAVLRQLAAHFPAGRDMLGSRLENALAAVLAGMPIYRLYGEHETLSGQESVA
FT                   VDTAVARARDRRPELDNEIMFLESVLRWHGFTEVLPRARRLWRDFWQRFQQLASPLTAK
FT                   GIEDTLLYRYFPVAASAEVGCEPSAPARTPAAFTDWMQNRVARWPRSMNTTATHDTKRG
FT                   EDVRARLTALSEFHQEWQQMWPKWRELMEPLCETVGNVRTPDIAEQYFILQTLLGTWPL
FT                   DHDPDASYTGRLQEYMYKALREAKRHSCWTAPDTEYEATVARFVHRLLEAPEGAPLRDA
FT                   LAPFAARIGFGGMLNGLAQVVLKCTLPGIPDVYQGCEYWDLSLVDPDNRRDVDFDRRRE
FT                   SLAAVRQAVQEDPVQCWWDVCATWTDSRIKQLLLHLCLQTRNRYPDPFVQGEFVSLSVE
FT                   GEFQDHVLAFLRHYGHTWVLAAVPRLPRGVAGAQAWPVGERWGETSIVLPRVTCGEWHC
FT                   QLTGARHTTGQRLPVQQVFQELPLALWVTEREGGQCPV"
FT   gene            52417..52566
FT                   /locus_tag="Dret_0040"
FT   CDS_pept        52417..52566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67342"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67342.1"
FT                   /translation="MARYSCIQIGIAIGIESVALSAATQTVALDCPVRSVFSALKVPGR
FT                   AMTA"
FT   gene            52682..54190
FT                   /locus_tag="Dret_0041"
FT   CDS_pept        52682..54190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0041"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: pca:Pcar_0554 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67343"
FT                   /db_xref="GOA:C8WZ68"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ68"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACV67343.1"
FT                   /translation="MLTDRASGILLHITSLPGTYGVGDVGPQARRFVDFLAAAGQRYWQ
FT                   VLPVHPTQDGAGHSPYSSTSAHAGNELLISPEDLVAEGLLGESHIRPWRRQAGESQAHY
FT                   DWAQAAKRECCAVVQDRLHRRLLPAFEAEFQDFCRTQRGWLDDFALFSAAKNHFGPRRS
FT                   WRYWPEEIRLRQPRALQWMRQELALAIEREKLGQCLFFRQWRRLQARCRAKEVALMGDV
FT                   PIYVDYESADVWSHPEYFKLDATLRPPVVAGVPPDYFSATGQRWGNPVYDWRKLCQDGF
FT                   HWWVDRLEGELQLCDVLRLDHFRGFSACWEVPVEHETAENGSWVHVPGEALFALLQEHW
FT                   GRLPLVAEDLGYITDEVRHLKQRFDLPGMALLVFAFDGDPQNAFLPEHHDPNLVVYTGT
FT                   HDTNTVRGWYEEEITAEQRSQLRRHLGHAPAASHVAQDLVRLALESRARTAILPLQDVL
FT                   GLGSEARMNVPAAPEGNWIWRTSSEALHEDVAAWLAEVTAASGR"
FT   gene            54631..56523
FT                   /locus_tag="Dret_0042"
FT   CDS_pept        54631..56523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0042"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dps:DP1333 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67344"
FT                   /db_xref="GOA:C8WZ69"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ69"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACV67344.1"
FT                   /translation="MTNPAPRPTLFDAFLESYKNYKHQTAFIYRVGDEQFEVSYAKLFE
FT                   DALLLAKAFRGQGIVKGDKVFLLSDNRYAWIVTDLALMALGAVSVPRGSDTPSSELAYI
FT                   LDHSECAYLILETEGLFNQHRELIEQRALQGVFVIASEHPAEPGMLTYSQLLANRSLSL
FT                   EDLRQLMQVKRQVGGDDLVTIIYTSGTTGTPKGVKLTHANIMHNVQNLPDLIRLTSEDR
FT                   WLSILPTWHIFERTVEYVALSRGSCIVYSSIRTFAADLERFKPTLVATVPRIWESLYGK
FT                   VNAALKKESPRKARLFQFLVSVSSSFRLNSRRISGRLPRFEHEPWWRVLPRKARALACV
FT                   VALAPLYAVARAKLAPVKKKFGGRLRLAISGGGSLPPFLDEWIDAIGIRITNAYGMTEC
FT                   SPGIAGRGLDCRTFGTLGPPFPYTEVRIAGQDDIEVPTGTEGEIQVRGPQVFHGYYHNN
FT                   EANAESFTPDGFFRTGDLGKKTLNGELVITGRAKEIIVLASGENIDPTNIEATISTFPF
FT                   VQDAVLVGQDKKGLGALIVPDLEKLRQYVAEQYNHVVNEAGDVLQDKQIVESLKREMNK
FT                   LLKPKRGFKPYEKLHSIHFLNREFKLGEELTNTLKKKRHVIEQKYQDIINRLLK"
FT   gene            56925..57000
FT                   /locus_tag="Dret_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            56925..57000
FT                   /locus_tag="Dret_R0001"
FT                   /product="tRNA-Val"
FT   gene            57308..59257
FT                   /locus_tag="Dret_0043"
FT   CDS_pept        57308..59257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0043"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; Threonyl/alanyl tRNA synthetase SAD; KEGG:
FT                   dde:Dde_2639 threonyl-tRNA synthetase / Ser- tRNA(Thr)
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67345"
FT                   /db_xref="GOA:C8WZ70"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ70"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ACV67345.1"
FT                   /translation="MQVRIADNEVEVPSGQSCAEALAQAVSKKKMKQVVAGKCGETVLD
FT                   LRDPVPEGCSELEPVFAESPEGLAVIRHSTAHVMAEAVKSLFPTAKVTIGPDIEDGFYY
FT                   DFDFERSFTPEDLEAIEKEMEKSVGADMPFERREVSVDEAKKFFLHQNESYKIELLEEM
FT                   DADRVTLYTHNGFTDLCRGPHVPSTGYLSAFKLMKVAGAYWRGDENRTMLQRIYGTAWA
FT                   RPKDLKNYLQQLEEAKKRDHRKLGAQLDLFSFSEEAGPGMPLWHPKGALIRTILEDFSR
FT                   KEHLRRGYQLVQGPTLLRQELWQRSGHYDNYRENMYFTEIDDQAYGIKPMNCLAHMLIY
FT                   NTKIRSYRDLPIRYFELGTVHRHEKSGVLHGLLRVRQFTQDDAHILCRPDQLQDEISKI
FT                   VRFVQDVLGLFGFDYEVEISTRPEKSIGSDDAWDRATDALTKALDELGVEYGICAGDGA
FT                   FYGPKIDMKLKDALGRKWQCTTIQCDFTLPERFDLVYVGQDGQRHRPVMLHRAMLGAIE
FT                   RFLGVLLEHYAGALPTWLMPEQARVLNITDDHAEYAQQCVDQLRAAGIRAEADLRNEKL
FT                   GYKVREAQMEKIPYVLVVGEQEVATSGANLRLRGGKNIGVLPVDDIIDRIRHDCLEPFK
FT                   RGGMRYSFAYESTP"
FT   gene            59229..59750
FT                   /locus_tag="Dret_0044"
FT   CDS_pept        59229..59750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0044"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   Translation initiation factor 3-like; KEGG: dma:DMR_10600
FT                   translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67346"
FT                   /db_xref="GOA:C8WZ71"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ71"
FT                   /inference="protein motif:TFAM:TIGR00168"
FT                   /protein_id="ACV67346.1"
FT                   /translation="MASPTKARRNHQIRVPEVRVVNSDGEQVGVMPTNEARQMAEEQGL
FT                   DLVEVSPKARPPVCKVMDYGKYQYEQKKRTQEAKKKQTQVQLKEVKFRPKTDEHDYQTK
FT                   VRHIQRFLEKGDRCKVTIFFRGREIVHKDRGQEILDRVQRDLAEEAKVEQQARVEGRTM
FT                   SMTLAPVAKR"
FT   gene            59859..60056
FT                   /locus_tag="Dret_0045"
FT   CDS_pept        59859..60056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0045"
FT                   /product="ribosomal protein L35"
FT                   /note="TIGRFAM: ribosomal protein L35; PFAM: ribosomal
FT                   protein L35; KEGG: pca:Pcar_1420 ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67347"
FT                   /db_xref="GOA:C8WZ72"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ72"
FT                   /inference="protein motif:TFAM:TIGR00001"
FT                   /protein_id="ACV67347.1"
FT                   /translation="MPKMKTNKGAAKRFRTTGTGKIRRNRAFRRHILTKKSPKRKRQLR
FT                   TGPVVDSANTKAVKRLMPYG"
FT   gene            60097..60450
FT                   /locus_tag="Dret_0046"
FT   CDS_pept        60097..60450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0046"
FT                   /product="ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20; PFAM: ribosomal
FT                   protein L20; KEGG: dvl:Dvul_0710 50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67348"
FT                   /db_xref="GOA:C8WZ73"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ73"
FT                   /inference="protein motif:TFAM:TIGR01032"
FT                   /protein_id="ACV67348.1"
FT                   /translation="MRVKRGVTARRRHKKYLKMAKGFRGSRSRLYRTAREAVEKSLCYA
FT                   YRDRRQKKRDFRKLWIQRINAAARENGMSYSRFMSGLKKSGVELNRKVLADLAVKDKHG
FT                   FSKVAELAKEKVH"
FT   gene            60452..61504
FT                   /locus_tag="Dret_0047"
FT   CDS_pept        60452..61504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0047"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="KEGG: dvm:DvMF_0980 phenylalanyl-tRNA synthetase,
FT                   alpha subunit; TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: Phenylalanyl-tRNA synthetase, class
FT                   IIc-like; aminoacyl tRNA synthetase class II domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67349"
FT                   /db_xref="GOA:C8WZ74"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ74"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ACV67349.1"
FT                   /translation="MSLSAQDVVQRIENLVQEFRNSLDQVSVFEDLETLRVEYLGRKGK
FT                   LAQAMTSMRDLDSSERPAAGKAANKAKEELNDLLEGAKHALEQAERSNRLAQFDPTLPG
FT                   RTPWQGSLHPVTRVTRQICEIFKGLGFEVVSGPEVENDFYNFEALNIPADHPARDMQDT
FT                   LYISDSVVLRTHTSPLQVRTMQKRTPPVAAIAPGKVYRRDADLTHTPMFHQIEGFLVDR
FT                   EVSMADLRGTLTSFVHQIFSPDTRVRFRPSFFPFTEPSAEVDISCVMCGGTGRVGNSTC
FT                   RVCKETGWVEILGCGMIDPAVFQAVDYDPDQYTGFAFGLGVERVAMLKYGIGDLRLFFE
FT                   NDLRFLRQFG"
FT   gene            61966..64362
FT                   /locus_tag="Dret_0048"
FT   CDS_pept        61966..64362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0048"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: dde:Dde_2634 phenylalanyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67350"
FT                   /db_xref="GOA:C8WZ75"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ75"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ACV67350.1"
FT                   /translation="MLLSLKWLHELTPFTVSVEDLAHKLTMLGLEVEEIQNPFAELESV
FT                   VVGHVLTCEPHPDADTLSVCSVDLGGGVQPTIVCGAPNVAAGQKVAVAPVGTTLPGDFK
FT                   IKKAKIRGQRSEGMICSEKELGLGEGADGIMVLDADLEPGTSLIEALDLETTVFDIGIT
FT                   PNRADCLSVLGVAREVAAAYDLPLHIPQGDTTPYEGESSLDIDLEISDGRLCPLYQAMG
FT                   IEQITLKPSPAWMRYRLLAVGQRPINNIVDITNYVLLEQGQPLHAFDRDRLEGDRIQVA
FT                   PAEEGQTITTLDGQERALQAGELLIWDAAKPVALAGVMGGANSEMQTGSSRVLLECAVF
FT                   HPGTIRKTARRLALSSESSYRFERGVDQPGSSRAMYRAAALMAEYGAGRIVKGVASSEP
FT                   LPWEPVRLPFRPERTKRFLALDVDDSFCFQTLTGLGCVVETADPSVWQVDVPSYRLDLE
FT                   REVDLTEEIARVYGMDQIPASLPRVSKSLESDALRDTHFDFLQQLKTWASGLGLNEAVN
FT                   YSFVGANDLNCLGLPENDRLFVCNPLSAEQDTMRSALAPGLLQTLRHNLGQGNTTLRLF
FT                   EIAHTFHADPHSETTAEEIPRLALMLTGRRHEQGWPYPDEELDYTDIKGLVEHLVAWLG
FT                   QRPEFTLQEGHSYLEPCVRVSVGEQEVGIIGRVNDEVARAYRAKSDVWLAELDIPVLES
FT                   FAADHEVVFRDLPKFPPVHRDMTVIVPPGVKLQSILDTVRSAQEQLLQDMLLVDIYQPE
FT                   DSDEQKFTLRLTYRHPKKTLKDKEVDKVHTRLGEYLLSQLPVRFS"
FT   gene            64806..65099
FT                   /locus_tag="Dret_0049"
FT   CDS_pept        64806..65099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_1822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67351"
FT                   /db_xref="GOA:C8WZ76"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ76"
FT                   /inference="similar to AA sequence:KEGG:Dvul_1822"
FT                   /protein_id="ACV67351.1"
FT                   /translation="MLYILGCFLGGLAVGFAMRRQQHRLKPVGRLTDAAVCFLLFVLGA
FT                   KLGANETVMDNLGQLGWEALWLTLGAVLGSLLAVRPLERLLKGEVPESGGRT"
FT   gene            65099..65701
FT                   /locus_tag="Dret_0050"
FT   CDS_pept        65099..65701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0050"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="PFAM: protein of unknown function DUF340 membrane;
FT                   KEGG: dde:Dde_2305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67352"
FT                   /db_xref="GOA:C8WZ77"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ77"
FT                   /inference="protein motif:PFAM:PF03956"
FT                   /protein_id="ACV67352.1"
FT                   /translation="MKESGILVGVFIAGVVLGLADLLPQWILHPKMALYTLYGLLVLVG
FT                   LGIGCDTGALRAIVRLNIKTALMPVAVAVGSILGAGLVALVLFGVNFREGMAVGAGFGY
FT                   YSLSSVLISQIHGEQLGTVALLSNIMREVLTILLAPFLVRWWGSLAPIASGGATTMDTT
FT                   LPIIHKATSKHYAMIAVINGIVLSLLVPVLVPALLWG"
FT   gene            complement(66118..66459)
FT                   /locus_tag="Dret_0051"
FT   CDS_pept        complement(66118..66459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0051"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: dma:DMR_10720 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67353"
FT                   /db_xref="GOA:C8WZ78"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ78"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV67353.1"
FT                   /translation="MAYEGAMKKGGEKRYKIGQAAKLLELESYVLRFWESEFPQLDPIR
FT                   TPTGQRLYTERHLQLLRRIKFLLYEEGMTIDGARRRLEDTDRYTNVLEEVTAELQDLRD
FT                   YLANGPAGR"
FT   gene            complement(66804..67232)
FT                   /locus_tag="Dret_0052"
FT   CDS_pept        complement(66804..67232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67354"
FT                   /db_xref="GOA:C8WZ79"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ79"
FT                   /inference="similar to AA sequence:KEGG:DvMF_0531"
FT                   /protein_id="ACV67354.1"
FT                   /translation="MLFFHPLLQFGVILLALFVLWLGWHRFQSLHLHRRGVVFRRRRHV
FT                   LLGRLTLLLMLAGLFGGLSMAWLTWSSVFITGWHARVAMVIAVLAVTGYATGSHMERVK
FT                   KRRTWLPLLHGITNAVLVLLALFQIYTGWRVLSMYGII"
FT   gene            67565..68833
FT                   /locus_tag="Dret_0053"
FT   CDS_pept        67565..68833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0053"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: dvl:Dvul_0331 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67355"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ80"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67355.1"
FT                   /translation="MSEEYATDDRIRELEAELAAAKKRLAALEKRQESDAPPAMLQDVL
FT                   DGIDMDIHITDSHEGTILMANARMYTTYSGTIVGRHCWDVIRNANSPCPGCMVEQLDDP
FT                   KVPSVRWEDYNLAAGGWFEHIARRITWQDGRPAVLHISRNTTEAHETARAYRRSERKYR
FT                   RMNRLLRLMADNVPDLIWAKDLDDQYLFANKAICKQLLRCSDPELPLGKTDLYFAERER
FT                   RWGHDHTFGEICIDSDQVVKANRKSGRFLEDGKVRGRYLVLDVHKAPFFDEDGAMIGTV
FT                   GAAREVTEEIQRQQELDDIQSKYRLILENCNDGIGVNGPDGFFRWVNPSLCRICGFSEQ
FT                   ELLKHRTTTFVDPRDQNWVWDYFRQRLDPEQPDPEQVYPFRIVRKDGVVRWLQASVVKI
FT                   EWNDRPAALVFYTDITGRYPHLD"
FT   gene            69042..70058
FT                   /locus_tag="Dret_0054"
FT   CDS_pept        69042..70058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67356"
FT                   /db_xref="GOA:C8WZ81"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ81"
FT                   /inference="similar to AA sequence:KEGG:Dde_0097"
FT                   /protein_id="ACV67356.1"
FT                   /translation="MDFSDTSRVHLRHGVKTGLAATLAYLATLVLGLKFGYWAVLSTVI
FT                   VMQMNVADSIRMCRYRFFGTALGAVLGIGAILVFPVQPFWTAMAVFITTGFCAYMTRYD
FT                   VRYRMAAITVCIVVLASIGEPNRVVFSLYRVLEIGIGVFCAFAVTVLVWPRRAGQDLRR
FT                   RLNAQFEVAAREVQLLTHTFVSGGSLPGTNRIEALESEAAELRELLDKVMRHERRLYNE
FT                   DTARLNRNVSTLSRCAENLRSMHTILRAEPGAPPDIMQDELRELAAAAGAVVEARHNVP
FT                   PEDLRRLERAIAAAEQQMHLLRGQGATRTYYLEEVLRFFSFYYALMRFGKDGLDCRH"
FT   gene            complement(70510..71709)
FT                   /locus_tag="Dret_0055"
FT   CDS_pept        complement(70510..71709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0055"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; KEGG: dat:HRM2_13280
FT                   SulP1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67357"
FT                   /db_xref="GOA:C8WZ82"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ82"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACV67357.1"
FT                   /translation="MSLPLRFNRMEVAGSLGDLGTLLPIAMAMILINGLPALGVFFCIG
FT                   LFYILAGLFYGVTVPVQPMKVIGAYAIATALTPEQIAASALLLGIILLLVGWTGIIDLI
FT                   RRITPKSVIRGIQLSTGTLLLSSGIRFMLGTTQFQNVQQAAEPALALQHFGPLPIGVVF
FT                   GVLGGLVTLFLINNRRWPGGLAVLVLGTGCGLLFGAGSGLGDVDPGLYLPSLLPFGLPG
FT                   GADLSFALLALVLPQLPMTLGNACLAYTDLAEHYFEKQAQRVTNKNACFSMGLANLTAF
FT                   ILGGMPMCHGAGGLAAHYRFGARTAGSNLIIGTLFLGLALVFGPHSVALLQLLPLAILG
FT                   VLLVFAGAQLALTILDLETRKELFVAVLIMGITLAANLAVGFVVGVGVAWVLKSERFGI
FT                   "
FT   gene            complement(73677..74741)
FT                   /locus_tag="Dret_0056"
FT   CDS_pept        complement(73677..74741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0056"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: oan:Oant_4496 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67358"
FT                   /db_xref="GOA:C8WZ83"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ83"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV67358.1"
FT                   /translation="MKCHLANHTIGVDLGDKQNVVCVLDWNGDIATTFKVTNTKTAMRK
FT                   RFAAYSGAFVAIEAGTHSAWISRLLKELGCAVVVGNPRKLRCIWQEPIKTDFRDAEMLA
FT                   RVAKMDPKLLRPIEHRSADAQARLAILQARDALVKSRTSLINHVRGTVKCAGERLPKCS
FT                   AASFHKKAPEHIPSELKAALLPLIEQIANFTEGIKKYEHEVTHLSRTHYPETEVLRQVP
FT                   GVGPITALAFVLTLEDKDRFTKSRDVGPFLGLVPKRDQSGDTDKQLRITKCGNSQLRTL
FT                   LVNVAHYVLGPFGADSELRRFGQRIAARGGTIAKKRAVVAVARKLAVLLHRLWVTGEEY
FT                   HPFYCHKDSTVEAA"
FT   gene            complement(74991..76643)
FT                   /locus_tag="Dret_0057"
FT   CDS_pept        complement(74991..76643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0057"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rpb:RPB_2521 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; SMART: GGDEF
FT                   domain containing protein; PAC repeat- containing protein;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67359"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ84"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV67359.1"
FT                   /translation="MTQLIDVHSELLPVFLEQIEDAIAIVNTEHIYIFANAAYCRLRRT
FT                   DPATIIGKHVREIVGEDFYQLLVREKLEEVLQGAQVQYESPVTSDAGHTSHLAVSYFPL
FT                   PDATAPAYVAAVLRDISAPKEQEEVLRFLVENINEVFWLRDLNQDRVIYVSPSISSVFG
FT                   ITPEDMYSDSRAFMRMIDERDLARVQRAFQAVRNERIDFNEEYRIVHPEKGVRWIHART
FT                   YRFESDHKKLFVGTAEDITERKVQEEHVLKSKQHVEALYRGIPLPIFTWERRNDDFMLS
FT                   SFNTAAVEMTQGKAKHLKGRWLSEVYRDQNPQVIEDIHRCFESRSNLRRQMSYTLVSTG
FT                   EEKYIEASYVYVPDRHVMAMVNDITHQQQYQEHLKRLSRTDELTGLFNRRHFITLMHKE
FT                   FSRARRTHERLTLAMLDIDHFKDVNDKYGHDVGDHVLQHLGRILREDVRPYDIAARYGG
FT                   EEFAICFPDTDLSQADHICERLRTLCAASEVSRNGGTIGFTVSFGLSELRPEHEDLDGL
FT                   LKSADNALYAAKANGRNRIEHDVVYCDQQTGCS"
FT   gene            complement(77169..77591)
FT                   /locus_tag="Dret_0058"
FT   CDS_pept        complement(77169..77591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0058"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: pca:Pcar_1342 putative
FT                   acetoin utilization protein AcuB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67360"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ85"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACV67360.1"
FT                   /translation="MRIIDIMTKGVCTVQMDDFVRYVKSLFEEHEFHHLLVVDGGMLQG
FT                   VISDRDLLKNLSPFYDTPCEQNRDLAILNKRAHQIMSRNPVTVTAETSVKDAFELLIEK
FT                   RISCLPVVTESGRVAGIVTWKDLIRAAFREVDASCW"
FT   gene            77997..79796
FT                   /locus_tag="Dret_0059"
FT   CDS_pept        77997..79796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0059"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   sat:SYN_00659 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67361"
FT                   /db_xref="GOA:C8WZ86"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:5ERE"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ86"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACV67361.1"
FT                   /translation="MKNWGLVCFVAIVQLMIGVGSLCAQTAEAQDKPVVGVILPFSSAF
FT                   EDIAVEQQRAVELALAESGSAFEIVFKDGGADVDTAVQAFQDLVRSQENLAAVVSCSSW
FT                   ASSAIHPLAAEKDIFHVAIGSAALKRTEPGHTIRLTVGVQQEQEQLAAYLTDFERIAVL
FT                   AMDNNLGSSWIRMLEDRFPKQVVAAQEYNPQQMDIAAQLATIKARDSEALVLISAGEAA
FT                   TIAKQARQAGIKAQLVGTRPIQRAEVLAASAFTNGLVYTYPSYNQDHPFMSAFTDRYGL
FT                   EPGFFGVEAYDLCTTLSRALEQGRQTPKALFEWYAGNTFTGALGKVTFANDGDASYPYI
FT                   FKKVTESGFRVAEFQFPMLLTQTAQELNAIFKDMDRSVAAAAEQLSTTGLRGDRASAIL
FT                   ETLFNENQYAYNCVTVDATGTIVNVAPKQYSSVIGEDISGQEQIIRLHETHQPVLSQAI
FT                   KMVEGFVGIDLEHPVFDQDGGFIGSVSVLTQPDFFGSIISRKVHNFPVEIFVLQRDGTT
FT                   IYDVNAEEIGKNAFADPIYDAFPSLKRIARKMVSQAEGEGTYRFQDRHMEHAVAKQLLW
FT                   TSIGLHGTNYRLALTYGAGEIED"
FT   sig_peptide     77997..78086
FT                   /locus_tag="Dret_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.392 at
FT                   residue 30"
FT   gene            complement(80245..80320)
FT                   /locus_tag="Dret_R0002"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(80245..80320)
FT                   /locus_tag="Dret_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(80362..81225)
FT                   /locus_tag="Dret_0060"
FT   CDS_pept        complement(80362..81225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0060"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dal:Dalk_1100 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67362"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ87"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV67362.1"
FT                   /translation="MRITCWGARGSFPVSAPDTVRYGGQTTCFALQSHPGHDELLIVDA
FT                   GTGIYPLGRQLQKNGPRRIHLILSHLHQDHVCGFPFFAPLFDRRFEIRVSAPFVSPKEV
FT                   SNALHALLHPPLSPVTWANVAARLQICPAPGPEDRLAGLTVTAIPLAHPGKAAGLCCTS
FT                   AQGRRVVVVPDNELAAMTAEQRLALHTACSSADLLIHDAHFLDAELDGARGWGHSSPLE
FT                   AARLGLETRVQQVGLTHHHPDRNDDSIEAIEKQTRDWLSGFPDSPECTALAAGWSLNLP
FT                   EAEKKY"
FT   gene            81586..82419
FT                   /locus_tag="Dret_0061"
FT   CDS_pept        81586..82419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0061"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; Rubrerythrin; SMART:
FT                   Rhodanese domain protein; KEGG: dat:HRM2_46820
FT                   rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67363"
FT                   /db_xref="GOA:C8WZ88"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ88"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACV67363.1"
FT                   /translation="MRWKQFLTPIHSVDAETARSSLQAPGVDAEIIDVRQPKEYDQGHI
FT                   PGAKLIPLPQLQDRLQEIDADKPVYVYCAVGGRSRVAAQMLSSQGFAEVMNMKGGFKAW
FT                   NGHQAIGAEELGLELFDGLESFAELLKTAYGMEAGLREFYTSIASRVDDGDVRELFETL
FT                   ARIEEKHTRRVFQAYLQKVDDQVDESTFSEQIVPQALEGGQTSQDYIDRFAPDWNKPEE
FT                   VMELAMGIEAQAMDLYTRAAQRESGDAREFLEQMALEEKGHLQQLGQMLDRMLGA"
FT   gene            82462..82578
FT                   /locus_tag="Dret_0062"
FT   CDS_pept        82462..82578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67364"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67364.1"
FT                   /translation="MERGFIAIEIGIGIEIDLCPRRHANLREVFRKIEKLKN"
FT   gene            82604..82747
FT                   /locus_tag="Dret_0063"
FT   CDS_pept        82604..82747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67365"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67365.1"
FT                   /translation="MTVDGGQSGGDYGSHGMKSQAGVWRSEEQEMPHARAGTPSSRKGA
FT                   KG"
FT   gene            82862..83926
FT                   /locus_tag="Dret_0064"
FT   CDS_pept        82862..83926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0064"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: oan:Oant_4496 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67366"
FT                   /db_xref="GOA:C8WZ83"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ83"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV67366.1"
FT                   /translation="MKCHLANHTIGVDLGDKQNVVCVLDWNGDIATTFKVTNTKTAMRK
FT                   RFAAYSGAFVAIEAGTHSAWISRLLKELGCAVVVGNPRKLRCIWQEPIKTDFRDAEMLA
FT                   RVAKMDPKLLRPIEHRSADAQARLAILQARDALVKSRTSLINHVRGTVKCAGERLPKCS
FT                   AASFHKKAPEHIPSELKAALLPLIEQIANFTEGIKKYEHEVTHLSRTHYPETEVLRQVP
FT                   GVGPITALAFVLTLEDKDRFTKSRDVGPFLGLVPKRDQSGDTDKQLRITKCGNSQLRTL
FT                   LVNVAHYVLGPFGADSELRRFGQRIAARGGTIAKKRAVVAVARKLAVLLHRLWVTGEEY
FT                   HPFYCHKDSTVEAA"
FT   gene            84795..85904
FT                   /locus_tag="Dret_0065"
FT   CDS_pept        84795..85904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0065"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="TIGRFAM: pyridine nucleotide-disulfide
FT                   oxidoreductase family protein; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: dde:Dde_2562
FT                   pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67367"
FT                   /db_xref="GOA:C8WZ92"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ92"
FT                   /inference="protein motif:TFAM:TIGR03169"
FT                   /protein_id="ACV67367.1"
FT                   /translation="MARLVLLGGGHAHMTVMASLNEFLDRGHEVRVVGPEPYHYYSGMG
FT                   PGMLGGHYTPEEIRFDIRRMVESKGASFVEDKAERIDAASRVVHLASGQHLEYDVLSCN
FT                   TGSVVDQRLAAPDATNVYTVKPIANLLAAQKRIKDLASSKSELRIGVVGGGPAALEVAG
FT                   NALSWAHRVNASSPKVTVFGGKEFLRRHPGKVRQFAIMSLEQRGIELVQGSYVDKVTGS
FT                   RIVLEDGSSADVDLVFLAQGVRPSPLFRASDVAVGPNGGLAVNEYLQSTEEPSIFGGGD
FT                   CIHFEPEPLDKVGVYAVRENPILKANLMAQLEGKELTPFDPGDGYLLIFNLGDGTGIFW
FT                   RKKTIFHGRPAFWLKDFIDRRFMKRFQKA"
FT   gene            complement(86168..86707)
FT                   /locus_tag="Dret_0066"
FT   CDS_pept        complement(86168..86707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0066"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; Rubrerythrin;
FT                   KEGG: dvm:DvMF_1981 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67368"
FT                   /db_xref="GOA:C8WZ93"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ93"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACV67368.1"
FT                   /translation="MAAQSREERRAKVIEVLNTAREMELHAIYQYMNQHYGLDDMDYGE
FT                   LAKNIKLVAIDEMRHAEMFAERIKELGGEPVAASSQKVQRGQEVGTIFTHDSKLEDDTI
FT                   DTYNQFLQVCRDNGDSITAKLFEQIIDEEQEHLNYFDDVGDHIKELGSTYLARIAGTPA
FT                   STGGYTRGFTAEGGGE"
FT   gene            complement(86664..87353)
FT                   /locus_tag="Dret_0067"
FT   CDS_pept        complement(86664..87353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67369"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67369.1"
FT                   /translation="MQIRVPSRTNALAFASSNSPIPQSFNSQIFLAPSRLRDLRASPPG
FT                   REASLVLRTARRWPGSSFRSRRRLPSSVHRPLSSAASNSSMPQFFNPSIFLHTSRIFAS
FT                   LRGPKSISIPIPISIAMNQRSVICPPSIDFILPLPRPLTGHHFVPTMPNTEAKVLCASV
FT                   PAKIRIPDREPSQHLDTLLVDGRHLSGSFWFHREILPKEKAFTPHQTRQEVEHGCTVPR
FT                   RTSRKGD"
FT   gene            complement(87655..89748)
FT                   /locus_tag="Dret_0068"
FT   CDS_pept        complement(87655..89748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0068"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP-cone domain protein; KEGG:
FT                   dvl:Dvul_2681 anaerobic ribonucleoside triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67370"
FT                   /db_xref="GOA:C8WZ95"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ95"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACV67370.1"
FT                   /translation="MLLEDRPVPRSSTTNPPKYIRKRDGRLETWALDRIGEAILKALKA
FT                   SGVKDPLLANRLARKVEQKLEGIETPEQEQVQDMVELVLMESRLYQVARRYIVYREKRR
FT                   QLRSQQEAFLDIRETIDSYVNKEDWRVAENANMAHSFQGLMLHLSGSVQARYSLEKYPE
FT                   EVRMAHEHGYFHIHDLSFGLAGYCAGWSLRDLLLEGFNLEGRCSSGPAKHLNSALGQMV
FT                   NFLGTLQNEWAGAQAFNNVDTYLAPFVRFDGMDYVRVKQAIQKFVFNLNTTSRWGGQSP
FT                   FTNLTFDLVPPKHIASEAVIYGGELLDVTYGDFAPEMEMINKAFLEVMLEGDYHGRIFS
FT                   FPIPTYNITKDFPWDGEVGQLLLRLTAKYGVPYFQNFINSDLKPEDVRSMCCRLQMDLR
FT                   ELKRRTGGLFGAGDLTGSIGVVTLNLPKLGYLAQGEEDFLDLIEEYAEMAKNSLEFKRK
FT                   WVSDNMDRGMYPFSQRYLKNGLSGHFSTIGLIGGHEACLNLLGKGIDSTAGVRLMNRVL
FT                   EHLRDLTSRYQEETGHLYNLEATPAEGTSYRLAKIDKQLYQDIVASGEDVPYYTNSTAL
FT                   PVDATTDVFAALEHQNQLQPLYTGGTVFHTFLGEAVADTEALKSYMIKAMSQTKLPYIS
FT                   ITPTFSICKEHGYINGEHFECPHCGQDAEVYTRVVGYYRPVKMWNRGKREEYKQRSEYA
FT                   PVD"
FT   gene            complement(89885..90511)
FT                   /locus_tag="Dret_0069"
FT   CDS_pept        complement(89885..90511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0069"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: dde:Dde_0278 radical SAM domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67371"
FT                   /db_xref="GOA:C8WZ96"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ96"
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /protein_id="ACV67371.1"
FT                   /translation="MNDPHTPWNHIRGMQPQSFCDWPGHVSAVLFTGGCNLHCPTCHNA
FT                   GLAWHPEEHPLVGRETVLTHLQSHRNWLDGVVITGGEPTLVPGLDQLCRDCLDCGLPCK
FT                   LDTNGMRPDVVAELLEQDLLSLVAVDVKGPWSKYPELTGKACTPEQAQSCLEQIFALSK
FT                   RYPGRFAFRCTKVPPLSEDDLAATKTLIPTGMELTFQDYIPPRPH"
FT   gene            91055..91342
FT                   /locus_tag="Dret_0070"
FT   CDS_pept        91055..91342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0070"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="PFAM: cysteine-rich small domain; KEGG:
FT                   dma:DMR_05450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67372"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ97"
FT                   /inference="protein motif:PFAM:PF04071"
FT                   /protein_id="ACV67372.1"
FT                   /translation="MRDVLCPLGTHDFNQNRQCQYFPCHPGADPETFNCKHCYCPLYFI
FT                   YWTDCGGTFRILGNGVKDCSACLLPHEPGGHEYILEKLREYFALVKPAEG"
FT   gene            92311..92799
FT                   /locus_tag="Dret_0071"
FT   CDS_pept        92311..92799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0071"
FT                   /product="DctQ (C4-dicarboxylate permease, small subunit)"
FT                   /note="KEGG: dps:DP0488 DctQ (C4-dicarboxylate permease,
FT                   small subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67373"
FT                   /db_xref="GOA:C8WZ98"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ98"
FT                   /inference="similar to AA sequence:KEGG:DP0488"
FT                   /protein_id="ACV67373.1"
FT                   /translation="MERFYKYALTLLITTVAVLMFIQVMMRYVLQAPLMGLEEVLVYPT
FT                   LWLYLLGSVNASREDTQIKANVLDVFMKTPRSRMIVRILADVFGVIISTWLTYWAFLYF
FT                   KYALRVWKESPTLYIPTFYAECALFIGLLLMTIYAAYHLMRSVRLFVTAPSKGGFDRD"
FT   sig_peptide     92311..92406
FT                   /locus_tag="Dret_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.665 at
FT                   residue 32"
FT   gene            92792..94090
FT                   /locus_tag="Dret_0072"
FT   CDS_pept        92792..94090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0072"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: dps:DP0487 DctM
FT                   (C4-dicarboxylate permease, large subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67374"
FT                   /db_xref="GOA:C8WZ99"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZ99"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACV67374.1"
FT                   /translation="MIEISMFALGTLVVLLSFGVPLPYCFGGALMVMHLFGGATMRGTM
FT                   LWGFSQLANPVLLCIPLFVFAGAIMSESGIASSLLKFVNFFVGRIRGGLGVVASVSCAI
FT                   IGAISGSGLTGIAATGPLLIPEMAERGYPRGYATALVANSSILGLLIPPSVTMIIYGWV
FT                   TDTSILACFLATVGPGLLITFLFALVNMYLSRNFPLILEEKKTWPEKTREGVTLTSRAL
FT                   PALIMPAIILGGIYGGIMTPTEAAAVAVVYAIPVGVLVYKGLTFNTFLRAAKDSATSVG
FT                   AIMIMIIFSLMLSQIFVMEQVPQALVEGIFNITDNKVLLLVLVNFLLFFIGMIVNDVTA
FT                   IILTAPLLLPLMNAIGVSPIQFAAIMGVNTAMGGVTPPYASILYLGMRIGNVEFSEVFK
FT                   PAMTLIIFGYVPVVFLTSFWPELSLFLPSLLGY"
FT   sig_peptide     92792..92851
FT                   /locus_tag="Dret_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.563 at
FT                   residue 20"
FT   gene            94117..95109
FT                   /locus_tag="Dret_0073"
FT   CDS_pept        94117..95109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0073"
FT                   /product="Extracellular solute-binding protein"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: dps:DP0483 DctP (periplasmic
FT                   C4-dicarboxylate binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67375"
FT                   /db_xref="GOA:C8WZA0"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA0"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ACV67375.1"
FT                   /translation="MKKALWTVFIVGLALSLCTAAQARTWKVSHVRPQDTAIDKDLNAF
FT                   VQDVDEATNGKINIKVYAASSLGDYTVVQERVGLGAVEMACQPPATGADKRFQIQYFPY
FT                   LVKNYDQAKKNFGPDGPLRKEIGKLYGEQGIELLAAWPVYFGGIALKEEPKNPGDPTAK
FT                   KGLKVRVPPMKTFQMLANNIGYMATPLPFSEAFTAVQTGVVDGVIGSGAEGYYASFRDV
FT                   TNYYVPMNTHFEVWYLIANERMVEGLDKDEMAGLKAAAQRFEENRWDQVVEDQKKNEQR
FT                   LADYGAEIIEITPEDLTKTAEIVRENVWPEILSDVGTEWGQSVLDNIKE"
FT   sig_peptide     94117..94188
FT                   /locus_tag="Dret_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 24"
FT   gene            complement(95582..97477)
FT                   /locus_tag="Dret_0074"
FT   CDS_pept        complement(95582..97477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0074"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: dps:DP0482 sigma54-dependent
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67376"
FT                   /db_xref="GOA:C8WZA1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA1"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV67376.1"
FT                   /translation="MECTAILDSTILRQEIQASHARSKEYGVSRTTRKNQVKLTPLELS
FT                   QRQAQNKIFLEAVIAQLSELFDLLSPDDFMVAVVDGEGYILHMFGSDNIKAKFAERNCA
FT                   PGYRWTERDVGTTAISLCLERRIAVQLNDKDHYCQRAHGFTSSAAPVFGHAGNLQGILV
FT                   VSGNSQLVHPHTLCMISSAARSVERQLRILRRNSELAMHIGLLDAVLESTTSGLMVIDS
FT                   QGVIWRVNRKGGQILKKTDLAGQEVSVLQGLDLDIEDIRANPNAWVNRECTLKNGRQNI
FT                   HILFSAQPVLAGDQSMLGVVLEFEPIDSVRKLANNIAGTKAFFTFESMIGSSESFRRAQ
FT                   EMAKRAAHSDSTVLLRGETGTGKELFAQAIHNASRRRSAPFVPINCGAIPGELLESELF
FT                   GYVDGAFTGAQKGGRPGKFELAHRGTILLDEIGDMPHDMQVKLLRVLQTGEVYRIGARK
FT                   PTLVDTRIIACTHVDLGKAVAAGRFREDLYYRLNVLPIVIPALRERGRDDILALTEFFL
FT                   SRNRVTPPQLTVGAVKALENHPWPGNVRELENTIQRALHLCEENEIDAACLGVPETAAA
FT                   ASSSTPRGTLEEIERLAIEQTLEDTKGNMAETAKTLGISRATLYRKVKRYSLETG"
FT   gene            97749..98843
FT                   /locus_tag="Dret_0075"
FT   CDS_pept        97749..98843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0075"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase"
FT                   /note="PFAM: NAD/NADP octopine/nopaline dehydrogenase; NAD-
FT                   dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: glo:Glov_2392 NAD/NADP octopine/nopaline
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67377"
FT                   /db_xref="GOA:C8WZA2"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA2"
FT                   /inference="protein motif:PFAM:PF02317"
FT                   /protein_id="ACV67377.1"
FT                   /translation="MSRETVWAIVGGGNGGQSLAGHLSLMGYPVRLYDIFTETVDAINA
FT                   QGGIEVSGVVEGFGKPELVTTDLGAAVKGADAVMIVAPAVAHKTIAKQCAPYVSAGQTY
FT                   ILHPGATCGALEFRHTLDECNCTPDLAVAETNSLIYACRAPKPGHAVIHGIKDDLVLST
FT                   LPAAKNEHVLGVLQEAFPQIVGGANVMQSSLGNANAIMHPAPTLLNTSLIESRHDWYYY
FT                   REGITPSIGAFVEELDKERVNLAQAFGLDMITIREWYRVAYGVEAETLSEAVKKNPAYA
FT                   EIRGQKELRTRYLLEDIPTGLVPMIEMGKLMGVDTPRMELVARFGSSLLEEDFFAKGRT
FT                   LKNLGLAGMGKDDFLQYLQTGVKA"
FT   gene            complement(99320..102208)
FT                   /locus_tag="Dret_0076"
FT   CDS_pept        complement(99320..102208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0076"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; Protein
FT                   of unknown function DUF1998; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   dma:DMR_45970 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67378"
FT                   /db_xref="GOA:C8WZA3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA3"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACV67378.1"
FT                   /translation="MSSSAQVDAYLRALKDSGPYGSLVRHHATLPARAPSYSTPREPWP
FT                   APVQELCRQAGIDRLFSHQAEAVDHIRAGRHTAIATPTASGKSLTFALPIAEALCQDPE
FT                   SRALLLYPLKALAQDQLRALQAFTQPWPLEQQPRAAIYDGDTPQAERGRIRANPPHLLC
FT                   TNPDMLHLGLTPHHHSWGEFFSRLRFVIVDEVHTYRGVMGSHMAWVFRRLRRICRYWGS
FT                   DPTFIFASATIGNPAQLAQNLAGVPVEAVTENGAAQGKRHMVFLDALEGAPQTALGLLQ
FT                   AALARGLRTIVYTQSRKYTELLAMWLSQRSPRFADRVSAYRSGFLPEERREIETALANG
FT                   SLLGVISTSALELGIDIGNLDLCLLVGYPGSVMATWQRSGRVGRGRQDSATILLGGEDA
FT                   LDQYFMHHPQAFFALPPEAAVINPDNPVIRDRHLVCAAADLPLQHTEPLVTDPVHRRAV
FT                   HRLEQRGELLQSGSGEEWLSHRKTPHRQVSLRGTGRTLPILDSDSREHIGSVDGYRALR
FT                   ETHPGAVYLHRGQTYVVDRLDLEEGMVLARKQTVQYFTRVRAHKETTILETTEWAHVWG
FT                   SRIHRGRLRVTETVTGYEKRHVRGQRLLRMHELDLPPHVFETEGIWLEIPDTVRQELEK
FT                   RYLHFMGGIHAVEHALIGIMPLLVLADRNDLGGISTVGHEQLTTAAVFVYDGTPGGAGL
FT                   TRQAFQRAGELLEHTQRTIRDCPCETGCPGCVHSPKCGSGNRPIAKDAALAVLQTLHTS
FT                   QTPRSEPVIVQPAEEPDMTVTTDIPDNAGLPPLHYTVFDLETQRSAQEVGGWNRAKDMG
FT                   ISCAVVYDSALDTYVEYEEKDIPQLVEHLHKCDLVIGFNILRFDYQVLSGYSRADFQAL
FT                   PSLDLLRVVHKQLGYRLSLDKLAQATLQAQKTANGLQALQWWKEGRIRDIIDYCRQDVA
FT                   VTRDLYRFGRDNGYLLFHNKAKQLVRVPVQWE"
FT   gene            complement(102208..103581)
FT                   /locus_tag="Dret_0077"
FT   CDS_pept        complement(102208..103581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0077"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: dma:DMR_45950 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67379"
FT                   /db_xref="GOA:C8WZA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA4"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV67379.1"
FT                   /translation="MATHILIIDDEKNYLLLLETMLAEEGYAVTTQQDPQLALDYLGES
FT                   EVDVVITDMKMPHVSGQKVLEEVKKHSPHIPVLIMTAFGSIDGAVEAMKCGAFDYITKP
FT                   FSNDELLLSVSKAGKLAQAERENRLLRQSLEDRFGVHQIIGRSKAIRDVLDMIGRVAAS
FT                   RSTVLLTGESGTGKELVARAVHFASDRAGGPFVPVNCMALNPGVLESELFGHEKGSFSG
FT                   AVARRRGRFEMAHTGTLFLDEIGELSQETQVKLLRVLQERTFERVGGTTPVQVDIRLIA
FT                   ATNKDLAAAVSAGTFREDLYYRLNVVQIPLPALRERREDIPLLAAHFLKRYAEENNAEV
FT                   TEFASDAIDYLTAFEWPGNVRQLENVVERCVVLARSSQISVNDLPPEVKDEESQFKSAV
FT                   DLLPSKLNLGESLEKIEAALIRRALAKTNFIQVKAAEMLGISKSLLQYKLKKYNISGK"
FT   gene            complement(103606..105033)
FT                   /locus_tag="Dret_0078"
FT   CDS_pept        complement(103606..105033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0078"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: dvm:DvMF_2201 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67380"
FT                   /db_xref="GOA:C8WZA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV67380.1"
FT                   /translation="MRTPLRPNPAHPFQLVKFLSWSSLFIILGSIFFLALTIGNSAKQA
FT                   VMQKHRDFALLLAENLNHQIYQRFTLPTVLGFGRIQLKNEAQYQRLEETIQSTIHSFHV
FT                   LDVRIYDWEGMVVYSTDKTLVGKAGLAGPEVKKAVDTGEPSFTVQGELSFWRAMFDFDL
FT                   PAKTFVLRTTYPLRAERTLQPSQKAGPIMGILEFRQDISKDYETILRFQWVVVFLALGA
FT                   SLILFLLLYIIIKRADRLLAERIQEKERLERELLQNEKLASMGRMVASIAHEIRNPLGI
FT                   IRSSSEMLYKKALRDNSQNARLLHAVFQESKRLSQTVHEFLDYARPKQPAMREVDCSQI
FT                   LQRALAFLEQECAAHEIQVTTALPETLPSQGDDDLLYRAFYNIISNALQSMDGGGELDI
FT                   SGGREEDQIWICIRDTGPGFDATMLDKYLEPFYTTKDQGTGLGLAIVKNIVDSHGGSLN
FT                   ITNTETGAEVCIRLQAG"
FT   sig_peptide     complement(104899..105033)
FT                   /locus_tag="Dret_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.632) with cleavage site probability 0.195 at
FT                   residue 45"
FT   gene            complement(105309..106487)
FT                   /locus_tag="Dret_0079"
FT   CDS_pept        complement(105309..106487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0079"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dvm:DvMF_2204 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67381"
FT                   /db_xref="GOA:C8WZA6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV67381.1"
FT                   /translation="MRIATRLSQIKPSPTLGLNAQIQEMKAEGRSVVSLAVGEPDFPTP
FT                   AHVCQAAKAAVDEGFTGYTAVPGMPSLRQAVAGYYQTQYQVQAQADNTIVSNGGKQVLY
FT                   NLLQALVEPGDEVLLPVPYWVSYPPLVALAGGIVQEVPSTAADDFLVTADQLEACRTPQ
FT                   SRFLILNTPSNPTGSHYSQQQLDALIEWALSHDIFVICDEIYDQLIYPPAGPATASRWW
FT                   QQAPDKIAVVNGLSKSFAMTGWRIGFGLAHADLIKAMTKLQGQSTSNICSIAQRAAEAA
FT                   LTGTWDQVRTMRDSFAKRRDLALEYIAAWPGTTCPRPAGAFYLFPHLGDCLEGSAIPDS
FT                   AALASHILEQTGIAVVPGSAFGDDACLRLSYAVDETTLTDALERIGKVLQQL"
FT   gene            106922..107356
FT                   /locus_tag="Dret_0080"
FT   CDS_pept        106922..107356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0080"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_2277 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67382"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67382.1"
FT                   /translation="MKILRALRMERCIGCYSCSLACARLVHGSLSWKRSGIRIHSAGGL
FT                   STGFEAQVCLACDPAPCAEACPTGAMRQRKGGGVVYTKSLCIQCGDCARACPVDAIYMD
FT                   PETNAPVVCIHCGRCVEFCPHDCLEMVTVPSASKEDPHAY"
FT   sig_peptide     106922..107008
FT                   /locus_tag="Dret_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.655 at
FT                   residue 29"
FT   gene            107346..109112
FT                   /locus_tag="Dret_0081"
FT   CDS_pept        107346..109112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0081"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: dvl:Dvul_2276 aldehyde ferredoxin
FT                   oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase;
FT                   SMART: Aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67383"
FT                   /db_xref="GOA:C8WZA8"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA8"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ACV67383.1"
FT                   /translation="MRTSAKILHVDLSSGESDIQEISGREMWLGGCGLAACLFERFGDP
FT                   AQPPSAPAQPLIFAIGPLTGYFPLQSKVVAGFVSPYTGQYAESHAGGRLGLALRFSGFE
FT                   ALVVTGRASTPSCLIVGSRQLQIKDVHYLWGHDVFSTGKLLRQIHSQHSGHRSILRIGP
FT                   AGEQGVAYAAINVDTYRHFGRLGAGAVMGGKHLKGIIVAGDASLDLPKERRKSYNETYT
FT                   QVHHAITGQDVMRKYHDLGTPENLEPLNALQALPWRNLQATNDPAVSSISGETFARDLL
FT                   LRQTACAGCPVGCIHVGLLRERFGSDHEFFYRQVSYDYEPIFALGSMLGMERASEILTL
FT                   LEDAERYGLDVISCGVALAWATEALEKGVVTEKETLAPLAFNTLEPYRTALGHLALRSN
FT                   EFYHALGRGAARAAAEYGGTDFACVLGQEMAGYATGENYFVSQAYGFRHSHLDSGGYAY
FT                   DQNEGERDVDTAVTALVDDERQRIMVSCMVGCLFARKVYTAEQLQTCLDVLGYSALAAG
FT                   LEDRAAAVQAKRWALKCATGFDPDTVVIPRRFQEITTWKGAMDPAYMNELGRAYARTIQ
FT                   RMAANAPRWNEE"
FT   gene            109380..112220
FT                   /locus_tag="Dret_0082"
FT   CDS_pept        109380..112220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0082"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: dal:Dalk_0107 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; extracellular solute-binding
FT                   protein family 3; PAS fold-3 domain protein; response
FT                   regulator receiver; PAS fold-4 domain protein; histidine
FT                   kinase A domain protein; SMART: extracellular
FT                   solute-binding protein family 3; PAC repeat-containing
FT                   protein; histidine kinase A domain protein; response
FT                   regulator receiver; PAS domain containing protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67384"
FT                   /db_xref="GOA:C8WZA9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZA9"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67384.1"
FT                   /translation="MRGGSGLSHFGALVACLLVLLGMVPSVPAADNGFAAREQWAVGTA
FT                   QFVVAPDPHWPPIEFFDAQGRYQGLAADYLRLAAKELGLSLRVRRLDNWAQAVDAVRSG
FT                   EADVLGAARKTAERERFARFTQPFYEVPTVLVVRQGDRTITSLGDLEAVGAVRGYAVAE
FT                   YLRRTAPELTLHLVPDTATGLRQLSLGHLPALVTELPAATFLQSKLGLSNLRFVETLDY
FT                   SYPLSFAVRRDAPGLYTRLEAALAGIANEQRRALERKWIGLDHSELLRDSWFWKQVLGA
FT                   TLLVVLVVFVPLYGLQREKIRRRTRQLQTSEDKFRSVFEQSHQLMALLSVDGTLIEAND
FT                   RALEFMGADRAFLRGHELTALPWWTGVEDDNEEMAAAIRLAATGEVVHGRTRNIAPSGR
FT                   TVWIDYSVKPVFGEEETPHYLVVEGRDVTAYLQAKQALEENERMLSTLLANLPGMVYRC
FT                   SDDPRWKMEYVSRGCMDLTGYDEATLTTRMDPEYGDLILDEDKPFVLESVEQALTSKES
FT                   FQVTYRIQDADGVVKWVWEQGRGVWSEGGDLESIEGFVTDVTAQRQLEEQLRRSQRLES
FT                   VGRLAGWAAHDFNNMLTPILGYAEILLAGAPEGGKEAAKLEQIHAAAERARQLARQLLA
FT                   FSRNQVLAKAHLDLREMVQGFWDILSQGVREDIFLELTLSEEPCRVMGDAHQLEQVLMN
FT                   LVLNSQDAMLEGGSIQVAVAPIELDAGYQKLHPEIAPGRYIQLSVADTGVGMDRETQRQ
FT                   AFDPFFTTKGEEGTGLGLSSVHGILKQHGGHAEIYSEPGAGTVVKLFLPRVDEDSSRSE
FT                   GPQTLQEQTFVSGSETVLVVEDNEMVRELTCEVLFSLGYSVVSAAEPREGMRVASQTEE
FT                   EIALLVTDVVMPYMDGRKLYQELQADRPGLRALFISGYTDNHIANTGGMEAGTAFLQKP
FT                   FTSQELARSVRQVLDA"
FT   sig_peptide     109380..109472
FT                   /locus_tag="Dret_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.942 at
FT                   residue 31"
FT   gene            complement(112305..114560)
FT                   /locus_tag="Dret_0083"
FT   CDS_pept        complement(112305..114560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0083"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: dde:Dde_0106 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; DNA topoisomerase
FT                   type IA zn finger domain protein; SMART: DNA topoisomerase
FT                   I DNA-binding; DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67385"
FT                   /db_xref="GOA:C8WZB0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB0"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACV67385.1"
FT                   /translation="MSTDLIIVESPAKVKTIRKFLGSDYLVEASVGHVRDLPSSNLGVD
FT                   EDNNFQPQYQIISGKQKVVSRLKSAAKKATTVYLAPDPDREGEAIAWHVAELLKKTNTN
FT                   LKRIQFNEITSRAVKDALEHPRDLDERLFYSQQARRILDRLVGYKISPLLWKKVKRGLS
FT                   AGRVQSVALRLIAERERERQQFDPQEYWVLKAHVQAAAPPPVVAELWKIGGKKPHVANE
FT                   TQALEIEKKVSEAGFHVESVEEKERKRHPKPPFITSTLQQDASNRLGFAAKRTMRIAQQ
FT                   LYEGLDLGDKGTTALITYMRTDSVRISNEARNAAQKWIVSTLGEAYYPEKPRYFKTKGS
FT                   AQDAHEAIRPVDPTLTPGSIQSYLSREHFRLYKLIWERFMASQMAPARFWDTQLTLASA
FT                   NTLWRAKGERLIFDGYLRVYSADKSQEEVELPKVQAKDALTLEKIDKEQKFTQPPARFS
FT                   EASLVRKLEELGIGRPSTYAQIISTLLDRNYVQLAKKQFVPTEMGFVVADLLTAHFPQL
FT                   LDVGFTAEMEKKLDSVAEGDQDWTQLLREFTESFYPTLEKAEQEMQQVKTGVETGVSCP
FT                   KCGKPVVIKFGRNGEFLACTAYPDCDFTSNFTRDEAGTIVIVEPEPQERQKVGTCPECG
FT                   QDLVLKKARTGSRFIACTGYPKCKYTQSYSTGVKCPKQDCPGELVEKSSKRGKVFYACN
FT                   QYPDCKTAYWNWPIAEECPTCGSPILVRKETKARGEHVACPEKGCGYWRELRDDEKH"
FT   gene            114610..115548
FT                   /locus_tag="Dret_0084"
FT   CDS_pept        114610..115548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0084"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: GTP-binding protein Era; small GTP-binding
FT                   protein; PFAM: GTP-binding protein HSR1-related; KH type 2
FT                   domain protein; Miro domain protein; KEGG: dvl:Dvul_2909
FT                   GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67386"
FT                   /db_xref="GOA:C8WZB1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB1"
FT                   /inference="protein motif:TFAM:TIGR00436"
FT                   /protein_id="ACV67386.1"
FT                   /translation="MDESSFGEDYGGTYRSGLVAIIGPPNAGKSTLLNQFLGQKVAIVS
FT                   PKPQTTRNQISGILSTDEAQVVFLDTPGVHKSGQRFNRYMVDAAWRALTASEAVLLVLD
FT                   AGLYLARPQLLERDTSLMRKRVQQSGNPVFLALNKTDTIKDKSRLLPLLQRLSELWPEA
FT                   ELHPISALRGNETDALLSGLLGALPEGPPLYPEDQISTLPMRFMTAEIIREKLFLALEK
FT                   ELPYNLAVIVEQWEERPTGISVYATIYVARPSQKAIVIGKGGRLLKEIGQQSRLELAEM
FT                   IEKPVHLDLWVKVKKRWHEDMSFLGELGLTE"
FT   gene            115576..116283
FT                   /locus_tag="Dret_0085"
FT   CDS_pept        115576..116283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0085"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   dma:DMR_46160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67387"
FT                   /db_xref="GOA:C8WZB2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB2"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACV67387.1"
FT                   /translation="MDTQTPYAERVQEIKETMAAAARAADRDPAEVTLVAVSKYQPIEA
FT                   IAAVHAAGQTHFGENYIQEALDKQDQCDISPIQWHFIGHLQRNKAKFVPGRFDLVHTVD
FT                   SVRLAQMLDKKAAEAGVVQAILLQVSLAGEEQKAGLAPEALEETLDTVGQLPHLQLQGF
FT                   MTMPPYFNDPERVRPLFCRLRELRDEAQNQLGRELPHLSMGMSGDFEVAIAEGATLVRV
FT                   GTRIFGPRPQKSL"
FT   gene            complement(116843..117577)
FT                   /locus_tag="Dret_0086"
FT   CDS_pept        complement(116843..117577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0086"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: dde:Dde_3581 RNA
FT                   methyltransferase TrmH, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67388"
FT                   /db_xref="GOA:C8WZB3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB3"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACV67388.1"
FT                   /translation="MTEYSHVVAGLHPVKELLERTPDRVETVLLQKGGRQQKEIKDLCQ
FT                   ATGIRFQILPRAQLDKLISAHHQGIAARVFSPGFVDPQVLLETVADAPLPLLIALDQVQ
FT                   DPGNIGTLARTLYSLGGAGLVLPKNRSAPLGGGALKASSGALNYLPVAQVTNLGRFLEQ
FT                   ATQAALPVIGTGLTPDSLSVYKARLSTPAVLVLGNEHKGMRPGVAKKCETVVSIPLQRQ
FT                   FDSLNVAQAGAILISEFLRQRG"
FT   gene            117707..119569
FT                   /locus_tag="Dret_0087"
FT   CDS_pept        117707..119569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0087"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic;
FT                   Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: dde:Dde_3580
FT                   peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67389"
FT                   /db_xref="GOA:C8WZB4"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB4"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACV67389.1"
FT                   /translation="MPYVFPRAFVLVLLLAVGCAPLTNSPQSQHTGKMQNATPENTAVN
FT                   ASCPVSAAPSAVTEKAARNASKPEQQDLAAEATGSDADLKQPLEEEVQADVSSNATDKE
FT                   PALTQAEKKALESEAEIQFDLDVRETERMQKFFRYYTHKHRKTFQRWLKRAEPYLPHIR
FT                   KVITEKGLPQDLVFLPFAESGFNPWAYSRAGAAGLWQFMPATGRHFDLRVDWWMDERRD
FT                   PYASTQAAAEYLSRLYGQFQDWYLALAAYNAGEGNVGRALERSGCDNFYDLASSRRYLK
FT                   SETRNYVPKFQAILKIVRNLEELGFEPIDWDASPEPSQVAIKGGTDLMGLADATGMSWS
FT                   EFRKANPKFRRTVSPPDASYQVQIPAPKVAQAKAYLDGPRAQKMAGGKRYRVRSGDSWW
FT                   RIARRFDVPLTALMRLNNTRSKMLHPGDSVLIPVSGEAARARVAAQDGEYVVQRGDSLW
FT                   ELARRMDTTVTKLRRANNLQNTTLRVGQRLTIPGGSQKAKTRQIAQRRSNYTVKKGDTL
FT                   WELSRRFGLSLNTLVQANGIGRSSALQVGQKLYIPDRGRTTQVAKAREKAAHQRLVRYT
FT                   VRQGDNLWTIARRFGVSADALQDWNNLGKNELIHPGDNLRVYIQ"
FT   sig_peptide     117707..117781
FT                   /locus_tag="Dret_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.541 at
FT                   residue 25"
FT   gene            complement(119747..120562)
FT                   /locus_tag="Dret_0088"
FT   CDS_pept        complement(119747..120562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0088"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: dvu:DVU0115
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67390"
FT                   /db_xref="GOA:C8WZB5"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB5"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACV67390.1"
FT                   /translation="MQDPRLFGIIGHPLGHSLSPVLHNWALEAQGIPGSYLRWDIPPAR
FT                   LADFVTAARLLPIHGASVTIPHKVEVIDYLDRITDRARQAGAVNTLYWEQDRLCGTNTD
FT                   SEGFLAPLLASSRFPRSALILGNGGAARACLAALLEHGTEVWICGRRREQSEVLAAAFG
FT                   GHVLDWESRSTASAELLVNSTPLGMAGQRESLSPMPQNGSLQNFATVYELIYNPMDTVL
FT                   IRQAREEGLQTITGLAMFVHQAAAQFRLWTGREMDIPAAWERCTSALGA"
FT   gene            complement(120640..121197)
FT                   /locus_tag="Dret_0089"
FT   CDS_pept        complement(120640..121197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0089"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase; KEGG:
FT                   dde:Dde_0046 2-oxoglutarate ferredoxin oxidoreductase,
FT                   gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67391"
FT                   /db_xref="GOA:C8WZB6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB6"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACV67391.1"
FT                   /translation="MSLYKDVIIAGFGGQGVMLIGNLLAYAAMDAGLNVTYIPVYGPEM
FT                   RGGTANCTVVISDEDIGSPIIHAPQSLIAMNRPSLEKFQPRVQDGGIQIVNDSLVEEQL
FT                   AEKVRVRSYFVPANDLANEVGTAKMANMVALGAYIQATGVLPLERVKNSLEKVIAAHYA
FT                   HLIPKNQAALQAGADHVQKQLQ"
FT   gene            complement(121194..121964)
FT                   /locus_tag="Dret_0090"
FT   CDS_pept        complement(121194..121964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0090"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: dde:Dde_0045 pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, beta subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67392"
FT                   /db_xref="GOA:C8WZB7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB7"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACV67392.1"
FT                   /translation="MSSHEKQVFAVTDAVIDVPTHYCPGCQHGTIHRLVGECLDEAGLT
FT                   EQAICIGSIGCSVFIYNYLNVDAVEAPHGRAPAVATGAKRANPENFVFAYQGDGDLASI
FT                   GLAEIMHCANRGERVSVVFVNNTVYGMTGGQMAPTTMVGQKTTTCPGGRCAEREGLPMK
FT                   MAEIIGGLGGTAYSARVAVDTVKHLKQAKKALKKAFEVQTQGKGFGFVELLATCPTNWR
FT                   MSPLEANARISEEMIPYFPLGTYKDIEDEGGQQS"
FT   gene            complement(121957..123036)
FT                   /locus_tag="Dret_0091"
FT   CDS_pept        complement(121957..123036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0091"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: dma:DMR_07380 ketoisovalerate
FT                   oxidoreductase subunit VorB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67393"
FT                   /db_xref="GOA:C8WZB8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB8"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACV67393.1"
FT                   /translation="MPHSSGERIFIKGNEAIARGALAAGCQCFFGYPITPQNDIPEFLS
FT                   TALPEAGGEFVQAESEVAAANMLLGAAACGKRAMTSSSSPGISLKQEAISYLAGSELPA
FT                   VIVNISRGGPGLGDIGPSQGDYFQSTRGGGHGDYRLLVLAPGSCQEAYDMTARAFELAF
FT                   KYRNPVMVLGDAILGQMKEPVTVAAPHTPDPGEAADWALSGAQGRPKRLLKSLFLKDGE
FT                   LADHNQRLQDKYLRMASEIDAETYALEDAELVVVAYGSIGRIVKSTVRRLREQGRRVGL
FT                   FRPLTVFPFPSKPLQDLARKGKHFLTIEHNLGQMVEDVRLAVCPHGSSALHCCLPGNLP
FT                   TPEDFEQPIVKALEDTIHV"
FT   gene            complement(123026..123268)
FT                   /locus_tag="Dret_0092"
FT   CDS_pept        complement(123026..123268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0092"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dde:Dde_0043 2-oxoglutarate ferredoxin
FT                   oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67394"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZB9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67394.1"
FT                   /translation="MSRVVFRDERCKGCLLCTAACPSEIIVQSQRFNQQGYKVVEVADQ
FT                   DMDKCKGCAFCAMVCPDNVITVFRSSATKENDNAA"
FT   gene            complement(123460..124551)
FT                   /locus_tag="Dret_0093"
FT   CDS_pept        complement(123460..124551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0093"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-iso
FT                   merase"
FT                   /note="TIGRFAM:S-adenosylmethionine/tRNA-
FT                   ribosyltransferase -isomerase; PFAM: Queuosine biosynthesis
FT                   protein; KEGG: dvl:Dvul_0043 queuosine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67395"
FT                   /db_xref="GOA:C8WZC0"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC0"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ACV67395.1"
FT                   /translation="MNTIPRDYDLDAYQFELPADQIAQHPHPQRDASRLLILDRSSGQR
FT                   QHATFRDLVDTLPDGALLVANTSRVLPARLKGQKRATGGKVEFLLLTPLPLVTPQPLAD
FT                   GRNEGFVSGLLRSSKPLAVGQKADFPGGIELTVIEREEFGRVQVRLCWSGDMAEVFQAY
FT                   GHMPLPPYIQREDDATDHGRYQTVYADSAKTGSVAAPTAGLHFTDDVLHALRDKGIQWA
FT                   EVTLYVGYGTFSPLRCRDIREHHMHPEYIELDAANAETISRAQAEGRPVVAVGTTTVRT
FT                   LESIAHHCGRIQPFAGWTDIFIYPGFSFRVVDHLLTNFHLPGSSLILMVAAFAGRRLVL
FT                   EAYEEAVDEGYRFFSYGDAMFIV"
FT   gene            124913..125872
FT                   /locus_tag="Dret_0094"
FT   CDS_pept        124913..125872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67396"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67396.1"
FT                   /translation="MIYVSSHGCIRSAKKSTGESMTNHVERIQQILAQRVVSGDDLPSA
FT                   LRAYVEQSWGGFDREAVRQVLADPDHDEHDILLAFWGFPEKETVTAVEEVLPLAGLSAA
FT                   EGAAVQHWFCARPQRTVGLGGTVRVQLTLPEDILEAYVRRLRLQSEIPTSLAEAGKHRL
FT                   APREALALQRFLRTVSAALSAEQIAVCRKAIEGVPSEDIVAALRLLLELWQQRDADVGL
FT                   WALLVEEGQRCRQAIEHDQFQEKLLERQTMEQMMGAGNRVLAIDRRAYRDRLGLLDTLA
FT                   LQLYGAVLPAPQEPLQWNMGAFDADNADDVATLMRMLS"
FT   gene            126452..128056
FT                   /locus_tag="Dret_0095"
FT   CDS_pept        126452..128056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0095"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: dat:HRM2_09100 putative
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67397"
FT                   /db_xref="GOA:C8WZC2"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC2"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACV67397.1"
FT                   /translation="MQRKKMCIGILGLMQALFLFLPASRAVAADDPLTLLLVPVEEENV
FT                   VFRQFLPVKHYLEKRLNRRVELDIAHNAEAALDRLGQGQVDLAYLDPSAYCEGKSMYQL
FT                   HPVAKVVKNGEGQYRSVLVVRDDSQVEKIVQIPGRSLALGNTRSSSAYLMPLAMLQEIK
FT                   LDLEDFSQVGFLQKEDLVALSVLVRDYDVGAMSQEVARKYLPYGLRIIKKSEKLPQFII
FT                   SSAPQMDVEERNALQTALLEYTPQDFDTVSFAEAEDREYNVVRIMLKNITGKDYLAYPE
FT                   GAVKLALLPLYSPITLDKMFAPLAEYLTQETGREFRLVIPRDFEEFVSIVSNGEVDFAY
FT                   QNPYVYLLLGQRGKLQSLVTTISPEPETSREEFRGVILVRKDSAISSLEDLKGKDIMIV
FT                   SRRSAGGYRFQKILLRQHGIDIAREARLEEGKKHEEVVLSVYRGEADAGFVREAALQVA
FT                   KDIVDTSDLRVLATTEYYPNWPFAAYTETDADLVAKVRSALLAIEDPAFLEEARINGFT
FT                   QSQMKRLQQLKEKVVLE"
FT   sig_peptide     126452..126538
FT                   /locus_tag="Dret_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 29"
FT   gene            128053..129630
FT                   /locus_tag="Dret_0096"
FT   CDS_pept        128053..129630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0096"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   gme:Gmet_2454 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67398"
FT                   /db_xref="GOA:C8WZC3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV67398.1"
FT                   /translation="MMSFVADRFNQLKFKNKFLVITLANIIVVLAAFSFVVDDYFKKRI
FT                   SQNQEENNLSLARNMARESVDPLLIHDYLQLDVLVQSTKEALLCKYAYILDHHGRVVAH
FT                   SDKSRLGQKYSPPSTEEQYIRDRKVAGVMYQDYFLPIRVRGELLGYAVVGIDRNKETAV
FT                   IQQSLHGLRLRLLIVAVSLFAFTALTASYLASRLTRRIGDLKQSMRQVQQGDLNVQLPL
FT                   PRASSCKDLWDCPLKECPGYGSDACWAQGQSFLQPQKNCLECLVYKRACGDEIGELHIA
FT                   FNQMVRDLKRNLDKLHQADMEKNRLERLSLLGQMAAQVAHEIKNPLNSIKGSAHYLKAN
FT                   FEGRILHEFLHVIEEESERLSDILTDFLNFSKPGVPHFEREDLNALVRDTLRLASRDTQ
FT                   DGVVRLDSTLDPQLPPFWFDYAKLRQSLLNLVLNAVHAVREGGTVQVSTIAQPDRGQLV
FT                   IQDDGQGITAQELENIFKPFYTTKNRGNGLGLSIVEQYIRAHKGTIDVDSQPGQGTTFI
FT                   ITLPFDPR"
FT   sig_peptide     128053..128163
FT                   /locus_tag="Dret_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.456 at
FT                   residue 37"
FT   gene            129627..130973
FT                   /locus_tag="Dret_0097"
FT   CDS_pept        129627..130973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0097"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: scl:sce5791 sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67399"
FT                   /db_xref="GOA:C8WZC4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC4"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV67399.1"
FT                   /translation="MSTKKRILLIDDEPNTLKVLSAFLTKEGYEVGTAKDGRSGLNHLQ
FT                   EGGWDMLITDLKLPDITGLDILEQVKATWPKLPVVMITAYGSISNAVQAMKLGAFNYLT
FT                   KPVDPDELLLLVQNVFERSQLLEENQTMRRQLRDRYSLGNMVGKSKAMQELFNLIEKVA
FT                   QYEANVLVTGETGTGKELVARGIHYAGQEENLPFVPIDCAAVPETLLESELFGHSRGAF
FT                   TGAAEQKKGQIELAHGGTLFLDEIGELPLALQKKFLRFLQEKEIVRLGETRRRKVDVRI
FT                   IAATNRDLEAEIAAGQWREDLFYRLNVISIEIPPLRERRDDIPPLVNHFLAKYNAQNGK
FT                   AIQGMTGEVMEVFMAYDWPGNVRELENVIERAVVLCMGDSIAMSCLPPKLQERSAPAPS
FT                   TDGVNLMEMEKRLIVQTLEKTEQNQSAAARELGISRKQLRTKMKHHGLL"
FT   gene            131134..133569
FT                   /locus_tag="Dret_0098"
FT   CDS_pept        131134..133569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0098"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding
FT                   protein"
FT                   /note="PFAM: pyruvate phosphate dikinase PEP/pyruvate-
FT                   binding; PEP-utilising protein mobile region; KEGG:
FT                   dde:Dde_0604 pyruvate,water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67400"
FT                   /db_xref="GOA:C8WZC5"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC5"
FT                   /inference="protein motif:PFAM:PF01326"
FT                   /protein_id="ACV67400.1"
FT                   /translation="MFVTQLFKRWTYQVFAPGTLVRQKYEAFKELLQRDQKALEYMAEL
FT                   EDIALSHRPVDFARIESLAKALSREVEGMVEDLVVLHPLRYSALRDYLAKVDFYVRLAL
FT                   LSDEIRCSPPYVARIGDKSEENLLGGKGNNLSRIKRETDYPVPPGFVITTRAFHYFLEV
FT                   NNLRHELDALLAQVDLEDTEALRELCDRMQQTVLAGEVPVSVAREVEKAMSGAGLQTMS
FT                   LALRSSAVGEDSLVSFAGQYMSVLNVDPASWTETYKAILASKYAPNAVAYRIRSGMADT
FT                   MVPMAVVVMGMVHPRVSGIMYTPGEQGTESQLSMIPGYGVDLADGRESGQQATVSRQEE
FT                   VRFDNAEPVLAPSTVAAVARVGQGLEAVFAGPQDVEWAVDQEGEVVVLQSRPLPGGTPE
FT                   PVFTEQDTDALSYAPEAVLCQARSASPGRATGPVHLYDGQPEAVPPGSVLVVEHMTPDL
FT                   SVLAGRICAVVAAKGSATCHFASVAREQRLPAVYGAACANQLDGGRTVSVDSHAGVVLN
FT                   DAVVFEPEPREREEADDNLPPVQRKLAAALEHISPLHLTNPDDEEFSLRRCRSMHDIIR
FT                   FTHEAGVKEMFDLIGGRGLNQTGVKRLVSDVPLVLHVLDVERGLQEEARKRKEITPEDI
FT                   VNRPMRWLWAGLADPAVAWNPNVVHYDWDAYNKSQASFVNVEKSTMFSSYAVLGDDYLH
FT                   GLFRFGFHFAVVDCVVGEVPEHNYLHVRFKGGGGLDEQRLHRLELLRQLLTGHGFSVKT
FT                   TGDLLEGVLPRQEKHRLQMALHELGIILGKTVQLDMRLHSDQDVADLVEEIQNVLPER"
FT   gene            133739..134851
FT                   /locus_tag="Dret_0099"
FT   CDS_pept        133739..134851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0099"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="PFAM: Dual specificity protein phosphatase; SMART:
FT                   Dual specificity phosphatase, subgroup, catalytic domain;
FT                   KEGG: dde:Dde_0605 protein tyrosine phosphatase / dual
FT                   specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67401"
FT                   /db_xref="GOA:C8WZC6"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC6"
FT                   /inference="protein motif:PFAM:PF00782"
FT                   /protein_id="ACV67401.1"
FT                   /translation="MWSFLQKMFGRNDSEETYELSWVTGQVAVGHAPMSYEEFDSLKRQ
FT                   GITAILNLCAELDALVTLERDAGFEVYFLPVPNEEPPDVQATDAALDWLDECVYLGKKA
FT                   LIHCRHGIGRTGTVVSSYLLRKGLGQKLVNKHLKDLRSKPSNLTQWHFLRQYGKAQGQL
FT                   TIREPCLESRCLVDLSPFFDDIEALFAQIEDRAESATERCGREHAKCCFKTVRMSLAEA
FT                   VYLHHMFNKSVTSEKRKQSMAAALEALQTRQALVRENPGLSQAALDARYEALDIPCPLL
FT                   GEANKCQLFAYRPAACRVFDLRQVNSGPGVPLQRGLQRISDNLFMALTEHFMPGAPLEF
FT                   DLNAVVSGKFVQNLFLELARKEAEQTAATD"
FT   gene            complement(135040..136242)
FT                   /locus_tag="Dret_0100"
FT   CDS_pept        complement(135040..136242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0100"
FT                   /product="cysteine desulfurase NifS"
FT                   /note="TIGRFAM: cysteine desulfurase NifS; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   dvm:DvMF_2659 cysteine desulfurase NifS"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67402"
FT                   /db_xref="GOA:C8WZC7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC7"
FT                   /inference="protein motif:TFAM:TIGR03402"
FT                   /protein_id="ACV67402.1"
FT                   /translation="MNPVYLDNNATTRVAPEVEEAMRPYLGELYGNPSSMHRFGGQVGK
FT                   DLRIAREQVATGLGADPEEIIFTSCGTEGDNTAIHAALESQPDKRHIVTTKVEHPAVLN
FT                   YCKHLEKKGYEVTYLGVDTHGRLDLNALKNSLRPDTAIVSIMYANNETGVIFPLDEIAP
FT                   LVKERGILLHTDAVQTLGKIPFSVADLPVDYLVVSGHKVHGPKGVGVLYVRRSAPYAPF
FT                   VIGGHQEHGRRAGTENTASIIAMGKAVELATTDIAAEQSRISALRDRLQSGLLEAIPDT
FT                   VVNGEAAERLPNTLSIAFKYIEGEAMLLLLDEFAICASSGSACTSGSLEPSHVLRAMGV
FT                   PFTYAHGSLRFSLSRYTTEEEIDTVLRELPPIIERLRAMSPFRRGEEAFGVSCGIERDT
FT                   V"
FT   gene            complement(136239..137090)
FT                   /locus_tag="Dret_0101"
FT   CDS_pept        complement(136239..137090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0101"
FT                   /product="Fe-S cluster assembly protein NifU"
FT                   /note="TIGRFAM: Fe-S cluster assembly protein NifU; PFAM:
FT                   nitrogen-fixing NifU domain protein; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: dma:DMR_17100
FT                   nitrogen fixation protein NifU"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67403"
FT                   /db_xref="GOA:C8WZC8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR010238"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC8"
FT                   /inference="protein motif:TFAM:TIGR02000"
FT                   /protein_id="ACV67403.1"
FT                   /translation="MWEYTDAVKDHFLHPKNVGAMENPTAVGEVGSLACGDALKLYLKI
FT                   NDDGIIEDATFQTFGCASAIASSSVLTELIKGKTIEQAKSVTNKEIADALGGLPKEKMH
FT                   CSVMGQEALEAALKHYWGEVVPEVPLEGEIVCTCFGVTDQQILRAIEENDLKTVEDITA
FT                   YTKAGGGCGECQSKLTELLENKRLSEPAQVPTGPAASTKKLTNIQRMQLVNDVIEKEIR
FT                   PSLQKDGGDIELIDIEGREVQVALRGMCSGCPSSQLTLKNVVERRLQERVEPEITIKEI
FT                   VE"
FT   gene            complement(137214..138083)
FT                   /locus_tag="Dret_0102"
FT   CDS_pept        complement(137214..138083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0102"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dal:Dalk_4375 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67404"
FT                   /db_xref="GOA:C8WZC9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZC9"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV67404.1"
FT                   /translation="MSGILAILTAAALWGLIGPLAKYAFAHGFTPMEVAFWRAALAWGF
FT                   FATHAGLRGQLRIQWRDLGPTIVFGFFSVSVFFGAYQVAVARSGAAVAAVLLYTAPSWV
FT                   ALLSRLLFSEALTPIKLASIALSTLGVAAVAFGRADLGPVNLDWIGVTAGLTAGLTYAI
FT                   YYIFGKHYLGSYPSGTLFFYALPVGAFFLWPLADFGYHPFPAWLAVGAIAFFSTYLAYA
FT                   IYCHGLKRLQPARAAVLATFEPVVAAILAVIWWGERFTLLGIIGGLCIVGGVVWMSCAR
FT                   EPGPKSRH"
FT   sig_peptide     complement(138003..138083)
FT                   /locus_tag="Dret_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            complement(138086..138430)
FT                   /locus_tag="Dret_0103"
FT   CDS_pept        complement(138086..138430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0103"
FT                   /product="protein of unknown function DUF1291"
FT                   /note="PFAM: protein of unknown function DUF1291; KEGG:
FT                   dal:Dalk_4103 protein of unknown function DUF1291"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67405"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD0"
FT                   /inference="protein motif:PFAM:PF06948"
FT                   /protein_id="ACV67405.1"
FT                   /translation="MPNTPNLVLLWSSRDPEVFQQLVAMYARNSLRNGWWDRVRLIIWG
FT                   PSAQVAAEDAPVQALLDELQSDGVELLACQRCAENYGVSATLADLGIDVQYMGQPLTDM
FT                   LQSGWHCLTF"
FT   gene            complement(138947..140266)
FT                   /locus_tag="Dret_0104"
FT   CDS_pept        complement(138947..140266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0104"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: sfu:Sfum_3082 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67406"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD1"
FT                   /inference="protein motif:PFAM:PF03349"
FT                   /protein_id="ACV67406.1"
FT                   /translation="MRKVVLFTFALLTLSFSTANGAGFATYEWSARGNALGGSVVGMAD
FT                   DPAAVASNPAGITQLEGGHGLFGLTAIYPQAEVTTKPQGGPEQTTSGEDNIWTLPHAYY
FT                   TRQLSDRYWLGLGVFTRFALGTEYHDDWPGRYNTRYTGIKTVSFNPNLAMKLTDTVSLA
FT                   VGVEVMHMDFQQRKVKDASALAGQKTDPETTTYDFSADLNGQSQGVGFNIGLHYKPLDW
FT                   IQAGIIYRSPVDQKVEGEVNFDRSNLSKLTAINPAYGGSFQDMDAWGEITLPDSFQAGI
FT                   AFNLTQKLTVEVGGAYTFWSKYDELTFNYEKPVISVKPSSDTSTTPKSWEDTWRFNIGA
FT                   EYAVTPWCDLRAGYVYDQSPVQDEYADYLIPADDRQIFSFGTGFALNEQWTLDLSYNYI
FT                   MIQDRTVDYDEVRVEDEGVYAAEFDNANAHMVGMSLGYEF"
FT   sig_peptide     complement(140201..140266)
FT                   /locus_tag="Dret_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 22"
FT   gene            140473..140922
FT                   /locus_tag="Dret_0105"
FT   CDS_pept        140473..140922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0105"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: gur:Gura_1130 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67407"
FT                   /db_xref="GOA:C8WZD2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV67407.1"
FT                   /translation="MYEDKEFLLEDSPGFLLNRTALRIKKDFQRRISAAELDVTAEQCA
FT                   VLWSLWRREGCFQRELAEQTFKDITNITRILDGLERRGMVRRVRDEHDRRMSRVYLTEQ
FT                   GTSLQDKITAIASELGRDAYQGIDESDLQELRRVLNLVYANLSDA"
FT   gene            complement(141458..142153)
FT                   /locus_tag="Dret_0106"
FT   CDS_pept        complement(141458..142153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0106"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: dde:Dde_0126
FT                   MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67408"
FT                   /db_xref="GOA:C8WZD3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD3"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV67408.1"
FT                   /translation="MEDDLLSIKEIARQLEVPESNVRYWRDRFEDYLPVVGEGRKRRYK
FT                   KQALDIFQAIRDGYQANQSTEDIARDLARNYPRTMRVAPDEPAQDPAAEIQSVHSPFES
FT                   VQTLVQSQAKTLEHLASSLNASHSLDPRLKELQHRQEVLHKALASLWKHHKMQRRQLHE
FT                   ARMESAQARAEQQKLEQRLQSLEHVVAEHAEAQREERHKLEKEIGQYRYWLKKLVAHLD
FT                   PERQGNSCS"
FT   gene            142274..143521
FT                   /locus_tag="Dret_0107"
FT   CDS_pept        142274..143521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0107"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tgr:Tgr7_1569 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67409"
FT                   /db_xref="GOA:C8WZD4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD4"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV67409.1"
FT                   /translation="MALSSKVVRSVVLIAGLIVISIAVALYILRHPPKQPTPGEAMDPR
FT                   VEVQVQAIQPRVFQRKFTLWGTVHPKRQAAVAAGVAGDVQWVSPQCEPGEMVEAGQALL
FT                   RLDERTFRAVFEEARAQVAEAQAALALQRLDNAKQEKILEQLRQQVQAARASLQRFTTL
FT                   RQRETISQAELDREQERVSDVVSRFVQQREQVRTAAAQLERAEAALAGARARQDRSRAD
FT                   LERTTIRAPFSGRVMRREVDTGDRVTVGQPVFHLGQFREVRVAVEIPSSRLALVHKGVK
FT                   ATVRLPQASRQWEGRLVHLAPSGDAETRLFPAEVAVENTTAPLLLGGQFVAVECAERDP
FT                   KRYMAVPLRAIGQDDEGDYVFVVQGDPLRAVRRSVQRLWFQDGEVLVTGLQPGDRVVVE
FT                   GQADLSSGTAVKVGRS"
FT   gene            143518..146619
FT                   /locus_tag="Dret_0108"
FT   CDS_pept        143518..146619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0108"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pca:Pcar_0669 AcrB/AcrD/AcrF family cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67410"
FT                   /db_xref="GOA:C8WZD5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD5"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACV67410.1"
FT                   /translation="MNLASFSVRNPVCINLIMATILIMGVVLYVTRMPKEIFPAFSQDI
FT                   IQVTTVYGGASAREMEKNVSMKIEDAFADLEDIEDIFSTSQEGRSTVRLEVSKEVSNTA
FT                   KLLNDVQQAIDQIDDLPEDAEDPVVQELDSDLPIITVSLYGGINLLELERLVEDLEDAI
FT                   AAVPGVANVNRSGLPEREVWVEIRPETIKQYKLTLQDVTRILDAQNYDLPGGTMDTTEG
FT                   AYLLRTKGKAATLEDLREIVVATGPNGGQVVLDDIATLRDWFADKSTLGRFNRQRAINL
FT                   SVFKNDDGDAIKITQAITEVTERFEGQLPPTVQIGLFNDLSVYIKNRLDVLKTSGFQGL
FT                   IVVFILLLLALNTRVAGLVTLGIPVSFLGAIVLMYYVGMTMNMIAMFALIVVLGLVVDD
FT                   AVVIGENVYRHYEQGLSPAEAAVRGASEVSWPVVSAVATTIAAFLPMLLIPGTMGVFLG
FT                   VIPKVVTFALLVSLLEALVILPSHLAEFLPARPKPPSRLRRKLNAGVDSAIDVYGRFLD
FT                   LVLECRYVFLTAVISFSAVLIVYSAVHLPFILFGEFEGAQFYVNVECPLSFSLEDTEEY
FT                   IKQVEERLAETIPEAELISLVTNVGTIMDDMDSFRSGPHLGQIIVELKEFGKGRDRPIK
FT                   VVSSDVRDALADLQRGGRHIEVQELQSGPGGKPIYILVTGPRLDVLQEISFEIQNFVSQ
FT                   IPGVRDLSDNLEPGKTEFQVELTPLARTLGLSERDVAWQLRSGFAGIASTTSMQSAAED
FT                   IDIRVRFPEAVADRVETLYRMHLRLPGGELVPLSEVARVAPVRGESAILRDNGQRSVAI
FT                   TGDLDQAKTTASDVAQAVQDRFGDVAERFPGYRLTTQRGEVQDINRSMTALKFAFLLAL
FT                   FLIYFILGTQFRSYVQPLIVMAAIPLGIDGVLLGHILTGKQLGILSMIGLVALSGIVVN
FT                   DSLVLVDFVNRLRRQGQDRRSSLVQAGMIRFRPVLLTSLTTMGGLFFLAFLAKGQAQFL
FT                   SPMAVSIFFGLMMATLITLLVVPAMYSVTDDIALHFRRRRKGTV"
FT   gene            146845..147420
FT                   /locus_tag="Dret_0109"
FT   CDS_pept        146845..147420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0109"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   sat:SYN_02920 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67411"
FT                   /db_xref="GOA:C8WZD6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD6"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACV67411.1"
FT                   /translation="MQVVAINGSPRKNGNTAQLLQTVCAKLNTQGVETETIQLGTEPLR
FT                   GCVDCGVCKKEKNSRCVYDDDPLNTILAQMNAADGILLGSPTYFSNVTTNMKSLMDRAG
FT                   RVSRVSGFTLRRKVGAPVVAMRRAGGTHVFSSINYFFLISQMIVPGSSYWNLACGLQEG
FT                   DVMKDAEGVKTMELLGENMAWLLKKLRD"
FT   gene            147675..149789
FT                   /locus_tag="Dret_0110"
FT   CDS_pept        147675..149789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0110"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: dal:Dalk_3707 AsmA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67412"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD7"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ACV67412.1"
FT                   /translation="MGWKKITAIVLGVILLVVVGAAVFLVTYDYNALKPQIEAAVEKNT
FT                   GRKLTLDGDISLALGLTPALVVEDVSLANAQWGSKPQMLEVGRFELQVALLPLFQRNVE
FT                   IQRVVLRDTSVLVETNTQGVSNLTLHKPQAAAEPEQETSPEAPSDAASQKGPLPGLELD
FT                   NVLVENGSIDVRDAAGETVTSFSVQRLALQTLPNKDVQMTFDGQFNGQPLSMSGTVGPL
FT                   QGLTDAQQQWPVDLAVQSGSASVALEGAIRDVFAQRGLDLDLSATIPEPAALKPLVGQE
FT                   IPVAGPIECTATLTDTAAKTFRLDSLQVRQGENRLSGTVSLALGPPLSVTADLTSPLLD
FT                   VTAITTQPSGDTAPPQEQQGASSAAGDQRVFPDTELPWEALRQINAQCSLQVGTLVIPK
FT                   LQLVDTQLELGLKDGLLTLSRLTARSGAEGTLNATMTVDARSKQPRLECAARIEHFALE
FT                   QVLRETKSDSFLQGTVSTDLAVTGQGRSVAAIMAGLDGKLQASMSEGRLANARLEKWGA
FT                   DLGASLFRLLNPLEERGRFTPIQCAVLVVPIDSGLARVQALVVDTPRMLLRGQGSVNLR
FT                   TEALDIGLDPQPKEGLQTGVLGKLSLSFSELAQAFRLGGTLAKPSLALDKTKTIETLGK
FT                   GIGGTLLFGPAGAAAGLLGSSDTSDNPCLQALEGADAAQEQQAEKPSSPQEQVEKGLED
FT                   LGGKLQKLFE"
FT   sig_peptide     147675..147740
FT                   /locus_tag="Dret_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.462 at
FT                   residue 22"
FT   gene            149877..150668
FT                   /locus_tag="Dret_0111"
FT   CDS_pept        149877..150668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0111"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sfu:Sfum_3016
FT                   3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67413"
FT                   /db_xref="GOA:C8WZD8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV67413.1"
FT                   /translation="MQVQTATIRSAYHLEGPATAPVVVFSHCLAGNRTLWAPQMDALKK
FT                   DYRVVSYDIRGHGESEVVPGPYSMSELAQDTIALLDALDLDRVHFVGLSLGGMIGQVLG
FT                   AMYPERFVSLALCDTTEAIPASGAQEWDKRAEIARRQGMAPLAEANLERWLSPAFRAER
FT                   PEETQRIRDMVQTTPVEGFAGCCAAIKGFDFSERLSSVTVPSLLLHGEQDGLMPRDKAE
FT                   AMARMMPRARVATLTEALHLSNIEQSEAFVRELLAFWDGRS"
FT   gene            complement(150812..151153)
FT                   /locus_tag="Dret_0112"
FT   CDS_pept        complement(150812..151153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0112"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   dde:Dde_3493 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67414"
FT                   /db_xref="GOA:C8WZD9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZD9"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACV67414.1"
FT                   /translation="MKLIIAYIRPERLNPVKQALYAKRVYNMSVTNILGSGRQKGFTET
FT                   YRGVVMEVNLLKKIRLEIGVNEEFVDAALDAIREGAQTGREGDGVVFVLDIAKSMRIRT
FT                   EETGPDAIG"
FT   gene            complement(151165..152541)
FT                   /locus_tag="Dret_0113"
FT   CDS_pept        complement(151165..152541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0113"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: ammonium
FT                   transporter; KEGG: dde:Dde_3492 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67415"
FT                   /db_xref="GOA:C8WZE0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACV67415.1"
FT                   /translation="MRSRKTSLCKSNVLRPLAFAAVLGFVPTMALAAEAPLSQFHGNIL
FT                   WTLIAAILVMFMQAGFAAVEAGFTQAKNAGNILMKNVLDFSAGSVMFFFFGFALMFGTD
FT                   VGGLLGGSGFALGGVDATSPDGQWTLTFWFFQSVFAATAATIVSGGVAERTKFPAYILI
FT                   SIIVTGLIYPISGHWAWGSLWLGDAGAGWLESLGFADFAGSTVVHSVGAWIALAGAIVV
FT                   GPRLGKYTKDGTARAIPGHNIPLAGLGVFILWFGWFGFNPGSTTTADGTIGYIAVNTSL
FT                   SAGTGALGAMIMAWLRFGKPDATMSLNGILAGLVGITAGCYELSPIGAMIVGLGSGILC
FT                   ILSVEFIDKVLKVDDPVGCVSVHGTCGAFGTLCVGLLAAPGYGGLTGLFYGGSINLLGI
FT                   QALGVASVFVWAFGVGFMAFKGVDALIGIRVDEDEERKGLDITEHGMESYNGFQIFSTE
FT                   "
FT   sig_peptide     complement(152443..152541)
FT                   /locus_tag="Dret_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            153117..153920
FT                   /locus_tag="Dret_0114"
FT   CDS_pept        153117..153920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0114"
FT                   /product="predicted phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: dma:DMR_05370 putative aldolase; TIGRFAM:
FT                   predicted phospho-2-dehydro-3- deoxyheptonate aldolase;
FT                   PFAM: deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67416"
FT                   /db_xref="GOA:C8WZE1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE1"
FT                   /inference="protein motif:TFAM:TIGR01949"
FT                   /protein_id="ACV67416.1"
FT                   /translation="MHLGKALRLERIVNRNTGRTIIVPLDHGVTVGPIYGLVDLRETVD
FT                   KVAEGGANAVLMHKGLVRCGHREHGRDVGLIVHLSASTALSPYPNAKTLVGSVEDAIKL
FT                   GADAVSVHVNIGDESERQMLSDLGNVSSRAAEWGIPVLAMVYARGPKIENEFDPQVVAH
FT                   CARLGEELGADVVKVVYTGDIESFSKIVDACCVPVVIAGGPKLENTRQLVQMVHDSIEA
FT                   GGAGLSVGRNIFQAEAPDRLVRALHQIVHEDYSVEQALSLLESGE"
FT   gene            153967..154938
FT                   /locus_tag="Dret_0115"
FT   CDS_pept        153967..154938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0115"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: dvl:Dvul_2476
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67417"
FT                   /db_xref="GOA:C8WZE2"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE2"
FT                   /inference="protein motif:PFAM:PF01959"
FT                   /protein_id="ACV67417.1"
FT                   /translation="MMTVYVKAMPFDKQVVTLALESGVDGLFVAQEHKEEVLSLGRTAV
FT                   VTPEEMEEITLADKGDEEEAATALRAGKNVVLRQGWEIIPVENLLAQGGRLGLEVTSLE
FT                   QARLAAGILERGVDFIVVPQEACEAIKPIVDGMKRSQGQLDLEIGRITSIAQVGLGHRV
FT                   CVDTCSLMRTGQGLLVGNSAALTFLVNAETESNPYVAARPFRINAGGVHAYVSMPGDTT
FT                   SYLEELRAGSEVLVVGHDGTTQVATVGRVKTEVRPLLLITAEVGGSSGQVFLQNAETIR
FT                   LVRPDGSPVSVVSLREGDEILCRTDKAGRHFGMRIDEEIVEH"
FT   gene            154942..156075
FT                   /locus_tag="Dret_0116"
FT   CDS_pept        154942..156075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0116"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: prephenate
FT                   dehydratase; amino acid-binding ACT domain protein;
FT                   Chorismate mutase; KEGG: dvm:DvMF_1749 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67418"
FT                   /db_xref="GOA:C8WZE3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE3"
FT                   /inference="protein motif:TFAM:TIGR01807"
FT                   /protein_id="ACV67418.1"
FT                   /translation="MGLNNQDEMTMTDTSTISLETLRDAIDGVDQELLHLLNRRAQLSL
FT                   QVGEAKSTTKGAIFKPFREKAVLERLSAHNPGPLPQDHLESIYREILSSSRALQRPQRV
FT                   VYLGPEGTFSYFAGVHALGGSAEFHDQPTLEDVFHAVSCGRAELGIIPLENSLQGTVGQ
FT                   SLDLFLMYEVFIQAEVFCRISHSLLSCNGDKGGITTVYSHPQALQQCGGWLRQHLPQAK
FT                   VVPVESTAAAAARVKNASEAAIGHSALAGLYQLQVVASHIEDLPENWTRFLVIGRGAPP
FT                   AGNRDKTSLLFSVPDKPGALAGVLNLLAREGVNMRKLESRPMRGERWKYVFFADLECDL
FT                   GREEYTQLLQALEANCHSFRVLGSYPNGQALDMGREE"
FT   gene            156078..157412
FT                   /locus_tag="Dret_0117"
FT   CDS_pept        156078..157412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0117"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: dma:DMR_05340 3-phosphoshikimate 1-
FT                   carboxyvinyltransferase; TIGRFAM: 3-phosphoshikimate 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67419"
FT                   /db_xref="GOA:C8WZE4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE4"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACV67419.1"
FT                   /translation="MYHVEVTVPASKSLSHRALICAGLALGVSRVENVLDSQDLDRTRA
FT                   CLEALGTQFEVEADGLVVRGRGGIGQVNQASLDVGESGTTCRLLTAVAAAGSGVFSLAG
FT                   QGRMHQRPIAPLASALHQLGCRFEWLEADGFLPCRVHSSGLKGGQTTVALDESSQFLSG
FT                   LLLASPLACDPLTIGIGGQRAVSWPYVALTLEVMRFFGQEPILEQAHGERWHSVPFESN
FT                   PSIEPSKTRFRCHPGVYSPQRYRVEGDWSNASYFVAAGAIGPRPVRLRGLYKDSRQGDR
FT                   VIVDIVKQFGAYVEWGRESLVVAPGPLQGQELDMGPCPDLVPTVAVMASLAEGPTVIKN
FT                   IAHLQLKESDRLNGVANELRKAGAEVTVEADTLTIIPCPLGTKPLRLSTYDDHRMAMAL
FT                   SLFQLAGLHLQLDNPGCVAKSFPRFWEQWDKVRQASEGTSERPGN"
FT   gene            157412..158200
FT                   /locus_tag="Dret_0118"
FT   CDS_pept        157412..158200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0118"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: dvm:DvMF_1747
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67420"
FT                   /db_xref="GOA:C8WZE5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE5"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACV67420.1"
FT                   /translation="MSAMSAIQTILFIGGNGAMARFLQPRLEEAGYAVRGVDKPLDGEQ
FT                   LRTAASGVDLVILAVPVPAVEEVLAKVVPFVPARAILADICSVKDAPLRHMLHYFSGDV
FT                   VGTHPLFGPAPDAATPLRTVLVPGRGANALERVRDVFERAGLVCFESTAEAHDRSVALL
FT                   QGLNFVTSVAYLACSADQEAVATFMTPSFTRRLEAAKKMLLEDSPLFTALFEANPYSQD
FT                   AVRQFRSYLNLAAAGDMDILVEKAAWWWRGASYEEECYEI"
FT   gene            158436..159857
FT                   /locus_tag="Dret_0119"
FT   CDS_pept        158436..159857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0119"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: dma:DMR_05320
FT                   anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67421"
FT                   /db_xref="GOA:C8WZE6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE6"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ACV67421.1"
FT                   /translation="MPQVVLQQQGRTLPADTQTPISLYQQMVGKKPGLLLESAEVDGRW
FT                   GRYSLVAWDFRLVASCHEGNLELTVKDARLEALRSYTGLPFEQGLRALLADLAVQPPEE
FT                   LADLPIFSRGVYGYLGYGLAGCFEPALADQLPPEKAEACLVLPAHVLLFDHLHHRCVQL
FT                   SLDDTFPKHGGGRQVGASLDAKPRLGQVETRPDKEQFCQSVRRIREDIHNGEAIQVVLS
FT                   TRFQASFSGEAFAVYRRLRQYNPSPYMYFLRLPGTTIVGSSPEVLVRCSEGRVEECPIA
FT                   GTRHRGTTREEDAALADELAADPKERAEHVMLVDLGRNDLGRIAAAGSVRVDRLMQVER
FT                   FSHVMHLTSYLEAELKTGLDAVDVLAATFPAGTVSGAPKIRAMETIAEHESQPRGPYAG
FT                   AVGWIGLDPDQVALDTGICIRTLWIQSGTIFWQAGAGIVADSDPEKEWQECQNKARILR
FT                   EVLQEEGESDVFAHR"
FT   gene            159838..160410
FT                   /locus_tag="Dret_0120"
FT   CDS_pept        159838..160410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0120"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   dma:DMR_05310 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67422"
FT                   /db_xref="GOA:C8WZE7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE7"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACV67422.1"
FT                   /translation="MFLLIDNFDSFTFNLVQAFQVLGADPVVLRNNRPELLELAASGEV
FT                   ERVVISPGPGGPADSGLCLPFLRSLAAATPVLGVCLGHQILAAHAGLVVGKGPRVMHGK
FT                   TSRIHHNGDPLFAGVSNPFEACRYHSLLVSGLEKSPAVTRTCQSEDGDLMGLRYTDRPW
FT                   MGVQFHPESVLTPDGQRLLANFLAVSS"
FT   gene            160436..161443
FT                   /locus_tag="Dret_0121"
FT   CDS_pept        160436..161443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0121"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: dvu:DVU0467 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67423"
FT                   /db_xref="GOA:C8WZE8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE8"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ACV67423.1"
FT                   /translation="MNAAVAMNTILDHVADGQDLAPEMARACFDHLFSGHCPPAQAGGL
FT                   LLALRAKGETGLELAAAVQAALQQARTVSGLTRPRIDTCGTGGDNKSSFNCSTVVALYL
FT                   ADMGYDVVKHGNRAVSSSCGSADVVEALGLPFAEQENDVHSGLARSRFVFLFAPHFHPA
FT                   FAKLGPIRKDLGVRTLFNLLGPLLNPARPTHQLLGVPRSQFMQPVADALALSGIQRAAV
FT                   VHGAGGYDELTPLGPNRCLVVDNGEVVRRDIDPAAFGIATCDEAALACRDKTEALEVVR
FT                   ALLQGRGPQAMQGMLALNLGVALFLLEPELSLDAAVARACEAVSRGISKEVACA"
FT   gene            161436..162254
FT                   /locus_tag="Dret_0122"
FT   CDS_pept        161436..162254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0122"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   dvl:Dvul_2469 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67424"
FT                   /db_xref="GOA:C8WZE9"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZE9"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ACV67424.1"
FT                   /translation="MLDRFIEAKKEELERLRLQEANGTLPAPLEIDRPSLKRQLQEAPS
FT                   VAVVAEYKRASPSKGIINPRLGAKEAAEAYAAGGAAAISVLTEKAHFHGSLAFLERAQV
FT                   AGLPLLRKDFLFHPLQIAESAATPAAAVLLIVRYFLETPGTLKTLVEQAQAYGLETVVE
FT                   VFSEAEIDLARQAGADIIQVNNRDLDTLQVDLDRSYALGKRKQAGEVWISASGINAPQH
FT                   CVALGERGFDAVLVGTWLMQHKEPAAALRYLRGVGPGMATAKSTPFFEQG"
FT   gene            162259..162912
FT                   /locus_tag="Dret_0123"
FT   CDS_pept        162259..162912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0123"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: dds:Ddes_1589 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67425"
FT                   /db_xref="GOA:C8WZF0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF0"
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /protein_id="ACV67425.1"
FT                   /translation="MADTLLIKVCGLKRQQDVELCGALGVDMVGFIFHEPSLRSIRPEQ
FT                   VAELPRGRFLRVGVVVRQRTAAITDIMHRAELDLVQFHGEQDHHDAAAIGPQRVIRVVW
FT                   PERFASKAALQAYLDAWADSCRYFLCDSGVAGGGHGRELQSAVALQQIVFPRPWLLAGG
FT                   IGAENVRKKITKFQPDGVDMNSGVENAPGEKNRGQLIAAVQTMRQSRSCVQLGE"
FT   gene            163151..164356
FT                   /locus_tag="Dret_0124"
FT   CDS_pept        163151..164356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0124"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: dma:DMR_05260 tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67426"
FT                   /db_xref="GOA:C8WZF1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF1"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ACV67426.1"
FT                   /translation="MNTKTEFPDAGYYDGFGGQFVPELLMPPLIELEEAMQSVLPSQAF
FT                   QEELAEVLQDYVGRPTPLYRCRNLSKRLGFDLWLKREDLAHTGAHKINNTIGQALLAKH
FT                   MGKRCLLAETGAGQHGVATATAAAMLGMECIVYMGAKDVQRQAHNVHRMRLLGAKVEAV
FT                   DSGTQTLKDAISATLRHWIRDQATAHYCIGSVVGPHPFPALVRDLQSVIGTETIAQCQK
FT                   KMGGLPDVVLACVGGGSNAMGMFHPFTDYPEVRLIGVEAAGSGEEGCTHSATLSQGTEG
FT                   VLQGARTYLLQTQAGQILPSHSVAPGLDYPGVGPEHVAFMTSGRAEYVCVCDDVALEAF
FT                   YTLSRDEGIIPALESSHALAYAMALQGEIPSGSRVVVTLSGRGDKDLGIVREREGAAET
FT                   KA"
FT   gene            164400..165167
FT                   /locus_tag="Dret_0125"
FT   CDS_pept        164400..165167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0125"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: dma:DMR_05250 tryptophan synthase alpha chain;
FT                   TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67427"
FT                   /db_xref="GOA:C8WZF2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF2"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ACV67427.1"
FT                   /translation="MHTSVLTEAVDKAHKAGRHALIPFLPAGFPDPERFWEVLRELDAQ
FT                   GADIIEIGVPFSDPVADGPLIEAVSLQCLADGVDLDWILDGLERMAGQLATPIVCMGYY
FT                   NPFWQYGMARFAERAAQAGVAGCIVPDLPLEEAGPFQEVLNAQGMDLIRMIGVNTSEER
FT                   MRAYAKNGSGFVYMVAALGITGTQAGFPPQLPQALSRAQDIFDDPIALGFGLERKEQLG
FT                   EIRDLVDAVVFGSSLIRHVQGGGEVRTFLQRWH"
FT   gene            165374..166030
FT                   /locus_tag="Dret_0126"
FT   CDS_pept        165374..166030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0126"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase; KEGG: CG9550 gene product
FT                   from transcript CG9550-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67428"
FT                   /db_xref="GOA:C8WZF3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF3"
FT                   /inference="protein motif:PFAM:PF00685"
FT                   /protein_id="ACV67428.1"
FT                   /translation="MRILIGYSMRSGSTLLQHMLGQHSAVRSTSDLSSWLMLSRLLTGL
FT                   GPKQGAVCVKPMDILFLEQWRLMSRFFDRFIWLVRDPRDAYLSSIESGYAYLLWPRGRR
FT                   MSGVDLGLVDRWQRIQRQYLKAPEKWHLVRYEDLVTRPEATMNSILEYLELPYERLDRF
FT                   ERFRLLNGGDYKICQSSGVRSSSVGRYRTKMPGPQRAVFQRLIGPEMDFFGYPSV"
FT   gene            166683..167459
FT                   /locus_tag="Dret_0127"
FT   CDS_pept        166683..167459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0127"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   spq:SPAB_02523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67429"
FT                   /db_xref="GOA:C8WZF4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF4"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ACV67429.1"
FT                   /translation="MFVLKKMVARLVFPLPLAFELLVAGLVILFGFRRWQRTGRWLVLA
FT                   GTAVLLVSTTPAVPQWAMRTLEGRFPAIDMTAAKAADAQWVVVLGGGHASDPGLPVSAK
FT                   VGTSTMYRLVEGVRIVRQLPGATLLLSGYAGKEAVSNARIKADLAKALGYEGPLVLEER
FT                   PRDTAQEAAMITERLGQAPFVLVTSASHMPRAMALFQGQGSHPIAAPTGHLAPREALQA
FT                   WDWFPNAQDAYCLQRAVYEYLGLGWAWLRGQLEQPV"
FT   gene            complement(167972..168925)
FT                   /locus_tag="Dret_0128"
FT   CDS_pept        complement(167972..168925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0128"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: pag:PLES_57731 putative
FT                   glycine betaine/L- proline ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67430"
FT                   /db_xref="GOA:C8WZF5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF5"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACV67430.1"
FT                   /translation="MSGFSKKVLVALIAFAVLTMSASQVLAAKEVRFASVSWTGVTTKT
FT                   ELAVRILRSLGYEASNTMVSVPIAFKALDTGEADIFLGNWMPTQATMANKYFDKGTIEP
FT                   LVASMPGAKYTLAVPTYAYEGGLQHFKDIAKYADKLGNKIYGIEEGNDGNQIIQSMIDK
FT                   DMFGLGDFQLIPSSEAGMLSQVQSFTKDERWIVFLGWAPHHMNEMIDMKYLDGSTSETF
FT                   GKNDGTATVYTIVRDGFVEENKNVAKFLKNLIFPISMMNQIMTTLHEKDGLKPVDAGLD
FT                   WVKAHPEVYKGWLEGVTTISGEPALPAFEQYLETVN"
FT   sig_peptide     complement(168842..168925)
FT                   /locus_tag="Dret_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 28"
FT   gene            complement(169059..170543)
FT                   /locus_tag="Dret_0129"
FT   CDS_pept        complement(169059..170543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0129"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: reu:Reut_B5835 aldehyde
FT                   dehydrogenase (acceptor)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67431"
FT                   /db_xref="GOA:C8WZF6"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF6"
FT                   /inference="protein motif:TFAM:TIGR01804"
FT                   /protein_id="ACV67431.1"
FT                   /translation="MMRTTPMYINSTWTEALSGDSREIYNPFDASVIARVPEGGRGDAH
FT                   KAIQAARRAFDTGQWPGQPAVERARLVFTLAEAIDRDREELARLESLDSGKTVEESRWD
FT                   MEEIAGIFRYYAGLADKEHGEVIASPFPQTTSKVVREPVGVCGLIAPWNYPLLQASWKI
FT                   APALAAGCTIVVKPSEITPLTTLKLAELCHEAGFPPGVVNVILGPGAEVGAQLAESPDV
FT                   DLISFTGGIATGKTIMRAAAGNVKKVALELGGKNPNIIFDDADFDLAVDYALNGVFFHA
FT                   GQICSAGARLLVQDAIHDRFVAALRDRMSRIVLGNGFDAQTEMGPVISQEHLDKVEHYV
FT                   ESACQEGASLLLGGQRPSAPELQNGYFFEPTLFSECTSDMRIVQEEVFGPVVTVERFTT
FT                   EQEAIDLANGTIYGLSAGFWTRDPDRMERVAQGLRAGTVWINDFNVYFVQAPWGGFKQS
FT                   GIGRELGRSGLEEYTEVKHIYHNYATRPVHWFGAAR"
FT   gene            complement(170552..172195)
FT                   /locus_tag="Dret_0130"
FT   CDS_pept        complement(170552..172195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0130"
FT                   /product="choline dehydrogenase"
FT                   /note="TIGRFAM: choline dehydrogenase; PFAM:
FT                   glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: dal:Dalk_0705 choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67432"
FT                   /db_xref="GOA:C8WZF7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF7"
FT                   /inference="protein motif:TFAM:TIGR01810"
FT                   /protein_id="ACV67432.1"
FT                   /translation="MAQKKYDYIIVGGGSAGSVLANRLSANPKNKVLVLEAGLPDYRLD
FT                   FRIHMPAALTYPLQGKTYNWWYESDPEPYMHNRRIYQPRGKVLGGSSCINGMIYIRGNA
FT                   MDYEKWASFEGLEDWDYARCLPYFNRAEYRLSGADAYQGVGGPLYLTTPECDNPLFEAF
FT                   FKAVQQAGHPVVDNVNGYRQEGFSKFDANIYRGRRWNAARAYVHPVKNRKNLDIRCRAM
FT                   STRILFEGKKAIGVEYKKGNTTHKVYGGEIISCGGAINSPQLLQLSGVGAGDHLRQLGI
FT                   DVVQDLPGVGENLQDHLELYVQWAAKKPVSMFPALKWYNQPKIGMEWLFANKGAAATNH
FT                   FEAGGFIRGNDQVDYPNLQFHFLPLAIRYDGTAPNEGHGFQLHVGPMNSDVRGRVKITS
FT                   ADPGDYPSILFNYLSTEQERREWVEAIRASRHIVEQSAFDELRGKELAPGSDAQTDEEI
FT                   LDFVAREGESAYHPSCTCKMGYDDMAVVDSDLRVHGVENLRVVDASIMPTITNGNIYAP
FT                   TMMLAEKAADKILGNTPPEPAQAPFYKTEV"
FT   gene            172603..173073
FT                   /locus_tag="Dret_0131"
FT   CDS_pept        172603..173073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0131"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: scl:sce5381 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67433"
FT                   /db_xref="GOA:C8WZF8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV67433.1"
FT                   /translation="MARFKVVPLENSPDYLVLRTAMRMKTALYRTLFGSGLRVSPEQWS
FT                   ILNRLWEKEGLCQSELAEKTSRDRHNMHRILGLMEKNGLIRREPDPLDSRRSNIFLTQR
FT                   GREIKEELVPLVEDFGDQVFAGLSDEEVRQLWRLHERIGSNLEILEKAQGGG"
FT   gene            complement(173216..173500)
FT                   /locus_tag="Dret_0132"
FT   CDS_pept        complement(173216..173500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67434"
FT                   /db_xref="GOA:C8WZF9"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67434.1"
FT                   /translation="MNKGVLWTVLGLLGLGILLAPFFDVFEAGLFAVDYFAAGQFACGV
FT                   FAAGTFSIGIFSAGIFSVGIFSAGIFSVGLWTAGIFLVGMFQRRLDRRR"
FT   gene            complement(173835..175046)
FT                   /locus_tag="Dret_0133"
FT   CDS_pept        complement(173835..175046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0133"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482; KEGG:
FT                   dma:DMR_08250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67435"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG0"
FT                   /inference="protein motif:PFAM:PF04339"
FT                   /protein_id="ACV67435.1"
FT                   /translation="MTAPSTLSLQWHKSMASIPREEWNRLSTPLQNPLLSWDWLHLLET
FT                   SGAVRTRTGWTPSHVTLWRERRLVAAAPLYLRHNSWGDYIFDQVWAEVAERIGLGYYPK
FT                   LVGACPFSPVPGYRFLLDPAENEQHLTTRILRSIHTMAVKRGISGCHFHFVDPEWKPLL
FT                   EHCDYLAWVQPGFLWHNDAFKSFEDFLSRFHRNQRRNIRRELRKPAELGIETRIVPADQ
FT                   APEQFFTRMYAMYRKTARQFGRWGCHFLTPQFFLELSQNKELCRNLLFTAGFERHGSGK
FT                   PIALSLLIRKGNTLLGRYWGCLKDYDALHFNLCYYLPIQWAIDHGIAFFDPGMGGEHKS
FT                   RRGFCAVANHSLHRFFPRPLMALFRQHIEAINRHQREGIATLNATAPYVFANSQRQWPV
FT                   EEKN"
FT   gene            complement(175287..176015)
FT                   /locus_tag="Dret_0134"
FT   CDS_pept        complement(175287..176015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0134"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; KEGG: dal:Dalk_5110 PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67436"
FT                   /db_xref="GOA:C8WZG1"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG1"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ACV67436.1"
FT                   /translation="MLQGMSLSSWHIDCHVHSSCYSPCSRLRPEQACRLASERGLGAIV
FT                   FTEHQIQWPQADLQILRSRSPGLAIYSGLELSLAEGFDIVCLLPEIDLQLPYGLSLDAL
FT                   EHALAPFGDEVFCFVAHPFRFLDRWDPDLDRMAPLLHGVEMNSVNILRGQACWEGDRLL
FT                   PCRHELYRQLADTGLVQMFNSDAHLAEAIGTVSTRISLAHQDIPADTGELAALFRQHPR
FT                   TYEHQNTNSLWPLVAGTAGI"
FT   gene            complement(176147..177172)
FT                   /locus_tag="Dret_0135"
FT   CDS_pept        complement(176147..177172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0135"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   dma:DMR_28310 cytochrome d ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67437"
FT                   /db_xref="GOA:C8WZG2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG2"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ACV67437.1"
FT                   /translation="MLETIWFVLWGVLWAVYFVLDGFDLGLGTIMPAVARTETEKRTLL
FT                   NAMGPFWDGNEVWLITAGGVTFAAFPTTYAVLFSGLYTALMLLLIALIIRGVALEFRSK
FT                   IESPRWRNIWEKAFIVSSFLPALLLGVAFANIFQGLAINAENIVQGGLLGLLNPYGLLG
FT                   GLLFVLLFALHGSLWLGIKARGELQERAARLARGLWPAVVTVLLAFLAFSATTTQLFGN
FT                   YLQTPWLMVVLILPILGLFGSRLFLGTRQWWLAWGASAATIAGTAMFGIIGNYPALLPS
FT                   KLNPAYSLTITNSSSSPLTLKIMLGVVLVFVPLVLGYQIWAYHLFRHPISEDDLSSDEA
FT                   Y"
FT   gene            complement(177350..178654)
FT                   /locus_tag="Dret_0136"
FT   CDS_pept        complement(177350..178654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0136"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: dde:Dde_3204 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67438"
FT                   /db_xref="GOA:C8WZG3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG3"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACV67438.1"
FT                   /translation="MDPLLLSRLQFAMATMFHFLFVPLTLGLSILVAIMETQYVRTQDE
FT                   KYKRMTKFWGKLFIINFVLGVVTGITLEFQFGTNWSRYSEYVGDIFGSILAIEATAAFF
FT                   LESTFLAVWIFGWKRVSQKVHLLSIWLVAFAGNMSALWIIIANGFMQNPVGYVMRNGRA
FT                   ELADFMAVVTQPFAWQQFIHTLAGSYILAGFFVMGISSYHLLRKQHIDFFTTSFRFGLI
FT                   MALLFSIVEVGQGHLHGAEVAKIQPAKLAAMESHWETQTHAPQYLFSIPDEKNERNLVN
FT                   FLPIPSGLSLLAYHRADAEVKGLKDFPKEDRPPVALTYWSFRVMIALGFLFPVLSIWAW
FT                   LRRKKLTESPWLLKTLIWAIPLPYIALEAGWMVAEVGRQPWIVHGLMRTSDAVSPVAGS
FT                   QVGFSLVALTLLYAVLGALCIYLLFYYARKGPSEA"
FT   gene            complement(178671..179384)
FT                   /locus_tag="Dret_0137"
FT   CDS_pept        complement(178671..179384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67439"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG4"
FT                   /inference="similar to AA sequence:KEGG:Dde_0372"
FT                   /protein_id="ACV67439.1"
FT                   /translation="MDTEFTCGRNAKRAVLSALGQDDPFAHFSRLLESFSAQQLVCPLF
FT                   GAVLQTDPNIRWHGVTAFGLLLPRLWDDSPERARVLLRRCIWNLNEESGGIGWGMPEAM
FT                   AEAMSAVPELADEFHKVFLSYIHEKEGPDNYIDHPPLRRGALWGVARFAQSRPDLASRA
FT                   CADLHHHLMTEQDTPCMGLTCLALSQLPECGLPEHLGDRLDALQQEPQTIELYWNRTLR
FT                   AVTVGELARQAVTTQ"
FT   gene            complement(179501..180706)
FT                   /locus_tag="Dret_0138"
FT   CDS_pept        complement(179501..180706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0138"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: sfu:Sfum_3253
FT                   flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67440"
FT                   /db_xref="GOA:C8WZG5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG5"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV67440.1"
FT                   /translation="MSVTELKKDIYWVGSVDWNLHNFHGYSQAHRGTTYNAYLVIDEKI
FT                   TLFDTVPAKYSGELMHQIRRLIDPEKIDYIVVNHVEPDHSGALPHIVDTIKPSKIFCSP
FT                   MGKQAIGEYFHRDDLPLEVVKNGASISLGKRSVEFMEARMLHWPDSMFSFIPEDKLLIP
FT                   NDAFGQNWAGSERFDDEVDLSMLLREAAHYYANIILPFSPLVQKVLGKIQKAGWDIDMI
FT                   APDHGLIWRSHAKEIIEAYDRFSKQEPQQKAVIVYDTMWHSTEQMAKAIGDALIEEGVP
FT                   TRLMHLKAYHHSDVMLEAWDAAAIIYGSPTHNNGIMPLVSDMATYMKGLRPANKIGAAF
FT                   GSYGWSGESVKHLTELLEGMGFELPVDGVRSKFRPNHDELAQCKEMGRQLAAAIKEKVN
FT                   AS"
FT   gene            complement(180980..181141)
FT                   /locus_tag="Dret_0139"
FT   CDS_pept        complement(180980..181141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0139"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   sfu:Sfum_3222 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67441"
FT                   /db_xref="GOA:C8WZG6"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG6"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ACV67441.1"
FT                   /translation="MQRWVCTVCGYVYDPQEGDPDNDIAAGTAFEDLPEDWVCPVCGAG
FT                   KEDFEKED"
FT   gene            complement(181333..181713)
FT                   /locus_tag="Dret_0140"
FT   CDS_pept        complement(181333..181713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0140"
FT                   /product="desulfoferrodoxin"
FT                   /note="TIGRFAM: desulfoferrodoxin; PFAM: Desulfoferrodoxin
FT                   ferrous iron-binding region; Desulfoferrodoxin Dfx domain
FT                   protein; KEGG: dma:DMR_17610 desulfoferrodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67442"
FT                   /db_xref="GOA:C8WZG7"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="InterPro:IPR004793"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="InterPro:IPR038094"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG7"
FT                   /inference="protein motif:TFAM:TIGR00320"
FT                   /protein_id="ACV67442.1"
FT                   /translation="MPEQLQVYKCEQCGNIVEVLHGGAGDLVCCGENMKLIEAGTVDAA
FT                   KEKHVPVIEKTDKGYKVSVGSVPHPMEEKHYIEWIELIADGKAYRQFLKPGQTPEAEFC
FT                   IEAKAVTAREYCNIHGLWKAEA"
FT   gene            complement(181968..182369)
FT                   /locus_tag="Dret_0141"
FT   CDS_pept        complement(181968..182369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0141"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: dps:DP2867
FT                   ferric uptake regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67443"
FT                   /db_xref="GOA:C8WZG8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG8"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV67443.1"
FT                   /translation="MTHIPELRMTRQRQVILDELRSVTTHPTADEVYDMVRKILPRISL
FT                   GTVYRNLELMHEAGMVMKLETAGMQKRFDGNPAPHYHIRCINCGIVRDLELEDKGHDLE
FT                   STLKTDFKVLGHRLEFYGLCPACQSPVEH"
FT   gene            complement(182491..184302)
FT                   /locus_tag="Dret_0142"
FT   CDS_pept        complement(182491..184302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0142"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: dde:Dde_1370 N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: cell wall hydrolase/autolysin; SMART: cell
FT                   wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67444"
FT                   /db_xref="GOA:C8WZG9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZG9"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ACV67444.1"
FT                   /translation="MPLPDEITDSYGNTHTSELFRAVTMRTLLPRTCIALLLGALLFGG
FT                   LSGLPDNRAVAATSTQLFQHGWKSFHSLRKNAERARFRSSWMQVKNTFWELYQRNPNGG
FT                   YAPKALYYLGRVYSELGQRSYLRKDFRQATDYYQRVVTRFPRHSWSDDAQLRKARIHLE
FT                   HLGEKNQAYLDLLSVVHNYPDGDMYAKARSLLDQLDRKKEAAPASAQKAPQPSPKKQSP
FT                   KPQKASAAAGMEKLLRIRHWSSDDYTRVVLDVSGEAEFSKKLLKPDPKLNTPHRLVVDL
FT                   QKTRLADKCEEAHKIRDGLLRRVRTGQYRHDTARVVLDIEKLDKYRVFSLQNPYRVVLD
FT                   VYAPEGGRSKSAPQVAGYQFDAKSKKYTSSLVEQLGLTIQTVMIDPGHGGKDPGAVHGD
FT                   IYEKDINLSVAKTLGAKLKKQGFDVLYTRTKDVFVPLEERTALANSKKADLFISLHVNS
FT                   HRKANVQGFELYSLNLAKSKDAVRVAARENAVSVKKISDLQVILTDLMLNTKIKESKQL
FT                   AKSLHAKTLAHSRQFYSVRDHGVREAPFYVLMGAKMPAVLVEMGYLSNPTERKRLLTAK
FT                   FQQRIAQGLVQGITAYKQTIDNYARLE"
FT   gene            complement(184324..186147)
FT                   /locus_tag="Dret_0143"
FT   CDS_pept        complement(184324..186147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0143"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; KEGG: dde:Dde_0502
FT                   glutamine--fructose-6-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67445"
FT                   /db_xref="GOA:C8WZH0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH0"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACV67445.1"
FT                   /translation="MCGIIGYAGHRPAVPLLVEGLRRLEYRGYDSAGVAYLQNKGLQVV
FT                   RAEGKLKNLEHCLTECQHLQATCGLGHTRWATHGLPTTQNAHPHQDEGQNIALVHNGII
FT                   ENFQELKQSLEAKGHHFASQTDTEVIVHLLADNLGHQNTLPKALAATLHQIEGSYALAC
FT                   IHRDYPNEIWAARHSSPLLLGVGQGENFIASDIPAFLSSTRDVVFLEDGEVVRLTPNSW
FT                   EVFSAADMQPVGKTPQRIEWDLQAAQKGGFKHFMLKEIMEQPQVIQDGIAGRIDDATQE
FT                   VVLDEIADLPIPGRLHIIACGTSFHAGLWAKYLIEEWARIPVQVEVASEFRYRQQVFQE
FT                   GDLALAISQSGETADTLAGMRIARENNLPIVGLCNVVGSSVARESDGTMYTQAGPEISV
FT                   ASTKAMCSQMVALLLLAIAWGRKKGTLSAEAAQQLTGQLQRLPHTLSTELERMRHAAQR
FT                   LATQFSKARSFFFLGRGLGSPLALEGALKLKEISYIHAEGYAAGEMKHGPIALIDSEFP
FT                   TFALAPQDSLLPKVGSNLQEVQARGGKIIALTHPGTDIPSDERWEVPQMGSALDSFLFL
FT                   PALQLFAYEMAVYLGKDVDQPRNLAKSVTVE"
FT   gene            complement(186159..186788)
FT                   /locus_tag="Dret_0144"
FT   CDS_pept        complement(186159..186788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0144"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /EC_number="3.6.1.15"
FT                   /note="KEGG: dvm:DvMF_1699 non-canonical purine NTP
FT                   pyrophosphatase, RdgB/HAM1 family; TIGRFAM: non-canonical
FT                   purine NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67446"
FT                   /db_xref="GOA:C8WZH1"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH1"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ACV67446.1"
FT                   /translation="MTEIVLATGNAGKIKELQAMFAASGQSLTILGLDAFPDIGPLSET
FT                   GTTFEANALEKARAVAVATQRIAIADDSGLEVDALDGAPGVHSARYSGPGANDSRNNAK
FT                   LLEALADIPAEKRTARFRCVLAAVAPNGAELTVDGSWEGVIAEKPAGDNGFGYDPLFFD
FT                   PECGCTSAQLPPAEKNSRSHRGKALQALAGQWSRFAARAASPKTSE"
FT   gene            complement(186886..189273)
FT                   /locus_tag="Dret_0145"
FT   CDS_pept        complement(186886..189273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0145"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   dvm:DvMF_2529 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67447"
FT                   /db_xref="GOA:C8WZH2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH2"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACV67447.1"
FT                   /translation="MPQSPFSEKLPSVATLLSLVFLTLLLPLPGRAQPEEPDTETQRWE
FT                   ALLANKQEEVSDLGEQLDQIQSTYEANTAEAQKQIEALTDELNRLTALKGLSAHNPRET
FT                   LGLRNTIQSLTTQLNSDTMPLREAQSRLETIAHELDVRQKELQETTPPTPQGQKTLVNY
FT                   QKDLKNLQRRANTLETRIQKSLAPALELEKELNATVTALDKTLSSVWRQYFFEPSPTLL
FT                   AFQDPGSMQPLTRWMKYLPTYTRVVLLGDIDWFALGSVVLVFFALSMLPIHLWILPALE
FT                   KSSLQLTMREMAPPLYWVALGLALMVSTTILPSGQGCLVRSFTQLFLSWGIMLALWPLR
FT                   QYQLGENAPRRNHIRLLWTLYAIAVILQDINLPPLFLGPLWAGVLVMGAIWSKKRCTPD
FT                   KPKLERSIFGASIPFFILLIIGSLTGYVHFTLFLTAAWFVFWLAVQIGTGMAALLRSWS
FT                   AQTSPALLENLLKGVAQGVGYPLVWLGALSLLIGWLGYSLGGYPFLNELLQLKVGWGKV
FT                   SFNFMRILGVVIGFYIARSGLIILRSLFDNVIRKQDHWEKGTAESLQTIISYAVWGLFA
FT                   LAAMYFLGFNFTSLAVIAGGLSVGIGFGLQSIINNFVSGLILLFGRSIQPGDIVDLSGT
FT                   WGQIKRVNIRTTVVQTFDNSTIFVPNAELIGGRITNWTHKDISLRRRIDVGVAYGSDTE
FT                   KVKRLLLEQARKHPQVFRYPEPFVRFANFGNSTLDFILYFWSDINNGWHAESDLRFQID
FT                   QAFRENGVEIAFPQQDLHIRSAAGLDPYLARPASATGNTSET"
FT   sig_peptide     complement(189175..189273)
FT                   /locus_tag="Dret_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.989 at
FT                   residue 33"
FT   gene            189631..190947
FT                   /locus_tag="Dret_0146"
FT   CDS_pept        189631..190947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0146"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="KEGG: dvl:Dvul_0234 MiaB-like tRNA modifying enzyme
FT                   YliG; TIGRFAM: MiaB-like tRNA modifying enzyme YliG; RNA
FT                   modification enzyme, MiaB family; PFAM: Protein of unknown
FT                   function UPF0004 ; Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67448"
FT                   /db_xref="GOA:C8WZH3"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH3"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ACV67448.1"
FT                   /translation="MAIHDPLRVFTISLGCPKNRVDTEFLLGALGGAYAPAQDITSADV
FT                   VLINTCAFIEPAVEESVQQILEVADDISDLVPRPLLAVTGCLVARYGQDLKAGLPEVDL
FT                   WLPLAEQDQWGERLAQALGRSFPGGRERILTTGPASAYLKISEGCDHACRFCIIPQLRG
FT                   PLQSRPVEELVREAGSLVDQGARELVLVAQDVSNYGQDLGMRQGLQRLVEALSAVPGLD
FT                   WIRLLYLYPVGVTTELLRFLRDSAPLVVPSFDIPLQHAHPDILTQMGRPFARDPYRVIA
FT                   TVRDVLPQAALRTSLIVGYPGEKEAHFAYLRQFVQEVRFHNLGVFPYYAEEGTPAATLP
FT                   DQVPEAVKNDRREQIMGDQAQISETILESCQGTTMDVLVERPDPHWPTLFQGRVWFQAP
FT                   EVDGVTYVSGHSLQAGQLVHAEIEESKTYDLVALVPEEK"
FT   gene            191085..192812
FT                   /locus_tag="Dret_0147"
FT   CDS_pept        191085..192812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0147"
FT                   /product="ribosomal protein S1"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: dds:Ddes_2333 ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67449"
FT                   /db_xref="GOA:C8WZH4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH4"
FT                   /inference="protein motif:TFAM:TIGR00717"
FT                   /protein_id="ACV67449.1"
FT                   /translation="MSTNIPAEAETENEEMSFEAALEDYLQPDFGEVEDGSIARGEIVR
FT                   IGDESVLVDVNFKSEGEIPIAEFQDSEGNLKVSVGDKVDVFVVHKDELEGTIRLSYERA
FT                   KRMKVLDDLDEKMQNEENVTGRIIRRIKGGYVVEVHGVEAFLPGSHVDLRPVPDMDALV
FT                   GQDFEFRILKINRRRSNVIVSRRVLLEEERESKRQELLKTLEEDQVVHGKVKNITEYGV
FT                   FVDLGGLDGLLHITDMAWKRIRHPKEMVQLGDDLELKVLNFDQESEKVSLGLKQLVPDP
FT                   WVDIANKFPEGEKFSGKVTNIVDYGAFVELEPGVEGLVHISEMSWTRKLRHPSQVCQVG
FT                   DEVDVVILGVDSDRKRISLGMKQVRPNPWDVVSEKYPEGTVLEAPIKNITDFGMFIGIE
FT                   DGIDGLIHVSDISWTKKIRHPNELYQVGDVVQAKVLTVDKENEKFTLGIKQLSEDPWSQ
FT                   IPARYPVGTNVEGKVTNITDFGLFVEVEEGIEGLVHLSELSRKKIKTPSEHFEEGQEVS
FT                   AKVIHVSGDERRLGLSIKQFEEEEEQQRNRELKNQPGAATPSGNNLGDLIRQKLEDSE"
FT   gene            192805..193695
FT                   /locus_tag="Dret_0148"
FT   CDS_pept        192805..193695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0148"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: dvm:DvMF_1703 signal peptide
FT                   peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67450"
FT                   /db_xref="GOA:C8WZH5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH5"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACV67450.1"
FT                   /translation="MNKTPNFSQRHPFLFGFMLIAAAVALFMGAMAAFSYWSGQGGGWG
FT                   QPQIGVVHVRGVLTNARPVTHWIETLRQKNRVKGVLVRINSPGGVVAPSQEVYSAVSSL
FT                   AEDKPVVVSMGSVAASGGYYVAVGAPTIFANPGTITGSIGVKAQLKNFKGLLDKLGIED
FT                   ETVVSGPLKDATSAAKPMTEAERKYMQGMVDDMHAQFVQAIAKGRDMDLEVVRRLADGR
FT                   AYTGRQAKDLGLVDALGSMQDALDVLRHKAQVGTDYALVEGPERERSLWQWLLSTVSIQ
FT                   WPDMTGEPHWEFRYE"
FT   sig_peptide     192805..192912
FT                   /locus_tag="Dret_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.558 at
FT                   residue 36"
FT   gene            193688..194764
FT                   /locus_tag="Dret_0149"
FT   CDS_pept        193688..194764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0149"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dma:DMR_08720 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67451"
FT                   /db_xref="GOA:C8WZH6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV67451.1"
FT                   /translation="MSDILDALRERIEHGGRLSRREAVELVQEATVHDLGELGLLARER
FT                   RHGRQAYYVYNQHLNYTNICENRCRFCAYSKRRGEKGGFTYSAAQARARLEERQDAPIR
FT                   EVHIVGGLNPALPYEYYLELIRTVKQARPGARVKAFTAVEIAFLADTYGKSQTTVLEEL
FT                   MAAGLDALPGGGAEVFDPQLRQKLCPEKVSGQRWLDIHRIAHGLGLPTNATMLFGHIEG
FT                   WEERLDHLEALRELQDETGGFLCFIPLPYQPKNNRLGGVGPDGQDYLRMIALSRLFLDN
FT                   VSHLKAYWVMAGIKPAQLALWAGADDFDGTLVEERIGHAAGAEAPAGMTVPQLEQAIAA
FT                   AGFSAVERDTFFQPVATA"
FT   gene            194878..195030
FT                   /locus_tag="Dret_0150"
FT   CDS_pept        194878..195030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67452"
FT                   /db_xref="GOA:C8WZH7"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67452.1"
FT                   /translation="MDVLGTLFSNMGESTVPGMFGVGGILVYFVVIVGAALFRIKEIYQ
FT                   EEEHH"
FT   gene            195260..195442
FT                   /locus_tag="Dret_0151"
FT   CDS_pept        195260..195442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67453"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67453.1"
FT                   /translation="MPGKESIIFKALYLYGKHGRICGGHKREGGCALPGEVCPPAMCYR
FT                   RREASGRAGRSQPSA"
FT   gene            195505..196905
FT                   /locus_tag="Dret_0152"
FT   CDS_pept        195505..196905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0152"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: sfu:Sfum_3200 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67454"
FT                   /db_xref="GOA:C8WZH9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZH9"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ACV67454.1"
FT                   /translation="MTNGAAEGRAGTPVATPEGRGRNPREYGSGASSVTATKEYSHPEQ
FT                   QSLMEAVVGRENMLAAYKRVRANKGVPGVDGMSVNDVWGYCTLNWARIKEELLDGRYEP
FT                   QPVLGVEIPKPGGGVRQLGIPTALDRLIQQALHQVLSPIFNPHFSESSYGFRPGRSAHQ
FT                   AVLKAREHAAAGKRWVVDMDLEKFFDRVNHDVLMARVARKVKDKRVLVLIRRYLQAGLM
FT                   QGGIASKRKEGTPQGGPLSPLLSNILLDDLDKELERRGHAFCRYADDCNIYVQTKRSGE
FT                   RAMASITRFLTERLKLRVNADKSAVDRPWKRKFLGYSMTWHTQPRLKVAPSVVKRLKQA
FT                   VREEFRRGRGRSLKKTIDTLAPKLRGWMNYFKLAEVKGVFEELDMWIRRRLRNILWRHW
FT                   KRPYARARNLIRRGLTEERAWKSAINGRGPWWNSGASHMNQAFPKKYFDSLGLVSLQDQ
FT                   LRKAQSVR"
FT   gene            complement(197120..198196)
FT                   /locus_tag="Dret_0153"
FT   CDS_pept        complement(197120..198196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0153"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: dma:DMR_39140 glucose
FT                   1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67455"
FT                   /db_xref="GOA:C8WZI0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI0"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ACV67455.1"
FT                   /translation="MRNCAGRQSHLSRCALVLQAISRSHEKTPERSLLLPFPALQANNA
FT                   HVLTASLASVLENGVSMKGIILAGGSGTRLYPLTWGVSKQLLPIYDKPMIYYPLSVLML
FT                   AGIREILIISTPQDIPRFERLLGSGEQIGLRLTYKTQPEPEGLPQAFVLGREFIGDDSV
FT                   CLVLGDNLLYGEGLSRILQRCAALEQGGIVFGYPVRDPRQYGVVEFDAHGRATRIVEKP
FT                   EKPRSKYAVPGIYFYDNTVTEIAAQLRPSSRGELEITDINTAYLQAGTLHVEVLGRGYA
FT                   WLDAGTHESLHQAASFVQAIQERQGFKLGCIEEIALRKGYITPDQVRELAAPMAKNDYG
FT                   AYLLQLVEELHTYGQPAS"
FT   gene            complement(198245..198436)
FT                   /locus_tag="Dret_0154"
FT   CDS_pept        complement(198245..198436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0154"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_2933 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67456"
FT                   /db_xref="GOA:C8WZI1"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI1"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67456.1"
FT                   /translation="MSKVVIDHDECIGCESCVEICPEVFAMDEDEGKAYVIKEEGGPED
FT                   QIQEAIDSCPSECISWED"
FT   gene            199079..199570
FT                   /locus_tag="Dret_0155"
FT   CDS_pept        199079..199570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_2118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67457"
FT                   /db_xref="InterPro:IPR024755"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI2"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_2118"
FT                   /protein_id="ACV67457.1"
FT                   /translation="MRYLRIISGGQTGIDRAALDWALENDVPCGGWVPRGRWAEDGPVP
FT                   TRYPLQETEVVDPAVRTARNVRDSDGTLVLYVGKPCGGTELTIHFARCDTWPGGPRAMC
FT                   CVSLDREQWTAAVSRVVHWMRTNCICTLNVAGPRESEAPGIEVMGRQFLDLCLEPGSAS
FT                   "
FT   gene            199625..200317
FT                   /locus_tag="Dret_0156"
FT   CDS_pept        199625..200317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0156"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   dvm:DvMF_1205 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67458"
FT                   /db_xref="GOA:C8WZI3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACV67458.1"
FT                   /translation="MDFTVTPARKPKVYEEVVRQIEELIASGALRDGDRLPPERELAQL
FT                   FKVSRNSVREAVFALENRGLVVSKVGAGTFVRGAEQDLIDPLARAIEQQRQRLHEIFEF
FT                   RLLLEPQIIGLAALHVSGEQLQELEALVAAQEARIAEGLPWGDLDSRFHRLIVQASGNQ
FT                   VLCKVFQQLDAILDEVRDETLQTASRARESLATHQRIVEALRRGDPEAASREMEDHLIG
FT                   VEEAKDRS"
FT   gene            200440..201450
FT                   /locus_tag="Dret_0157"
FT   CDS_pept        200440..201450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0157"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: dat:HRM2_12470 LldD"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67459"
FT                   /db_xref="GOA:C8WZI4"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI4"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ACV67459.1"
FT                   /translation="MKEIKDTARELMKGYCRVCRVCDGKACAGEVPGMGGLGTGSAFQS
FT                   NVTALAEKQFNMRLLHEVTEPDTSVEMLGQTLDIPVLAAPIGGVSFNMGGGVSEGEYIR
FT                   AVVNGCKAEGTLGCVGDGVPPFIHEEGYAAIAEAGGAGIPFIKPWEDEELYEKMRKAAD
FT                   AGASIVGMDVDAAGLITLRKMGRPVSPKPAHELRKIRETTSMRFIIKGVMTPDEAKLAV
FT                   EAGADGIVVSNHGGRVLDHTPGVAEILAGVADAVQGQTAILADGGVRTGGDVLKMLALG
FT                   AEAVMVGRPISIAAVGGLEDGVRAALQQMRTELKQAMVLTGTARASAVQPQILHS"
FT   gene            201464..202261
FT                   /locus_tag="Dret_0158"
FT   CDS_pept        201464..202261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0158"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   dvl:Dvul_0529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67460"
FT                   /db_xref="GOA:C8WZI5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI5"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACV67460.1"
FT                   /translation="MITAFVMYIALGAFAGVLAGLLGIGGGLVIVPMLTFMFTAQGLPD
FT                   AYILHLALGTSLATILFTSISSLRAHNQHGAVKWPVFWRIAPGIIFGTFLGSWIAAQLS
FT                   TDFLKGFFACFLFYVGIRMLRGSKPKPSRQLPGTLGIFGAGSGIGVFSSLVGIGGGTLS
FT                   VPFLVWCNVTMHKAIGTAAAIGFPIAVAGSLGYLVNGLGTEVLPWYCLGFIHIPALLGI
FT                   ILASVLTAPVGARLAHKLPVARLKKIFAVLLLFVGLRMLWTLF"
FT   sig_peptide     201464..201523
FT                   /locus_tag="Dret_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.588 at
FT                   residue 20"
FT   gene            complement(202804..203313)
FT                   /locus_tag="Dret_0159"
FT   CDS_pept        complement(202804..203313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0159"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cvi:CV_1731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67461"
FT                   /db_xref="GOA:C8WZI6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV67461.1"
FT                   /translation="MPHIHCVQSAADIARVAALAHEIWHEHYTPIIGPAQVEYMVPKFQ
FT                   SREAIAAQIDTGARYDLVYEKGQAVGYIGVVPDTAAGELFLSKIYIRRDRRGCGLGRFA
FT                   LDHVESVCRELGTPYIWLTVNKNNHASIRAYEKMGFSHRREICQDIGHGFVMDDYLLDK
FT                   TLPSAP"
FT   gene            complement(203491..204273)
FT                   /locus_tag="Dret_0160"
FT   CDS_pept        complement(203491..204273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0160"
FT                   /product="anaerobic cobalt chelatase"
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG:
FT                   dvl:Dvul_1703 anaerobic cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67462"
FT                   /db_xref="GOA:C8WZI7"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI7"
FT                   /inference="protein motif:PFAM:PF06180"
FT                   /protein_id="ACV67462.1"
FT                   /translation="MTASIAIVCTTFGTASQRGLETLRTYQEAVQDRFPQADIHWAFLS
FT                   KRMRSLRRNAGGSVDSLPAVLTRLSQEATTRIIVHPLQVIPGKEYGTIRQTVRALAHLP
FT                   EKPDCHVTAPLLWEPASVARLGEALLAEDGAPGLENQLVYMAHGSPEPGHALYVALAHW
FT                   LAWRQPRILLGSMEYWPTLDDLLQRLDPGTPQLRLIPLLTLIGTHAQRDLAGEEPTSWR
FT                   SRLTAAGFAPQAELRGLLEKPAVTRLWLERLAEVVTNG"
FT   gene            complement(204270..205025)
FT                   /locus_tag="Dret_0161"
FT   CDS_pept        complement(204270..205025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0161"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_1193 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67463"
FT                   /db_xref="GOA:C8WZI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV67463.1"
FT                   /translation="MADMSAPSPLVRLQDIRFGFPGHTTPLFNDLEFSLPAQERIGLIG
FT                   PNGSGKTTLLRVIMGLLAPQHGNVFFSGSPIHTREDWRTLRQHIGFVFQDSDDQLFCPT
FT                   VLEDVAFGPRNLGLSREHARTRALETLADLELTALAEAMTHTLSGGQKKLVALATVLAM
FT                   RPQALLLDEPTNDLDHDARNRLIDILERLDTALLIVSHDWDFLDQTTSRLCELHAGQLE
FT                   CNGNVTLHSHVHAHVRGGVPHKHGDSSPS"
FT   gene            complement(205018..205776)
FT                   /locus_tag="Dret_0162"
FT   CDS_pept        complement(205018..205776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0162"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   dvl:Dvul_1937 cobalt ABC transporter, inner membrane
FT                   subunit CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67464"
FT                   /db_xref="GOA:C8WZI9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZI9"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ACV67464.1"
FT                   /translation="MLQETLHHGHSFFHRRDPRAKILSAAAVAWAIALCQSFPPLILAT
FT                   GGAATALFAAQLPWRDLAKRFAAVNLFLLFLWMVLPWTYGQEHIWAPHTWQLSSDGLLL
FT                   CLAITLKANAITGFLVVLLATSSIPEIGRGLHQLRLPDKLVFLLLFTYRYIHVIAEEWQ
FT                   RLFRAAQLRGFSPGTNRRTYTTLGHMLSQVFVRSFDRSQRIYQAMLLRGFTGRFHPLTA
FT                   SLMRPADWILALSCIALAGGLVGWEVLLRG"
FT   gene            205967..207106
FT                   /locus_tag="Dret_0163"
FT   CDS_pept        205967..207106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0163"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: dde:Dde_2559 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67465"
FT                   /db_xref="GOA:C8WZJ0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ0"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ACV67465.1"
FT                   /translation="MGKRFARKVGLLGMVVGLLMATVTASAAASPSLEAMVGQMLMIGF
FT                   RGTTFEAKSPLGEAITEGNLGGVVLYGRDVALNKPMRNIRSAAQLQALTADLQDHARIP
FT                   LFIAVDEEGGQVSRLAPRFGFPETVTAATWGRRNDPAWTRRGARAIGQRLRNLGCTINL
FT                   APVVDLNTNPDNPAIGKLERSFGANPDTVTRQAAAFIHGLHDAGILACIKHFPGHGSAY
FT                   NDSHLGLTDISTTWSPKELEPYKRLVDRGLADAVMTAHVFHAGLDPKVPATLSAEIIPD
FT                   ILRREIGYEGVVISDDLQMGAIRQSFSLRQTVRRCLEADVDIFLFGNNLEYEPFVWRRV
FT                   QRIVRDLVDQNIVSRSRIERSYERIQRLKERMDLFQGRS"
FT   sig_peptide     205967..206050
FT                   /locus_tag="Dret_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.751 at
FT                   residue 28"
FT   gene            207223..208188
FT                   /locus_tag="Dret_0164"
FT   CDS_pept        207223..208188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: Twin-arginine translocation pathway, signal
FT                   sequence; KEGG: dma:DMR_38630 iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67466"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ1"
FT                   /inference="protein motif:PFAM:PF10518"
FT                   /protein_id="ACV67466.1"
FT                   /translation="MPTKLSRRNFLKSLGLGATAAVMPSTFAAAARGEELATLLDLSKC
FT                   VGCENCVYACKEVNQDKFPEPEKPFPTMYPSRVPVQDWSDKREVKDRLTPYNWLYIQTA
FT                   YVDYGGQSWEIHVPRRCLHCQNPPCANLCPWGAARKQDNGIVRIDEAICLGGSKCNKVC
FT                   PWHIPQRQTGVGLYLDLLPSLAGNGVMYKCDRCFDRIAEGKVPACIEACPFDVQTIGPR
FT                   SEIVAEAHRLAEKMPGFIYGEHENGGTNTLYVSPVPFDRLNAAVQQGAGQPDLEPHPDM
FT                   LSSETNLAKAMLIAPVAGLAAGALHAVRLVQNETKEDTDD"
FT   sig_peptide     207223..207309
FT                   /locus_tag="Dret_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.558 at
FT                   residue 29"
FT   gene            208181..208642
FT                   /locus_tag="Dret_0165"
FT   CDS_pept        208181..208642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0165"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="KEGG: dde:Dde_0656 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67467"
FT                   /db_xref="GOA:C8WZJ2"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ2"
FT                   /inference="similar to AA sequence:KEGG:Dde_0656"
FT                   /protein_id="ACV67467.1"
FT                   /translation="MTDPRVSFWYRLGVKLLVAVLAVSGFAQMPIFKRYYIADIPGLGW
FT                   LAQFYTTHIVHYVAAAIFLALVGYVLARYFLQWKRDFRLRSSAWPRIFLFAVIIGTGAL
FT                   RVAKNLPDVHFDPTTTMLLDWVHLFAVIILGLVALPIWIVRRSGYLQPR"
FT   gene            complement(209038..209679)
FT                   /locus_tag="Dret_0166"
FT   CDS_pept        complement(209038..209679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0166"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: dvl:Dvul_0241
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67468"
FT                   /db_xref="GOA:C8WZJ3"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ3"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACV67468.1"
FT                   /translation="MNNERPQKMYLYARFERFWHWAQALLILILLVTGFEIHGTYTLLG
FT                   FERAFTVHNFCAWTWLVLYAFIVFWMITTGEWRQYTPTYKKVLEVAWYYAFGIFQGKPH
FT                   PVPKTKRTKHNPLQRLTYLGIVSVLVPFQLITGYLYYFYNSWDQLGLDWGLSGVAILHT
FT                   IGGFAMLVFVITHIYMTTTGHTVLAHTKAMITGWEEVHDPASVGEWEYKK"
FT   gene            complement(209672..211345)
FT                   /locus_tag="Dret_0167"
FT   CDS_pept        complement(209672..211345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:210983..210985,aa:Sec)
FT                   /locus_tag="Dret_0167"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: dvl:Dvul_0242 cytochrome c family protein;
FT                   Contains selenocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67469"
FT                   /db_xref="GOA:C8WZJ4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ4"
FT                   /inference="similar to AA sequence:KEGG:Dvul_0242"
FT                   /protein_id="ACV67469.1"
FT                   /translation="MHFNRPAPLRVAWLGLAVLLLWSTTGLAAVEDQQQSVDKDYGAAE
FT                   ARKVVEAPKRWITADHSKHKILQKDFESGPEVTEACLTCHNEAALQFHETIHWTWICPA
FT                   DPNKEMGKNGVSMNNFUMSIKSNEARCTSCHAGYGWEDKNFDFTSEKNVDCLVCHEQTG
FT                   TYKKFPTGAGHPVSEPKKFGGKMFYPPNWNKVAQSVGRPDRKNCGTCHFYGGGGDGVKH
FT                   GDLDSSLYNPSQQLDVHMSEEGGDFTCVRCHTTEAHSIAGRCYKKPAYEERKSLIDDDQ
FT                   IKRISCVSCHTTTPHKPGHKANDHTDMVACQSCHIPEFARVNPTKMWWDWSKAGRLNEK
FT                   GKPILTEGKYGKHSYHGKKGEFRWEKNVVPEYDWFNGSLEYQLFTEKFDPANAPIELNK
FT                   VQGSREDPRALIYPFKIHRAKQPYDTKLNKFVNVHLFGKDKNAYWKSYDWQRAITAGMD
FT                   YMGLPYSGEFDFIETEYHFPITHMVAPKEDSLACNQCHADNARLAQLTGFYMPGRDKNV
FT                   LVDTIGWLAVIGSLGGVGIHAALRRRFAKKRQTNGGAGHE"
FT   sig_peptide     complement(211259..211345)
FT                   /locus_tag="Dret_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.903 at
FT                   residue 29"
FT   gene            211703..213091
FT                   /locus_tag="Dret_0168"
FT   CDS_pept        211703..213091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0168"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: dvm:DvMF_1692 PAS modulated sigma54 specific
FT                   transcriptional regulator, fis family; TIGRFAM: PAS sensor
FT                   protein; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; helix-turn-helix Fis-type; PAS
FT                   fold domain protein; PAS fold-4 domain protein; SMART: AAA
FT                   ATPase; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67470"
FT                   /db_xref="GOA:C8WZJ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67470.1"
FT                   /translation="MTLPLPQSHPFFEDVVNTMQEGLLIVAPDGTIQMVNEALTHILGY
FT                   EREELLGRSCAVLQCDQCQAARGQGGAHWCRLFAQGLERKRRCTVRRKDGHLVPVLKSA
FT                   SLLRHNQEVVGAVETVTDISLLDRHETAIKDLERALDREFCGMVGTAPAMRHLFSLLEK
FT                   VAQSEAPVMVRGESGTGKELAARAVHECSPRREGPFIQLNCAALNEALLESELFGHVKG
FT                   AFTGAYRARPGRFEVATGGTLFLDEVGDIPLSVQAKLLRVLETKQIERVGDHRPIEVDV
FT                   RIVSATNRDLDRLVAEGEFREDLYYRINALPVAMPALRERPEDIPWLASHFLGLVRQNS
FT                   GKALTGLTPEALRSVVAYPWPGNVRELKSALEYASVLAETGRLKTEHLPPHITAANPSA
FT                   QPAASHSGEETADAQRQALIEALRQSGGNQSRAAQLLGVSRVTVYNRMRKYGLTVQTVV
FT                   ESRH"
FT   gene            complement(213286..213510)
FT                   /locus_tag="Dret_0169"
FT   CDS_pept        complement(213286..213510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0169"
FT                   /product="ferredoxin"
FT                   /note="KEGG: dps:DP1865 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67471"
FT                   /db_xref="GOA:C8WZJ6"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ6"
FT                   /inference="similar to AA sequence:KEGG:DP1865"
FT                   /protein_id="ACV67471.1"
FT                   /translation="MSTSTPEITIDPIGCTGCESCAEVCPECFAMQDGTGLAVVREPLP
FT                   DPIPDCLNEAIICCPTQCIHVEYPPESTS"
FT   gene            complement(213796..214905)
FT                   /locus_tag="Dret_0170"
FT   CDS_pept        complement(213796..214905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_25670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67472"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ7"
FT                   /inference="similar to AA sequence:KEGG:DMR_25670"
FT                   /protein_id="ACV67472.1"
FT                   /translation="MQHPSSEEIQDQFSQNDVRLAEDAEAIREMRQQKGLEGLVGGLEG
FT                   VIINTEPQMHERAVAELLRTTGMQAGECFAEATRRISRLQAANSPDLILQTRLQGDNPF
FT                   WDLNMNPKSRFLPNTRLETFVFRTEDLAEYVRLQRDRGVAFMTEEIQQYPDYDFIQTRP
FT                   SRFTNNSLGFIQWKNPGGSLAAAQAEPAAALPEKPALAHLDNIGRLDHCATRVTAAERD
FT                   QAILEFMELTNYNFDFAIYVDSLNSITNVARLSDTDFAMVFTSGIAAATGPETAGPTEQ
FT                   FIVNYGRRVHHMAFATDNIDATYDALERDGMRFLVELVGSEEEGLQQTFTMPSKYTLLV
FT                   NEYIHRYGDFDGFFTKSNVTTLTEATGRQ"
FT   gene            complement(215007..217952)
FT                   /locus_tag="Dret_0171"
FT   CDS_pept        complement(215007..217952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0171"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; KEGG:
FT                   dde:Dde_1382 glutamate dehydrogenase (NAD)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67473"
FT                   /db_xref="GOA:C8WZJ8"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ8"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACV67473.1"
FT                   /translation="MSGAEQPEQEATLQQVKDSLASLADHVVPWFYQNMHEYYFKTHSP
FT                   AEQLRHLQAIITGQVTTDNQSVQLKSPCGTRITYISPGADLDNLIHALEQLKEYKIQTA
FT                   RIYPSFDGSLRLDTFHLASAQPTSTQNHDFTPLAVELEHNRLISSQEKKPFLQFLDCAS
FT                   SDYVEKFEPGRAARHFKLIQDIAGTERVMVQLETEVYPGEDRITLAMNNPPRCGLLLEI
FT                   MKTLQRMGVNTRRAYADLFAPQDRDSAAIISLYLQCEAQNGLSCSWDRLLQELRMVKWY
FT                   APDALEWFAAQRQWPLADVALLQAACDFVHHVLVKRDVYAYTLERIHKVVQDNFDLTED
FT                   LLRYFQARFDPAENEREDLLSLREGNVRQGLHDIFDETTRTIFKTLFTFFKSTLRTNAF
FT                   VPRRLGLAFRLDPRELGALYPDKETPFGVYYFHGPRFSGFHVRYRDIARGGVRLVPTNT
FT                   QEQYKLESNRLLDEVTGLAWAQQYKNKDIPEGGSKAVLLLKPGGEINLTWRAMIDALLD
FT                   LIVCTEQELVLPDVIDYLKRREIIYLGPDEHITPEHITWAVNRAKHRGYRYPAAFMSSK
FT                   PEAGINHKAYGVTSLGVVVFVEEVLKSLGLDPAHTDFTLKMTGGPAGDVASNAMRFLIA
FT                   GYQEHARILSISDGHGAAYDPAGLDHTELLRLIEAGERAHQFNPERLSDSQAFVIEADT
FT                   PENIRIRDELHNTVQADVFLPCGGRPETINEQNWHRFLDSRKRPSAKAIVEGANIFLSP
FT                   VARDHLQAAGVLIVHGSSANKTGVIASSYEILAGLLLDDAAFMEIKTPYIEEVLEILKQ
FT                   RARDEARLLLKEYTWRGGTQPLTDLTVRLSEEINQLGDTIAHSLVSRGGDLNKAPLLRQ
FT                   CLFDYCPPVLVEKHGARLVRELPERHCWALLGAALASRIVYREGLGWLRELSSVRDIFD
FT                   VATAYLEQEARLTDYLGQLKDSGAANATDMTAILQNMGRKYLTARHLGLDE"
FT   gene            complement(218129..219526)
FT                   /locus_tag="Dret_0172"
FT   CDS_pept        complement(218129..219526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0172"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: dde:Dde_3784 M24/M37
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67474"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZJ9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACV67474.1"
FT                   /translation="MRIAPHSRHKLHFQRPRKTSPRRVGIVAVLGLILFAASLISLPED
FT                   EPPKPNFQDTSSPVQAGQPQQTSKAQQTASKPVAKEPSLGSQMAAPRAEAALPPLETTK
FT                   GTIQPGQTATQLLANYFEAPTIYALSRQCEEVYPLTRLKAGQPYTIASRNGEFKQLSYE
FT                   INETAKLLIEKQDGEFCVAKQPIAYETRKTLVSGTIHSSLYTAVSEAGEEPEFALLLAE
FT                   IFAWDVDFVRDLRQGDHFTALVEKRYRKGKHSGYGRILAASFTNKGKTFQAFWYEDTQG
FT                   EGSYFDARGQSVRKAFLKAPLSFTRISSGYSNNRLHPVLKIRRPHHGIDYAARTGTPIK
FT                   TVGDGVIMTRSYAKGAGRYVKVRHPNGYVTVYNHMSRFASNLRTGQKVRQGEVIGYVGS
FT                   TGLSTGPHLDFRMKKHGTYVNPLKVESPPCEPVPSEEKERFQAHIQPLLAQLQQAEQQY
FT                   LATAETP"
FT   sig_peptide     complement(219401..219526)
FT                   /locus_tag="Dret_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.580 at
FT                   residue 42"
FT   gene            complement(219570..219797)
FT                   /locus_tag="Dret_0173"
FT   CDS_pept        complement(219570..219797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0173"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: dma:DMR_26290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67475"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK0"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACV67475.1"
FT                   /translation="MSITVKCYATLSAYQPENPESFPLTAGETVASLIDRLGIDPDEVK
FT                   ITFVNSRSVAVETPLHDGDRVGIFPAVGGG"
FT   gene            complement(220024..220644)
FT                   /locus_tag="Dret_0174"
FT   CDS_pept        complement(220024..220644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_3547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67476"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67476.1"
FT                   /translation="MHNLPECHIRVDYLDPTVIMPLYHRGVFLAPQCGTTVQDFLEHTC
FT                   HLQPDYIRSRIQTIFLDGHPVDDTAHTTLDQDATLALSAAMPGLVGATMRSGGQFAALR
FT                   EGISYTCSPSAAPGSEAPVLVRLKLFNFLAKEVGPDLLQNGVILPRADWVQWLSSADAL
FT                   WPHCLRMTYDGQDLDCSPQTATNSVWPEHIQFRLSTPSPTSPS"
FT   gene            complement(220690..222426)
FT                   /locus_tag="Dret_0175"
FT   CDS_pept        complement(220690..222426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0175"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: gur:Gura_3550 aldehyde ferredoxin
FT                   oxidoreductase; PFAM: aldehyde ferredoxin oxidoreductase;
FT                   Aldehyde ferredoxin oxidoreductase; SMART: Aldehyde
FT                   ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67477"
FT                   /db_xref="GOA:C8WZK2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK2"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ACV67477.1"
FT                   /translation="MDKILRINLGADGGPKYTEEPLGDYAGLGGRALTSAIVHNEVPAD
FT                   CHPLGQENKLVMSPGLLSGTAASTSGRLSVGCKSPLTGGIKESNAGGQAAQVMAKLGYA
FT                   AIVLEGSQPKDLYKMTISQDGVKIETANDLKMHTNYQLMNKFKDDYIKSGTMISIGTAG
FT                   EMRMANSTIAVTDPEGRPSRHAGRGGVGAVMGSKGLKMLLLDGTGAKMRKPQDQEAFKQ
FT                   ANKTFVEGLKGHAVTGQGLPAYGTNILTNIINEAGGYPTYNFKEGQYKGAANLSGELQA
FT                   EIEQKRGGNPTHGCHRGCGIQCSGVFVDKDGNYVTKQPEYETVWSHGGNCGIDDLDTIA
FT                   RLDFMDDDYGLDTIEMGATIGVAMEAGLIEFGDAEGAINLVHEVGKGTHLGRLLGAGTA
FT                   ATAKALGIERAPVVKNQAMPAYDPRAVKGVGVTYATSPMGADHTAGYAVATNILKVGPG
FT                   QQDPLASGGQAELSRDLQVATAALDSTGMCVFTAFAILDQPETFQALIDMLNAFYGLSL
FT                   TADDVVALGKNVLTQERAFNTNAGFTKVHDRLPYYFKREKLSPHDVTFDISDEELDSVF
FT                   NW"
FT   gene            223008..225368
FT                   /locus_tag="Dret_0176"
FT   CDS_pept        223008..225368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0176"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; GGDEF domain containing
FT                   protein; CBS domain containing protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   dvm:DvMF_0617 diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67478"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK3"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACV67478.1"
FT                   /translation="MIHLTGAESGVPGAIPAHEASFLQRQALELMHLSDFPPTQPRAGE
FT                   QEETVEPFGTILGRCRGSKGAHLVVLQEKALSLLGSLYGQDVLEAALQRVEHVLRRSAN
FT                   TFAPPPNPPAGLIRFEAGEYIVVWNVPEAASWIEDAAFVLRMALQKELQHLFVQSLGKQ
FT                   AHVRSGQASETCGRGRTWERTFYQALDAARSRCSVTSNLENLSLMREFELLVAGRTVEA
FT                   HFQPIVSLVTGQTLGWEALSRGPEGSPFRSPQFMFDFAEESDSLFALERACRARAIAEC
FT                   GPLQKGQKLFLNIHPRTMLDPNFTPGQTKRLLANTGLAPDDVVFEITERHSVKDFGLFH
FT                   KALDHYRSQGFKVAVDDAGAGYAGLWSIAQLRPDYIKVDMSLVQGVAHDPVRRALMETF
FT                   VAFADKVGARVIAEGIENHTDLSSLTAMGVHCGQGFLFARPAAPRPEPANVMDNLAAPV
FT                   PKLHTGCRIPLANLVDPVMQVDQSASVEDVRLLMKEQKPLASVVVVHRERPVGLIMSHH
FT                   LDRHLASRYGVALYSKRPVTNLMDGQALIVDENEAVERVAQLAMGRERFKAYDDIIVTR
FT                   HGRLLGVVSVQQMIDAMAQAQVEMAKGANPLTGLPGNVALEQEIETRMARHDPTAIVYA
FT                   DLDNFKVYNDTYGFKQGDEVIQLLAKILVWAGKRHGAEGSFVGHIGGDDFVLLAHPDQV
FT                   ERICTGVVRCFGRAVRGYYTQQDRTQGCTRGVGRDGSVACFPLVAVSLGVVFCHGPCPM
FT                   QVLSERAAEIKHYAKTYSGNNYVLDRRGVLGEG"
FT   gene            complement(225429..225686)
FT                   /locus_tag="Dret_0177"
FT   CDS_pept        complement(225429..225686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67479"
FT                   /db_xref="GOA:C8WZK4"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67479.1"
FT                   /translation="MTQQRPPHPPNVEEDLTLRQERSQLGAALAAIGAALGLTLRSLWR
FT                   LSCKAIRIFWERRGRRWKDTSLNFARQAWQAFLEDVMHTR"
FT   gene            complement(226313..227356)
FT                   /locus_tag="Dret_0178"
FT   CDS_pept        complement(226313..227356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0178"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pap:PSPA7_3488 ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67480"
FT                   /db_xref="GOA:C8WZK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV67480.1"
FT                   /translation="MHRLWHILRPGPLTRRRWAAFKTNKRGYWSMWLFLLLFLASLGAE
FT                   GIANDKPLLVWFKGQMYAPVIRSYPETTFGGVFPSETDYRDPFVQELIEDNGWMLWPPV
FT                   RYSYDTINYDLDQPAPSPPSTENWLGTDDHGRDVLARVIYGFRVSVLFGLVLTVLSSLV
FT                   GVMVGALQGYFGGRVDILGQRFLEIWSGLPVLFVLIILSSFVQPSFWWILGIMLLFSWM
FT                   PLVDLVRAEFLRARNMEFVLAARALGVGHAMIMAKHILPNAMVATMTFLPFLLNGSITT
FT                   LTSLDFLGFGLPAGSASLGELLAQGKANLHAPWIGISSFMVLAGLLTLLVFIGEGARDA
FT                   FDPRHTQ"
FT   sig_peptide     complement(227225..227356)
FT                   /locus_tag="Dret_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.497 at
FT                   residue 44"
FT   gene            complement(227364..228458)
FT                   /locus_tag="Dret_0179"
FT   CDS_pept        complement(227364..228458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0179"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: psa:PST_2259 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67481"
FT                   /db_xref="GOA:C8WZK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV67481.1"
FT                   /translation="MGSYILRRLFLMVPTLLGILTINFFLIQAAPGGPVEQFMAKLHGQ
FT                   AGRSVERFAGSESGDFQTQTPNGENDISYRGAQGLDPELVQKIEKLYGFDKPMWQRYIH
FT                   MLGNYLRFDLGDSFFRERSVMGLILSKLPVSVSLGFWSTLIIYAVSIPLGIRKALHHGS
FT                   RFDVWSSTAIIVGNAIPVFLFAILLIVLFAGGSYWDIFPLRGLTSPDFADLSLWAKIKD
FT                   YFWHLTLPVLSMVIGGFATLTLLTKNSFLDEIGKQYVVTARAKGLTEKRILYGHVFRNA
FT                   MLIIIAGFPAAFISMFFTGSLLIEVIFSLDGLGLLGFESTLQRDYPVMFGTLYIFTLIG
FT                   LLAKLASDLTYTLVDPRIDFERRD"
FT   sig_peptide     complement(228369..228458)
FT                   /locus_tag="Dret_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.841) with cleavage site probability 0.825 at
FT                   residue 30"
FT   gene            complement(228572..230395)
FT                   /locus_tag="Dret_0180"
FT   CDS_pept        complement(228572..230395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0180"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: aeh:Mlg_2274 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67482"
FT                   /db_xref="GOA:C8WZK7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV67482.1"
FT                   /translation="MSWLLYRLAILLMASTCCVLPVRSAFAAHALAMNGEPKYSADFTH
FT                   FAYANPQAPKGGHVRRAAIGTFDTFNPYVPKGMAPQGIGLIYDTLCVQSMDEPFTAYGL
FT                   LAQDITVPPDRSWVRFTLRENARFHDGHPVHAEDVAFTFELLMAKGSPTYANYYGDVSE
FT                   VEVLGPRQIRFTFEHANNRELPLILGQLPVLPKHFWKGKDFTSAGLTRPLGSGPYTIET
FT                   FKPGHFVRYKRVASYWGADLAVNTGRYNFDSLQYDYFRDTTVALEAFKAGEYDFRQENT
FT                   AKHWATAYTGPAVDQGHIVKERIPHDRPQGMQAFIYNTRRPLFSDPEVRRALAYAFDFE
FT                   WTNSQLFYGQYTRTKSYFSNSELAAQGPPAPEELALLEPHRSHLPEEALTSAYTVPSTE
FT                   TTPLRQNLRQGLRLLRRAGWTMQDGQLVHKQTGKSFQFTILLRSPSFERVVLPFKRNLA
FT                   KLGITMEIRRVDASQYVNRLRSFDFDMLIATLPQSNSPGNEQRYFWTSEAASTPGTYNY
FT                   MGVDNPAIDALVEQVVTAPDRESLITRCRALDRALLWGHYVIPQWHLGALRVARWDIFG
FT                   RPEKMPRYGLDFFTWWVDPDKAAAVRAFQGR"
FT   sig_peptide     complement(230312..230395)
FT                   /locus_tag="Dret_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 28"
FT   gene            complement(230570..231856)
FT                   /locus_tag="Dret_0181"
FT   CDS_pept        complement(230570..231856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0181"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; Thrombospondin type
FT                   3 repeat; von Willebrand factor type A; KEGG: sat:SYN_00198
FT                   outer membrane porin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67483"
FT                   /db_xref="GOA:C8WZK8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK8"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACV67483.1"
FT                   /translation="MHCKRLLHILIFTLALACLPMTALGENLQQPKVDNFLFVADISGS
FT                   MGQSYLDSGNSKAMTAKELMGRLNQAIPNLDYQSGLYTAAPSKQVAPWALYRTTRYAQA
FT                   IANVPDTVRKLGFIGYPTPLADGLNNLAPALDTAEGSTAIILFSDGQANTGGNPVQAAQ
FT                   ALYEAYPQICIHTVSLANSGSGQATLDAIANLRDCSVSTTAAALDAPAALNAFVQRVFY
FT                   TQLKDSDGDGVLDSKDQCPGTPQGVSVDERGCAIDSDGDGVIDAKDECPGTPQGVAVDS
FT                   KGCPLDSDGDGVIDAKDECPGTPQGVQVDEKGCPVPMDVSISILFDIDKSVVRGDYHDE
FT                   LADATAMLNKNPEANAVIEGHTDSTASAAYNMELSKKRAQSVRDYLVDTFDIDPQRLST
FT                   KAYGESQPTATNTTRFGRKLNRRVVITLQ"
FT   sig_peptide     complement(231779..231856)
FT                   /locus_tag="Dret_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            232292..232891
FT                   /locus_tag="Dret_0182"
FT   CDS_pept        232292..232891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0182"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: dde:Dde_2198 multiple antibiotic resistance
FT                   (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67484"
FT                   /db_xref="GOA:C8WZK9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZK9"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACV67484.1"
FT                   /translation="METLRLVFELAFPLFLIMDPIANSATCLAILKGYSPPKQRRIIFR
FT                   ELVIALVLIVLFQVLGKWLLELLAIHQSTLRVAGGLILFIISLKLIFPEDQGPVGGDDK
FT                   DPFIVPIATPFIAGPSLLAAVMLYAHREERQAVLFLAVFVAWLGSLGIMLSAPSLQRIL
FT                   GKRGIKAAERLMGLILILVAVQMLEDGVRLFVESMF"
FT   gene            233075..233860
FT                   /locus_tag="Dret_0183"
FT   CDS_pept        233075..233860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0183"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   dds:Ddes_0652 molybdenum cofactor synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67485"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL0"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACV67485.1"
FT                   /translation="MPLTLYWEETIPASGRALVALQSESTFPGSAMRSPQYASLAAGMY
FT                   LNGPDGQALAQVEAPTWLPQSQGASCPAVWIRSLRELPPEQSPIQVDAVRQGISLAWVT
FT                   MSDKGARQEREDTSGPSIASILGQTLSLSYIQGFVLPDDRDILRGVLHRLSFIDRFDLI
FT                   CTTGGTGVAPRDITPEATLAVLDKRLPGFEQVMTASSLAKTPHGMISRAVAGVAGQTLI
FT                   CNLPGSPKGVRENLESILPALQHTLDKIHGDPADCARIN"
FT   gene            233826..235493
FT                   /locus_tag="Dret_0184"
FT   CDS_pept        233826..235493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0184"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein;
FT                   KEGG: acp:A2cp1_0659 PAS/PAC sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67486"
FT                   /db_xref="GOA:C8WZL1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV67486.1"
FT                   /translation="MATPPTAPASTETTASALGSDDRHRLVLAAGIVRLVCLGLLLIPQ
FT                   ALIWGGDTTPEFMFRYGGEVLYTVALVAGFLLNIVFLLSWKRFVSTSWLVGTQLGTDIV
FT                   LALVLVVLTGGVSSPFTFLFWGIVFFHGRVLGRRPSLAIGVGVAVLMGGLGAVQVVWPE
FT                   IWHLQGAPGQLGYYLSLQWVGLGLVILLVRSSRSETEKLFARLRRQEQALEEAEALKAK
FT                   VLDWMDSGLMVLNTRGEVTSANRQALLMAGEHRLDSVLGRPLRDVFPAFDPYWQKWRHD
FT                   GRRERDEVQDPDQRVYGVRMLLAPDQQSTLVLFADITEIRRLEQRVREMEKMATIGELA
FT                   AGLAHEMKNPLAGIKAGLQLAEQGDVPPEQLHRLHGVVQRDIGRLDVLLRDFLNYARPN
FT                   PPQPESVEIEDVVEDVLSVCRYEFPGVDFAVARGVGRETWWADRHHLHQVLLNLVRNAA
FT                   ESVASQGHGLVRVEQLADEEGRGLAVVDSGSGILPGQERKIFDPFVTTKEQGSGLGLSI
FT                   AQRLAHQNRCWIELRNAAGGGGEARLVYESTIPVFGER"
FT   gene            235493..236632
FT                   /locus_tag="Dret_0185"
FT   CDS_pept        235493..236632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0185"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hch:HCH_06688 spermidine/putrescine-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67487"
FT                   /db_xref="GOA:C8WZL2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV67487.1"
FT                   /translation="MVWRLVLAGLVVVSCLGFPEAPACAEKQDQPTLHVLNWKNYFPFD
FT                   PDIPEEKGIYARSKVLQEFAARHGCRIEVDEVVNEIELRDRLLTMQGYYDVVVYSACDV
FT                   QYLHKAGLLRSIPREQLAHLPQVAKAYLKVNSALNGLYFVPYLSGTTGIIYRRDLLDQP
FT                   PVSWEDYFKPKASLQGRIGALDSAYSMFLCAFEHLGFGKLREDPSLLQQAADLLRGMER
FT                   RQMWEVITSDHVYLEKLLGQGQIWMTIGYSGAAARMQRKWGAERIGYALPTEGAEIWGD
FT                   GFIIPRGVRHPQLAYAFIDYMISPEVQYEAARNLLYIPANARAAEKISGGGLLPSGDPL
FT                   LHIPLGMYPVLSRADITSSHMEGMWRDIVSKHHSHPPGQ"
FT   sig_peptide     235493..235570
FT                   /locus_tag="Dret_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.766 at
FT                   residue 26"
FT   gene            236698..239130
FT                   /locus_tag="Dret_0186"
FT   CDS_pept        236698..239130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0186"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gme:Gmet_2426 Hpt sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67488"
FT                   /db_xref="GOA:C8WZL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV67488.1"
FT                   /translation="MRLHTKLLLAVLPLVLPVLVFGLWAEGLFDHLASDTTQLVSGSEV
FT                   LADKAERVHTLARLIERQAESDYRLVAREAARSLQNYHQFLTQVQQLLGSSTTLTLYMH
FT                   SHPSGREYLAMQLYPELEQALKNFHLSAIRLVDDNGVSLLHQGVPPLQKAGRQKRKPPW
FT                   WSQIQRELHADAQHISTLYQGQNKGAPVYRLAVIMPLRYLWNRYNQKAGKVKGYLSFEV
FT                   SLPALMAYLGSKSGHGGDLVWKTPDGTVVAGRSANAAGRSMAEVEAQLGPMRHFEAEAV
FT                   PGKLVVDFLLPEASVYSHVQAARQLSTSLDTRVKEVAHLSSAAQHESLRLQSVLFITLA
FT                   VTLVLSLVLALVISRGIGRPLSRLTSAAERISKGNLQENPGVYPRDEIGDLAASFERMR
FT                   KALQSQIATLDKQVRDRTAALSKAKEEAERANRAKSDFLSGLSHEIRTPMNALLGASDL
FT                   LEKTELDARQRKYLRMGKSSGKTLLSLITNLLDVARLERGRLQLAREVFSLEQMVQEAI
FT                   DVVELAAQEKGLILNKKIALAVRGTYLGDPVRLRQILVNLLNNAMKFTPQGRVLVEVTP
FT                   AEQTGVLFRVSDTGEGIPQESLETIFEPFSQLDSSSGLPNSGSGLGLAISRQLLEAMGG
FT                   RIWVESRLGRGSDFFFLVPLERTDSAAPATVVPQPAEEVPDLTGLQVLLAEDTPNNSML
FT                   IRFFLEGTGCRVSAVENGAAALEALERDRYDVVLMDIQMPVMDGITATRRIRAREQATG
FT                   GNAIPVVAMTAHTNAEEVSKLYAAGCSQYLPKPVCRAYLLELLQHIHTGTSQILHQP"
FT   sig_peptide     236698..236775
FT                   /locus_tag="Dret_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.864 at
FT                   residue 26"
FT   gene            239360..240661
FT                   /locus_tag="Dret_0187"
FT   CDS_pept        239360..240661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0187"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; glucose-inhibited division
FT                   protein A; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: pca:Pcar_2050
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67489"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL4"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACV67489.1"
FT                   /translation="MKGKREPGDRRANPRVIVIGGGPAGLLAAGYAARQGAEVVLLEKM
FT                   HKPGLKLGITGKGRCNVTNAAPLREFLAHFGTQGRFLRQALNRFSPQDLQELFASIGIA
FT                   TVVERGGRVFPEHLRAPAVASRLTEWVKKGGVRVQTHTEVLGVTATRDRVTGVRIRGEQ
FT                   GESVWPCHALIVATGGASYPQTGSTGEGASWMTALGHTVVPCRPALVPLETAGDTAARL
FT                   QGLSLRNVEVSLWLRGKKTAQAFGEMVFTHFGVSGPVVLELSQQAVDLLRNGECPELCI
FT                   DLKPALDETKLDARLLRDIQHKGKKQIANWLRDLLPTSLIPICLEATGLDGSLQAGQMT
FT                   ARQRRNLKMWLKYFPLPLTGYRGFEEAIVTAGGVALQEVDPRTMQSKLVPGLYLAGEIL
FT                   DLAADTGGYNLQAAFSTGVVAGEAAGIAVSRSTG"
FT   gene            complement(240795..240956)
FT                   /locus_tag="Dret_0188"
FT   CDS_pept        complement(240795..240956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_1412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67490"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL5"
FT                   /inference="similar to AA sequence:KEGG:Dvul_1412"
FT                   /protein_id="ACV67490.1"
FT                   /translation="MQKRYCTCGRTIWVNYYHTNQGWIPQLNRHAHPQETLRICPNCGR
FT                   ILDINRLP"
FT   gene            complement(241089..241724)
FT                   /locus_tag="Dret_0189"
FT   CDS_pept        complement(241089..241724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0189"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: Peptidase S24, S26A and S26B, conserved
FT                   region; CI repressor; KEGG: dma:DMR_33970 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67491"
FT                   /db_xref="GOA:C8WZL6"
FT                   /db_xref="InterPro:IPR010744"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL6"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACV67491.1"
FT                   /translation="MHIEFDLFFKRLQEALGITTQSELANLLQVNRSAVTQAKRTGEVP
FT                   QRWVWQLSRHLGLNRTWLETGQGPMRPGPDTFATIPKVKARLSAGGGSFETEQAVEGYY
FT                   SFRRDWLRGKGQPGCMVLMDIMGDSMEPELKEGDTVLVDQNQQEIYAGGMYAMGVEDTV
FT                   MVKRVEKHPNKLVLLSTNQRYTPIVLQGDEIEAVTCIGRILWVGRELL"
FT   gene            241983..242927
FT                   /locus_tag="Dret_0190"
FT   CDS_pept        241983..242927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0190"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: pna:Pnap_4178 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67492"
FT                   /db_xref="GOA:C8WZL7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL7"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACV67492.1"
FT                   /translation="MHIEALRQKKIGIALSCGAARGFAHLGVLDELDRAGIHPCCIAGS
FT                   SAGALVGALYSGGRFQDYIERIQHWTRKDTLAMMDPVVPRSGLINGDRILEFNSSFFTV
FT                   EKIEACAPALAVVATEALTGKELVLQQGDLRSAIRGSISIPGLFTPAPWEGTFLLDGGL
FT                   VNPLPVNVCRDLGAEIIIAVDVNSQMVLPLETRENETAEHEEAVPEIPSTWHKVLGSSQ
FT                   TYLFQLVQNWLGNTNSQRKKTAFEKGIVDTMLHSITIMQRAVQQAHLQTTRPEFLLQPQ
FT                   INGVRLMDFHHAASTIEAGRQAVQDFLNNLDSL"
FT   sig_peptide     241983..242063
FT                   /locus_tag="Dret_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.515 at
FT                   residue 27"
FT   gene            complement(243074..243553)
FT                   /locus_tag="Dret_0191"
FT   CDS_pept        complement(243074..243553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0191"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: dde:Dde_1214 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67493"
FT                   /db_xref="GOA:C8WZL8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL8"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACV67493.1"
FT                   /translation="MAGIFTAGDIVEAAIQVETKGESFYKRVAGKAANEQVRDLFLYLG
FT                   GEEIKHRETFQGLLQRVGQFELPAWSTDQEYQEYLESLVESHILFGDGLGDTILTHMQS
FT                   EAEALRFAMGFEKDTILFFMEMRELVPESEKRFVQECIEEERDHLRKLRTMLKSL"
FT   gene            complement(243569..244414)
FT                   /locus_tag="Dret_0192"
FT   CDS_pept        complement(243569..244414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0192"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   Dihydroorotate dehydrogenase, electron transfer subunit,
FT                   iron-sulphur cluster binding domain; KEGG: dma:DMR_01960
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67494"
FT                   /db_xref="GOA:C8WZL9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZL9"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACV67494.1"
FT                   /translation="MVNYCTNDNPYLPELATIQEVIEETQNIKTFRVTLDDEEKMRSFS
FT                   FEPGQVGQLSVFGTGESTFVINSPPSRMEYLQFSVMRAGEVTTKLHDLRAGDKVGVRAP
FT                   LGNWFPYQQMQGKNILFIGGGIGMAPLRTLLLYMLDNRDDYGQIKLIYGARGPYDLTYR
FT                   GEIPEWEARDDLDLVLTVDREHPDWDKRVGLIPHVLLEEEPSPENTVAVTCGPPIMIKF
FT                   TIEALKKLGFEDEQIITTLEKRMKCGIGLCGRCNIGTHYVCVDGPVFSYAQLKQLPSEL
FT                   "
FT   gene            complement(244407..245456)
FT                   /locus_tag="Dret_0193"
FT   CDS_pept        complement(244407..245456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0193"
FT                   /product="iron-sulfur binding protein"
FT                   /note="KEGG: dma:DMR_01950 iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67495"
FT                   /db_xref="GOA:C8WZM0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM0"
FT                   /inference="similar to AA sequence:KEGG:DMR_01950"
FT                   /protein_id="ACV67495.1"
FT                   /translation="MGATKFIAAQDLPRWLTELQQTRQVYVPVQDKQSVVFAPFSEQAE
FT                   LVLDRQPTTPPKEVVFPQTEELVHYKYTKREDDPGRNDIEIESRPEAPAAVVVGCRPCG
FT                   ARGFATYDRVYTSDAVCDPFYKSRREQTAFVSIACKRPENSCFCHWTGGGPADTTGSDV
FT                   LLTEVEGGYVAEACTDTGEALLSSTLFGEAGGKEAAAKTQHEEALAAMGTAPDLSDVPA
FT                   KLLKLFEDMDFWEAMSAKCIACGACTYLCPTCYCFNITDEGSGYEGRRVRTWDTCMSFL
FT                   FTLEASMHNPRPTKAHRLRNRVGHKFCYYPDLHEGAIACCGCGRCIKHCPVAVDIREIV
FT                   LRAKEEANG"
FT   gene            complement(245456..246412)
FT                   /locus_tag="Dret_0194"
FT   CDS_pept        complement(245456..246412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0194"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: dvl:Dvul_0829
FT                   methyl-viologen-reducing hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67496"
FT                   /db_xref="GOA:C8WZM1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM1"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67496.1"
FT                   /translation="MSQLEQLQDAIRHKLPELDMVIAWGTGFDPLHATPLFIREQGDLD
FT                   KMTWGPLCVHNLATYLPGLKGKKVGVVVKGCDSRSIVQLLEESLIERENLTVFGLPCEG
FT                   IVDLAKVEEALGPEAGFVREVREEGDALVVQTDSGDHRLSIAELRPQKCLSCRYPNPII
FT                   ADQVLGEPREPVKDPTDPDLEALEAMSYDERMQYWTAQLDRCIRCYACRNACPMCVCRD
FT                   HCIAQTRDPQWISQETGVAEKWLFQIIHAQHLAGRCTECGECERACPMDIPILTLKRKM
FT                   NREIKEMFDFEAGTDPEATPPLFTFQVEEAKINERGW"
FT   gene            complement(246440..246886)
FT                   /locus_tag="Dret_0195"
FT   CDS_pept        complement(246440..246886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0195"
FT                   /product="methyl-viologen-reducing hydrogenase delta
FT                   subunit"
FT                   /note="PFAM: methyl-viologen-reducing hydrogenase delta
FT                   subunit; KEGG: dde:Dde_3527 hydrogenase, iron-sulfur
FT                   cluster- binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67497"
FT                   /db_xref="GOA:C8WZM2"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM2"
FT                   /inference="protein motif:PFAM:PF02662"
FT                   /protein_id="ACV67497.1"
FT                   /translation="MSAQDGNKLRIVGFLCNWCSYGGADTAGVSRFEQPMDLRIVRLPC
FT                   TGRANPLFIMKAFFGGADGVLVSGCHPRDCHYSEGNYYARRRLELLKRTLPVLGIDPER
FT                   FEYTWVSASEGKRWQTVVTRFTERIHTLGPAPAIEKQCAPALQA"
FT   gene            complement(246853..248835)
FT                   /locus_tag="Dret_0196"
FT   CDS_pept        complement(246853..248835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0196"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dma:DMR_01920 heterodisulfide reductase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67498"
FT                   /db_xref="GOA:C8WZM3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67498.1"
FT                   /translation="MRIGVFVCHCGSNIAGTVNVQEVAETARDFPEVAFATDTMYACSE
FT                   PGQEGIVQAVQEKGLDGVVVASCTPRMHEPTFRRAVQRAGLNAYMFEMANIREHVSWVS
FT                   KDVAANTDKASELIRMAVEKLRRDRPLISEKFDVTKRVMVIGGGVAGIQAALDCADGGL
FT                   EVVLVEKSSTIGGKMAKLDKTFPTVDCSSCVLGPKMVDVAMHPNITLYAYSEIESLGGY
FT                   VGNFEATVRRKATYVDWEKCTGCGLCMEKCPSKKAYDYFNEGISTTTAINIPFPQATPK
FT                   KATIDADYCRRFTKGKCGVCAKVCPTEAINFEMQDEIVTEKIGAVITATGYDLFDHSKY
FT                   GEYGGGRFADVITSMQYERILNASGPTGGHIKRPSDGKEPENVVFIQCVGSRDKSVNRP
FT                   YCSGFCCMYTAKQTILTKDHLPESQSYVFYMDIRAPGKMYDEFTRRAMEEYGANYIRGR
FT                   VSMIYPKGERYVVRGVDTLLGTQVEIDADLVVLAVGAECADGAEKLAETLRISYDTYGF
FT                   YMESHPKLRPVETNTAGVYLAGACQGAKDIPASVGQGSAAASKVLALFSKDQLEADPQV
FT                   AQVQLARCVGCFKCVNTCPFGAIQESQDRGGNPKAEVIASVCQGCGICNVTCPQGAIQL
FT                   QHFTDNQILAEVSALCQPKMETSSA"
FT   gene            complement(248921..249823)
FT                   /locus_tag="Dret_0197"
FT   CDS_pept        complement(248921..249823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0197"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: dde:Dde_1208 succinate
FT                   dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67499"
FT                   /db_xref="GOA:C8WZM4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM4"
FT                   /inference="protein motif:PRIAM:1.8.98.1"
FT                   /protein_id="ACV67499.1"
FT                   /translation="MRSETIYAYYPGCSQIGTATDYDKSTRACCDKLGIQLRDIPDWSC
FT                   CGSTPAHTVDHTLSGALSLRNLQLAQQLEPTCVTTPCPSCLTNLKVAARKAEDPDSLTA
FT                   MNELLETPYAGNLEVKSTLQILVEDIGVDALASKVQKPLTGLLVAPYYGCIMNRPPDVM
FT                   QFDDPENPTAMDRVLEACGATVLPYPLKVECCGASYGIPRKDVVTHLSHKLLSLAEDVG
FT                   AMAMVTACPLCQMNLDLRQKQINKAQNANHNIPVFYFTQLLGLALGLPGRELGLEKLAV
FT                   SPKDVLNKAKARAIAEAAS"
FT   gene            complement(249826..250467)
FT                   /locus_tag="Dret_0198"
FT   CDS_pept        complement(249826..250467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0198"
FT                   /product="heterodisulfide reductase subunit C"
FT                   /note="KEGG: dma:DMR_01900 heterodisulfide reductase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67500"
FT                   /db_xref="GOA:C8WZM5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM5"
FT                   /inference="similar to AA sequence:KEGG:DMR_01900"
FT                   /protein_id="ACV67500.1"
FT                   /translation="MQTINLSTHTDPAFTQQVNEESHQDVALCYQCGNCTAGCPYTFVY
FT                   DIPVHQIMRLVQAGQKDTVLRSRSLWLCATCQSCTTRCPNNIDVAQIMDVLRHMARREG
FT                   YVTERNVKLFYDAFLESVHKHGRVYELGAMSSYIAHSKRVMTDAELGPTVMAKGKLSFT
FT                   PHNIEGKEHVAAIFDRYMEKQEQGREAYRPFQAERMSPVAAWLRRLRREE"
FT   gene            complement(250600..251781)
FT                   /locus_tag="Dret_0199"
FT   CDS_pept        complement(250600..251781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0199"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   dde:Dde_3523 alcohol dehydrogenase, iron- containing"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67501"
FT                   /db_xref="GOA:C8WZM6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM6"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV67501.1"
FT                   /translation="MAVQEMVYGFFIPSVTLIGIGAHKEIPERIKALGGSKPLLVTDKG
FT                   ITKAGISQQIADLLKENGMECVIYDETIPNPTDNNVHAGVDIYQKNGCDSLISLGGGSS
FT                   HDCGKGIGLVVSNGGKIHDFEGIDKSEKPMPPYLAVNTTAGTASEMTRFCIITDTSRKV
FT                   KMAIVDWRVTPGIAIDDPLLMVGMPPALTAATGMDALTHAVEAYVSLAANPITDACALQ
FT                   AIQLIAKYLRPAVANGQDMEAREKMAFAQYLAGMAFNNASLGHVHAMAHQLGGFYDLPH
FT                   GECNAVLLPHVEKFNLIAKVDRFIDMAKAMGENVEGLAPRAAAEKAIDAIKTLSTDVGI
FT                   PDGLVELGKRYGVDVKEKDIQTMTENAQKDACGFTNPRCPTDADVAAIYKAAL"
FT   gene            complement(252195..253544)
FT                   /locus_tag="Dret_0200"
FT   CDS_pept        complement(252195..253544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0200"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase;
FT                   KEGG: dma:DMR_02400 NtrC family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67502"
FT                   /db_xref="GOA:C8WZM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM7"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV67502.1"
FT                   /translation="MNSQSLVLIVDDEASIRRLLHKELSSANRAVHTAENAQQAREAVG
FT                   QHPYDVLVLDIRLPDGDGLDLLAEFKEVLPDAETILITGHGDIDSAVEAMKIGAYDYIT
FT                   KPFNLDRLEFVIDKAYQRACLQRDNRIFRRHQQKLQDSHNLIGNSAAMKHIRFLIEKVA
FT                   PTNVPVLVTGESGAGKEVVSRAVHYNSPRAQKPLVTKNCATLQRELARSELFGHIKGSF
FT                   TGATENQEGLLSFAHKGSLFLDEIGELPLEVQASFLRVLENKTYRRVGEKKEREVDARL
FT                   ILATNRDLAQEVEAGRFHEALFHRINVFHITIPPLRERKEDIPLLVEFFLNKLAGGQGV
FT                   CTLSPRAAQCLYDYQWPGNIRELRNVLERSIILSEAGVITEGDLPSEISGQHHNEEPAQ
FT                   NPLRLEAVEQAHIQRILRFFDYNRSQAAEALGVSRKTLYRKLQKYGLDSS"
FT   gene            complement(253513..254739)
FT                   /locus_tag="Dret_0201"
FT   CDS_pept        complement(253513..254739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0201"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   dde:Dde_3535 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67503"
FT                   /db_xref="GOA:C8WZM8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV67503.1"
FT                   /translation="MAPQTTLEDIIGIEHSKLGFFQEVQRKVAELRHSNEELEHKQREI
FT                   QAILDGISDIMLVLSADMRILSVNQVFFDHFEEPNPVGKYCFEVFRGQAKACRGCPARE
FT                   SMRSGEVCKETAIFKVNGRNRQYDMLASPLQDTPGQEGRVLLFKRDVTLEKEYQAQFYQ
FT                   AEKMATIGMLAAGVAHEVNNPLAGIQGFAQGILRRLPRVQEAVDEELANDFQEYTETIL
FT                   QECNRCQEIVRTLLTFSRPRESAFCSLSMNNLIRDTLKVLQHRIKRHQGLLLQEDLEPE
FT                   LPLVCGDEPHLKQVILNLLTNALDAIGEEGVITIRTSSTESQVALCVEDTGEGIPEEHL
FT                   DKLFEPFFTTKPVGRGTGIGLSTCYTIVHNHGGEISVKSAPEKGSRFCVVLPKRQGNAC
FT                   EQPITCTYR"
FT   gene            complement(254739..255881)
FT                   /locus_tag="Dret_0202"
FT   CDS_pept        complement(254739..255881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0202"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   dde:Dde_3534 alcohol dehydrogenase, iron- containing"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67504"
FT                   /db_xref="GOA:C8WZM9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZM9"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV67504.1"
FT                   /translation="MEITKFAIPEIIFGNNGLEYLASCARRHGAQKVFFVSDSGLERSG
FT                   WVQRACDILDRDRLPWTYFNMVESNPRDYQIEKGAAQYAQEGADVIIALGGGSPLDTAK
FT                   GIALLASNGGRVRDYEGANRIEHPLPPMIFLPSTAGSGSDISQFAIITDVERQVKMAII
FT                   SRTLVPNISIIDPVILQTKPPELIITSAIDALAHAIESYVSPIASPFSETQSLQSIKLI
FT                   VTNLQHAQATGDPEALKQLSIASTAAGMAFSNAGLGIDHALAHSLGGVFDVMHGIVHPI
FT                   LLPPIMRFNLPSCPEKMHRIGATVLGRRHTDSNGLALAGIEWLEDFFQSFQIPTRLGEI
FT                   LPSGTDLMPICHMATLDACMLSNPRPASPDDLFTLCQEVW"
FT   gene            complement(256121..256429)
FT                   /locus_tag="Dret_0203"
FT   CDS_pept        complement(256121..256429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0203"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: sat:SYN_00227
FT                   putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67505"
FT                   /db_xref="GOA:C8WZN0"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN0"
FT                   /inference="protein motif:PFAM:PF01627"
FT                   /protein_id="ACV67505.1"
FT                   /translation="MSESPVQEHIDPALVPLMPRFWSNARQEFQAMNEALNHREWTTLR
FT                   RLAHGSKGAAAGFGLQGLAGIAKNLEGAASTGDQEQAAFQLARLQTYLDSVQVLPRE"
FT   gene            complement(256461..257687)
FT                   /locus_tag="Dret_0204"
FT   CDS_pept        complement(256461..257687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0204"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; 6-phosphofructo-2-
FT                   kinase; KEGG: dde:Dde_0511 6-phosphofructo-2-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67506"
FT                   /db_xref="GOA:C8WZN1"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR013079"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN1"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACV67506.1"
FT                   /translation="MSEAHQALCIAMVGLPARGKSTLAQKIQDGLAADGVRAAIFNNGE
FT                   MRRALDRNDTTAPDFYHPANTEAAGVREKIAALNIQRAREFLRDGGQVAILDATNVSRK
FT                   RREFVERQMHDIPLLFLECFNEDEEILEENILQKARLSEFAHLETRQATASFKKRIEYY
FT                   RRLFCPLGEERNFIRQDSFLNTIHAIQILDRIPYFEQLRDLLVTDFVPNLYVARHGTSV
FT                   FNLENRVGGDSPLAQAGHQQAKRLAATFRDTPLSMVFTSTRRRTRQTAAYVLEAQQTAP
FT                   PLYSMELFDEIDCGICEEMDYEEVKRRRPDVHRGRVEDKYNFVYPGGEGYRNMRARIER
FT                   GVRKALYLSGGSRHILIIGHRAVNRLILSYFLYRRPADVPYLYIPQDRYFHISCAQNER
FT                   RIRLRPLLS"
FT   gene            complement(257680..260949)
FT                   /locus_tag="Dret_0205"
FT   CDS_pept        complement(257680..260949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0205"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dal:Dalk_2343 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67507"
FT                   /db_xref="GOA:C8WZN2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN2"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACV67507.1"
FT                   /translation="MAHEGRSVRGVIPSIVNTFLNPQLPILLIILALGVGLTAILLTPK
FT                   EEEPQIVVPLADIVVQAPGASAAEVENQVATPLENLLWQIEGVEYVYSISRKDSAVVTV
FT                   RFHVGQDHERAMVRLQNKVGRNLERAPALVKNWVIKPISIDDVPILNLTLYSETYDDHE
FT                   LYRIGQETLHHLSEVENISRTEIVGGRPREIRVELAPDRLAGYNVTANQIHQALAAADH
FT                   SVHAGSFNQANRRYILSANNFLTSTREVERLVVGVHEDKPVLLRDVARIMDGPQEASVY
FT                   SRISFSRLYRQRQVNTGAHPQGSNGSFPAVTLAVGKKKGTNAVWVARNVLDRLEELKDS
FT                   VIPDGVHVEVTRNYGQTAQTKVNNLLSSLGFAVLTVVVLLAFTLGRREALIVALAVPIS
FT                   FALALFVNYLLGYTINRVTLFALILSLGLVVDDPITNVDNIQRHIRMGKLPPRSATLAA
FT                   VQEVLPPVLISTLAIIVSFTPMFFITGMMGPYMAPMAANVPLTVIFSTVCALTIVPWLA
FT                   LTLLRRERLTPDESGAGQQSSPSSGTPAWIHSLYRKICSPFLDSRLKRWLLTGAIGLGL
FT                   AAAVSLPLLRLVPLKMLPFDNKNEFQLVFDMPEGTPLEATNKAVLAFEDYLRQVPEVTS
FT                   VVATVGDASPIDFNGMVRHYYLRQAPHQADIRVNLVDKPDREMQSHGITLRLRNDLTKL
FT                   ARRHGVDLKIVEIPPGPPVLATVVAEIYGSPGTPYAKMLQGAANMTSIMRKEPGVVDID
FT                   TSASAARPRRNFVVDKEKAALHAIPTSRITQTLRLAMSGTTPATLHAPRERAPLLIRPI
FT                   LPRAHRSEQTALLDLRLRGKGGALVPLGELGHFEQVAEDQPIYHKNLKRVVYAQAETAG
FT                   RSPATAILDMQSRLEHNPLSADLQAEWAGEGEWKITLRVFRDLGLANIAALAGIYILLS
FT                   IQTGSFALPLLILLAVPLTLLGIMPGFWLLNIFTASPVNGYANPVFFTATAMIGMITLG
FT                   GIVIRNAVVLIEFVHESLQQGHDFREAILQSGAIRLRPIVLTAMTTALGAWPITRDPIF
FT                   SGLAWALIFGLVASTVFTLLIVPVTYYALYTSRYSQESGHE"
FT   gene            complement(260939..262099)
FT                   /locus_tag="Dret_0206"
FT   CDS_pept        complement(260939..262099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0206"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dal:Dalk_2344 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67508"
FT                   /db_xref="GOA:C8WZN3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV67508.1"
FT                   /translation="MNLRNLLSTALGIAILAGLVLYTGGFFESGGISPDSVSRPQPTQG
FT                   PTPSRTATAHLKTISQTTTAPGTVAPRTTMRVEAQVAAQITSIAVTAGDRVSTGETLIQ
FT                   LEHNRLDTAVEQARQHLVKRQSQLDQARENLPAAQAEFNATQAQWRRIKTYFKAEAATK
FT                   QELEQARAAFHRARSRLTTARKRIGQAAAGVEVARQKLRAARIKRGYARLTAPADGQVA
FT                   KRLADPGDQARPGTPLLVLHTDRTLRLEARVPESRLAHVRQGHNATVHIPALPAALSGT
FT                   IEEIIPSADPRTRTFTVKVALPDYSGLQPGMFGRLEVASGTRQAVFVPEGAVRPMGQLD
FT                   IVRVRQQQGWQDILVTTGVHRDEMIEILSGVAPGDEIALAGGGHGT"
FT   sig_peptide     complement(262028..262099)
FT                   /locus_tag="Dret_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.672 at
FT                   residue 24"
FT   gene            complement(262116..263687)
FT                   /locus_tag="Dret_0207"
FT   CDS_pept        complement(262116..263687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0207"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dal:Dalk_2345 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67509"
FT                   /db_xref="GOA:C8WZN4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN4"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACV67509.1"
FT                   /translation="MSHPLPRPRFFSPGLDPGTCLEHSSTPPKAIVGKHFLPLIAAVLG
FT                   CAILLQACTRPAAMPPETAASPPQRVQQFAVPPAPAPNATTPSLASPLSLDAALQRAIA
FT                   DNPQRRIVAARLARAEAVIAERQAAFWPQVSLYTEHLQGESPSASLFKSIDQRRLDQRN
FT                   VDFNRPGRFQNFETGIKANLQVFNGRRDTLRLQIAKHRRAALTHTRAEVINDLCTAVTE
FT                   TFCTILAAEETVATSKHRVTLLREEVRMAKIRFEAGGTLKADVLSLQSRLSQAKSAHTR
FT                   ARARASSARAALAVLLDLPPDQCPDITGSPRLPVQLPATYHKARTYALNHHPALTRARE
FT                   QTEQARLGLDLAWAAYLPRLLAQGKYYHDDPHMAYSRERENWTLGLVLDWQLFSGLSRQ
FT                   AKVEQARGRMAEVRARNRQTRQRILQNLKQDLAEREAARDRLQASRHRVEQASEALRLV
FT                   RIRYQGGSATLTRFLSAELARYAAQEAETASRFDLLRIQAAIARDIGAWHRRFGSFAPS
FT                   TAQSAP"
FT   gene            complement(264013..264819)
FT                   /locus_tag="Dret_0208"
FT   CDS_pept        complement(264013..264819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0208"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   dma:DMR_31670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67510"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN5"
FT                   /inference="protein motif:PFAM:PF01875"
FT                   /protein_id="ACV67510.1"
FT                   /translation="MRRSPIVAGQFYPGTKTAWEQQVRTYLAQATAPQSPSLMAMVPHA
FT                   GYPFSGPVAGKTLGAASLPETLLLLGPNHTGLGKALALWSRGAWDIPGASLAIEEKLAG
FT                   AIVHGCPHIASDEAAHLREHSLEVILPFLWALNPRTRIVPLAVAEHHLPTLLETAEHLH
FT                   TVLGRQQQQVGIVVSSDMSHFISEQEAKHLDDMALQRILDLDPEGLYNTVRNNRISMCG
FT                   VLPMTLGLQLVKRMGAVSAKLVDYATSADATGDRSQVVGYAGVLLS"
FT   gene            complement(265056..265850)
FT                   /locus_tag="Dret_0209"
FT   CDS_pept        complement(265056..265850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0209"
FT                   /product="protein of unknown function DUF198"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   dma:DMR_31740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67511"
FT                   /db_xref="GOA:C8WZN6"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN6"
FT                   /inference="protein motif:PFAM:PF02649"
FT                   /protein_id="ACV67511.1"
FT                   /translation="MQDVQNTPAGIPLAIDRVGVKDLRFPLLVQDRERGHQHTVSRVDM
FT                   FVDLPAHFKGTHMSRFVEVLQDFSGILDYPNFKNLLREVRQRLQAHRAHLSFSFPYFLH
FT                   QNAPVSASASLMDYQCTLHGELDDADQLRMFLQVQVPVMTVCPCSLAIADEGAHSQRAM
FT                   VTMNCRFAGMLWLEDLIHIGQHAASCQVHSLLKREDEKFVTEKAFATPTFVEDVVRNAA
FT                   HQLQSHELISWFRVEVESFESIHNHSAYACIEAPGSQTGAGQ"
FT   gene            complement(265850..266272)
FT                   /locus_tag="Dret_0210"
FT   CDS_pept        complement(265850..266272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0210"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein DNA-
FT                   binding domain protein; KEGG: dvl:Dvul_0474 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67512"
FT                   /db_xref="GOA:C8WZN7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN7"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ACV67512.1"
FT                   /translation="MNKAVRVAITLDPTLLNKFDELCAKQSYQNRSEAIRDLIRNSLVQ
FT                   QEWREEETGESVGTLTLVYDHHHSDLAQRMTEIQHEALDIIVTSLHLHIDAHNCMEVLI
FT                   LRGPNTLIRDTAQRIISTRGVKHGKLTLSTTGKDLV"
FT   gene            complement(266405..267049)
FT                   /locus_tag="Dret_0211"
FT   CDS_pept        complement(266405..267049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0211"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: dma:DMR_31760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67513"
FT                   /db_xref="GOA:C8WZN8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACV67513.1"
FT                   /translation="MPSSELHIREGGREWILHRPGDLESYWQEMTDRHFDADERLPYWV
FT                   EVWPAGLRLATWLGDNSDRLAGRACLDLGCGLGLSTCAARAAGAKAVGVDYEPDALRYA
FT                   RINEQANGLEGIAWAVMDWRRPAFAPGQFPFICGADILYERRFTEPLAGLFAALLAPGG
FT                   RIWITEPIRDVSAPAWAFFRSRGWKTRLLNCEKTSFQDMTMRVNLWEMRRR"
FT   gene            complement(267049..268539)
FT                   /locus_tag="Dret_0212"
FT   CDS_pept        complement(267049..268539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0212"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_1510 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67514"
FT                   /db_xref="GOA:C8WZN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZN9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV67514.1"
FT                   /translation="MTDHPLVSLHQISKSFGSVQANKDITLDIRSGTIKTLLGENGAGK
FT                   STLMSILAGRFSPDAGTIRIRGVQRRFTTTAEALDSGIGMVYQHFMLVEAMTVAENVFL
FT                   GHKNGFWLHPKQMETQVRSLADQYGLDVDPAAKVHTLSMGEKQRVEILKLLFRDNDVLI
FT                   LDEPTTVLTPREVNQLFRAMRTIASQGKAIVFISHKLAEVMDVADEIAILRRGAIVDEL
FT                   PAATVHSKADLARRMVGREVVLSLDKAHVAPGRPVLEVDQLDAGPVREVSFSLCRGEIL
FT                   AVVGVAGNGQRPLVETICGLRSPECGQVNILGLPWSEFYSRLEWQGALSYIPEDRLGLA
FT                   TCPELDLVDNFLLTTRQGFCRGSILDRGKAERTARELTGAFNVHPPDVNNRARQLSGGN
FT                   LQKMVLAREFYRRPRLIIAEQPSQGLDISATEEVWHHLLQARERAGILLVTGDLNEAFN
FT                   LADRIAVIFQGRFMDIFPATDKTKLDNIGPLMAGMPTS"
FT   gene            complement(268536..269027)
FT                   /locus_tag="Dret_0213"
FT   CDS_pept        complement(268536..269027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0213"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: dde:Dde_1506
FT                   xanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67515"
FT                   /db_xref="GOA:C8WZP0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP0"
FT                   /inference="protein motif:PRIAM:2.4.2.22"
FT                   /protein_id="ACV67515.1"
FT                   /translation="MHDSERYTKMFPVTWEQLHRDARALAWRLVGSGPWKGIIAIARGG
FT                   LVPAAIIARELEIRLIETICISSYDFQAQGQSRILKELHLDSSGWLLIDDLVDTGNTAR
FT                   MVREMLPEAHFATVYAKPAGRPNVDTFITEVSQDTWILFPWDSEHQFCRPIVDRTGQHP
FT                   "
FT   gene            complement(269059..269979)
FT                   /locus_tag="Dret_0214"
FT   CDS_pept        complement(269059..269979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0214"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvm:DvMF_3028 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67516"
FT                   /db_xref="GOA:C8WZP1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV67516.1"
FT                   /translation="MNESILLPLLAATVQSGTPILYATLGEILTERAGVLNLGVEGMML
FT                   LGALAAFWASLSTGSPWIGLLAGGTAAALLSGLHALVCLVFQGNQVVSGLALTILGTGL
FT                   ADFWGTPFIGRKAPGFGTLELPVLADLPVLGPIFFQQDILVYLSLLLPVAMWLFLGRTR
FT                   WGLGLRSVGEYPRAAAAAGLPVLCYRAAGIMGGGFLVGLGGAYLSLAYTHLWTNGLTAG
FT                   RGWIAVALVIFAFWRPGRAIVGAYLFGGVMAFQLRLQAMGTNLPSSLLLMLPYALTILV
FT                   LALTSWRGRFTDAPGWLGVNIEPEE"
FT   gene            complement(270072..271139)
FT                   /locus_tag="Dret_0215"
FT   CDS_pept        complement(270072..271139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0215"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: dps:DP0678
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67517"
FT                   /db_xref="GOA:C8WZP2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV67517.1"
FT                   /translation="MLLYRIRKRTTPLTWQSWAIFLGAVLFSLVASGILLALQGKPPLE
FT                   GMRLFFQGGFGTSWALEDALVKAVPIYLCSLGVGIAFRLQIWNIGAEGQYALGAIGATW
FT                   AALHFSHLPGLLLLPLMLVCATVAGGFWGFIPAILKLRMRANEIIVSLMLNYIGIRLLE
FT                   YLVYGAWKDSRSFGFPMTPEFDPAAIIPSFGTSRLHWGLVLCVVIGVVMTLFLRFSRTG
FT                   FELKVSGESVRAARYARMPYGKLVVLVMVISGALAGWAGFVETSATLGRLQPSVMAGYG
FT                   YTAIVVAWLAKLSPLRIGIASFLLAGVRVGVETLQLDLQVPAAFGSIMEGLILLSVLSG
FT                   QFFKHYRFERLTRNR"
FT   sig_peptide     complement(271026..271139)
FT                   /locus_tag="Dret_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.853 at
FT                   residue 38"
FT   gene            complement(271242..272306)
FT                   /locus_tag="Dret_0216"
FT   CDS_pept        complement(271242..272306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0216"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   dvl:Dvul_1927 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67518"
FT                   /db_xref="GOA:C8WZP3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP3"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACV67518.1"
FT                   /translation="MRQISILCALMAAFLLCLPGAASAEDLKVGFIYVSPVGDAGYSYA
FT                   HDLGRQAVEQMDGVTTSYVEAVPEGPDAERVLLNMSRKDFDLIFATSYGYMDSVIKVAK
FT                   RFPEITYMHCSGFKRAENVGTYFGRMYQARYLTGMVAGEMTDSNVLGYVAAYPIPELIR
FT                   GINAFTLGAQAVNPDVKVRVVWTKSWYDPATEKEAALSLLDVGADVIAQHVDSPAPQEA
FT                   AAEKGAYSVGYNSNMAQFAPEAHLTSAVWNWDNLYPEIAEQVVQDTWESQDIWAGLNEG
FT                   IIGLAPYGPMVPESVQAEVEEAKAAIQNDELTVFAGPLKDQDGTVKVPEGDSMTDEEML
FT                   GMTWFVQGVIGTTE"
FT   sig_peptide     complement(272232..272306)
FT                   /locus_tag="Dret_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            272471..273442
FT                   /locus_tag="Dret_0217"
FT   CDS_pept        272471..273442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0217"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   protein of unknown function UPF0066; KEGG: dde:Dde_3569
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67519"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP4"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACV67519.1"
FT                   /translation="MAAYSLEPVAVVRTVYPSREACPRQAGSDAEPARIEVASEFQPAL
FT                   DGVRPGQHLLVLTWLEQGDRACLRCHPRGDVNRPQRGVFTTRSPDRPNPIGLHEVRVLG
FT                   WENGVLTVSGMEVVDGTAVVDIKSVPGAAADSAVGILKQAGHRCWQRGLSNGLSGNLSL
FT                   RCENGMYITRSGCGKGHLSTRDIVGLDEQGDSFWGQGRPSSEWRVHHAIYRAQPRARAI
FT                   VHVHPPCVLALSLGEDIRRAFAALPLYESQVVLDQLAVVPAFDPGSTALATAAGEAAQG
FT                   AGAIFLTRHGVVCWSEEMDQALALAEEVETLARIRLEAGRRS"
FT   gene            complement(273519..274367)
FT                   /locus_tag="Dret_0218"
FT   CDS_pept        complement(273519..274367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0218"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: dde:Dde_0296 methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67520"
FT                   /db_xref="GOA:C8WZP5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP5"
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /protein_id="ACV67520.1"
FT                   /translation="MLLLNGKETAATIRARLKTEIAGLVEAHGRPPGLAVILVGEDAPS
FT                   QVYVRNKERACADAGIASQTFRLPADTPQAELEGHIQDLNAREDIDGILLQLPLPTGLD
FT                   SQRCLDLIDPAKDVDGFHPVNMGRLLLNLPGPKPCTPAGILTLLDHYGIDPAGKHCVIV
FT                   GRSNIVGKPLAQLLLARHGTVTVCHSRTRDLPAITRQGDIVCVAIGRTGFLTPEMVKEG
FT                   AVVVDVGINRTDDGLKGDADFDGLQDKVAAITPVPGGVGPMTIAQLLLNTLESYTARVQ
FT                   R"
FT   gene            complement(274372..275535)
FT                   /locus_tag="Dret_0219"
FT   CDS_pept        complement(274372..275535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvu:DVU1801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67521"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP6"
FT                   /inference="similar to AA sequence:KEGG:DVU1801"
FT                   /protein_id="ACV67521.1"
FT                   /translation="MKGGVLFQALVLLLLCTPALAQRQCPSEPVMAAVEAFVQAAEGTQ
FT                   DPTPAQRDVLTSLASRRDAACSGDPVQFQGMPGAFHAFDVDVDLQTILETLYHPDIPSN
FT                   MIIPSSVRCTKWLEVAGENATEVPPLAPALSRPNATRIIRGVEQETNTPDLFTGSYYTY
FT                   QQHRLLVLSNAAQGQPVLISVAAQQDISEVGHKGRVIGDDTLWTYYYSGEKGVNKIGLG
FT                   WVDSHIFDGVSITLYSQVPDSRQTRVTTMKWLNAGWMGMNMVKPKHIQAGLERFAAGLT
FT                   RVLESPQFPAPDHLAQVGRWLERQPRQQLAQWRAALAQSRPEAPFPTDCEELTMACDVK
FT                   YARSMSHNSLVCAVGLEFMKWRLGLSSAPADEICRQIFAPVLQNPKG"
FT   sig_peptide     complement(275470..275535)
FT                   /locus_tag="Dret_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.986 at
FT                   residue 22"
FT   gene            complement(275536..276039)
FT                   /locus_tag="Dret_0220"
FT   CDS_pept        complement(275536..276039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0220"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: dde:Dde_3459 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67522"
FT                   /db_xref="GOA:C8WZP7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP7"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ACV67522.1"
FT                   /translation="MTQVAILIGSISDKDVLEPCTKVLEDMGITYRFTVSSAHRTPERT
FT                   ENMIQELEQAGCQVFICAAGMAAHLAGAVAARTIRPVLGVPINASALNGWDALLSTVQM
FT                   PPGYPVGTLALDKAGAKNAAWQAAQILALNDPDLARRILEARETMAADVAKAGQELESR
FT                   AGRS"
FT   gene            complement(276036..277319)
FT                   /locus_tag="Dret_0221"
FT   CDS_pept        complement(276036..277319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0221"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: dde:Dde_3458 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67523"
FT                   /db_xref="GOA:C8WZP8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP8"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACV67523.1"
FT                   /translation="MRILLIGSGGREHALAWKLTQSPSVSALFTAPGNGGTAALGENIP
FT                   VGADDLPALVQTAKDKAVDLVVIGPESPLVLGLRNAMERTGIPCFGPGSYAAQLEGSKA
FT                   FAKSLMREAEVPTADFEVFDDFDTAWDYVRQQEFPVVIKADGLAAGKGVVLAHTAEEAK
FT                   QTLQEMMEERVFGTAGNRVVIEEALEGEEASFMAFCDGLTVRPLPSCQDHKAIGEGDTG
FT                   ANTGGMGAYSPAPLLPASRAQEMSDLAITPIIQHLHEMGRPFRGVLYAGLMLTKDGPKV
FT                   LEYNVRFGDPECQPLMVRLESDLAEIMLACAQGRLKELEITWSEKTSLCVVLAAAGYPG
FT                   PYPKDMPITGLKEAEALENVHVFHAGTRLQDGEVLASGGRVLGVTALGDDLAQAQQQAY
FT                   KAADCIHFDNKYLRRDIGDKGLRRLGLK"
FT   gene            277558..279231
FT                   /locus_tag="Dret_0222"
FT   CDS_pept        277558..279231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0222"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   dvl:Dvul_1002 hydantoinase/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67524"
FT                   /db_xref="GOA:C8WZP9"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZP9"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ACV67524.1"
FT                   /translation="MLLGIDVGGTHTDVVVIAPSGVVGAAKVNTDPENLLASVRQALEE
FT                   VRSVLGGQVPTRFALSTTLCTNALVQGTTEAVGMVLFGGPGIDPSLHAPTPHCTVVPGV
FT                   VDHRGSVLEEFEAESLEQVVEQFAAQGLSAFACVGKFSPRNPEFEQQAAHHLASLGGWV
FT                   TQGHHLSGELNFPRRINTAYFNSAVWTTFNGFADAVAAILDEYGFNCPVNLLKADAGTL
FT                   PLQQARRVPVETIFSGPAASVMGISALCPVQDEAVLLDIGGTTTDVALFAGGVPVIERH
FT                   GISLEGRPTLVKGLKTRSVGIGGDSAIEVHNGSITVGPQRFGPCLAQGGPRATLVDALN
FT                   VTRRIAYGDTAASFRGLETVAHHLECSPARAAESVVEAACAGIRDAVQDLLAEVNQRPV
FT                   YTVHEVLWGKGLHPQHLLLMGGPAAALAPCLEKALDMQASVPEHAAVANAIGAALARPT
FT                   VCIELFADTQQRVMRIPALGVERSIGAGYDLEAAKQDALVALQETLEDSTLESGAAEIL
FT                   ESSSMNMVRGMSMVGRDIRVRCQVRPGIASGYETTVRSVC"
FT   gene            279225..280565
FT                   /locus_tag="Dret_0223"
FT   CDS_pept        279225..280565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0223"
FT                   /product="Histone deacetylase"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   dde:Dde_2337 histone deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67525"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ0"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ACV67525.1"
FT                   /translation="MLKVANSLGVVFFPAFDWAISPTHPERQERLLYTMDQLQEEGVFD
FT                   IPGIAEYKPDIASLEDVERVHFAFPRTEDVLTDSHLISAGGAIRAGQMVLDKERDKSFA
FT                   LVRPPGHHAMKSVHGGRGFCNVNMEAIMIERLRRQYGVNRVAVVDTDCHHGDGTQDIYW
FT                   HDPETLFISLHQDGRTIFPGSGFPGEIGGPKAAGRNLNVPLPPGTSDAGFLLLMDELVL
FT                   PVLRDFQPELIVHSAGQDNHFSDPITSMNLSAQGYARLSQKLQADIAVLEGGYAIEGAL
FT                   PYVNTGIILSMAGLDFSHVREPALRPESVAQDAKITEYLKQLAPAVRDLYFHPPEKLID
FT                   REKEGDFFVRDKEIFYDTDGLMEQQREFVLDCPHCPGLYKVQTSSTKTPFCLGIELGRQ
FT                   CCDSCARRAEEEFARAQKSLRYAVIQYIDRIQDFSQRVVGDAMDKEM"
FT   gene            280673..281728
FT                   /locus_tag="Dret_0224"
FT   CDS_pept        280673..281728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67526"
FT                   /db_xref="GOA:C8WZQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67526.1"
FT                   /translation="MSMTNDAGMTEETLTPQSSRARQTFWGVVLLAVIFLAAAGLSVEA
FT                   WMQLYAGRSLCSTSACEVVGEFVRIGEAGLVVTGAVFFWLVWAVVFFARRYPQPWLWGS
FT                   ATLLVCGALAFDGGLLGYQFMGLGEQCLLCLAVGLSLGLVTALLARVRGSWLLLFLGLA
FT                   VWTGGFAANSVLRIDPDSPPVAETAFLESAGDASKAPLRLHLFFSLHCGHCSELAANLA
FT                   VNQAWQKAYWTLSATDSAERDLRRLAAIQRDGDAASNPFVSILRVESQKEVPKGPVPEA
FT                   IRRATHKTQVFFRHRRWRGVPVLLAQEGLGKKVVLTGKESIMRYLARQDILTRRIDMHK
FT                   LRENLPRPPEP"
FT   gene            282419..282637
FT                   /locus_tag="Dret_0225"
FT   CDS_pept        282419..282637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67527"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ2"
FT                   /inference="similar to AA sequence:KEGG:DvMF_1218"
FT                   /protein_id="ACV67527.1"
FT                   /translation="MRHNYGHHQATTTMPFAGLGFDLNPVRQAAGLIAWKQWKGTEVQP
FT                   FLWCAPESGRPAGYTLMLHLSREIRGQ"
FT   gene            282666..285683
FT                   /locus_tag="Dret_0226"
FT   CDS_pept        282666..285683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:283239..283241,aa:Sec)
FT                   /locus_tag="Dret_0226"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="Contains selenocysteine; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit; PFAM: molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase;
FT                   molybdopterin oxidoreductase Fe4S4 region; Twin-arginine
FT                   translocation pathway, signal sequence; KEGG: dvm:DvMF_1217
FT                   formate dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67528"
FT                   /db_xref="GOA:C8WZQ3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ3"
FT                   /inference="protein motif:TFAM:TIGR01553"
FT                   /protein_id="ACV67528.1"
FT                   /translation="MTFTRRHFLKLSASAAAVTAFGGLGFSLKPTAAQAQLLKLRWAKE
FT                   TTSICCYCAVGCGLIVHTSQEGQGRAINVEGDPDHPVSEGSLCAKGAAIFNLGENEDRI
FT                   TSVLYRAPGSEKWQETSWDWALDTIAKRVKETRDATFTRTNAQGQEVNRCNGLASVGSA
FT                   AIDNEECWVYQAMLRSLGLVYIEHQARIUHSATVAALAESFGRGAMTNHWIDIKNSDCI
FT                   LIMGSNAAENHPVSFKWVTKAQEKGAQLIHVDPRYTRTSAKADIYAPLRSGSDIAFLGG
FT                   LIKYLTDKEMVNWEYVINYTNATFILSDEYGFEDGLFAGFDPKTKSYDKSKWSFVLDEN
FT                   GVPKRDTNLADPRCVYNLMRKHYERYTLDKVSKATGTPKEDLLKVYKAYAASYKADKSA
FT                   TIMYAMGWTQHTVGVQNIRAMAMIQLLLGNIGVAGGGVNALRGESNVQGSTDHCLLYHI
FT                   LPGYLKTPKASQPTLQAYNEAYTPVSNDPKSANWWQHYPKYSASLIKAMYKDAPIEKGY
FT                   KWLPKLDDGKGYSFLELFDAMYREEIKGFFAWGQNPASGLANSNKSREALSKLDWMVVT
FT                   NIFDNETASFWKGPNMDPKSVDTEVFFLPCAVSIEKEGSITNSGRWMQWRYEGPKPLPN
FT                   TKTDGDMIVELTKRLQKLYANEGGTYSEPIVNLSTELWEKNGKYDPHKVAKLINGFFLK
FT                   DVTVRGKSFKAGDQVPSFAYLLEDGTTTSGNWLYCNSYTNEGNMAARRDKSQTKMQANI
FT                   GLYPNWSWCWPVNRRIIYNRASVDLKGKPYAPDKPVIKWTGDSWAGDVPDGGWPPGEKH
FT                   AFIMRKHGFGQIFGPGRADGPFPEYYEPLECPLEEHPFSSQLHNPTALTFEGAMDKRRS
FT                   CDPRYPFVGTTYRVTEHWQSGVMTRWQPWLIEAEPELFVEMSPELAKMRGIENGERVIV
FT                   ESARGQVKAVAMVTPRMQPFTIMGQVIHQIGLPWHYGWVYPKDSGDAANLLTPSVGDAN
FT                   TGIPETKAFMVNVRKI"
FT   sig_peptide     282666..282764
FT                   /locus_tag="Dret_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.861 at
FT                   residue 33"
FT   gene            285717..286445
FT                   /locus_tag="Dret_0227"
FT   CDS_pept        285717..286445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0227"
FT                   /product="formate dehydrogenase, beta subunit, putative"
FT                   /note="KEGG: dde:Dde_0718 formate dehydrogenase, beta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67529"
FT                   /db_xref="GOA:C8WZQ4"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ4"
FT                   /inference="similar to AA sequence:KEGG:Dde_0718"
FT                   /protein_id="ACV67529.1"
FT                   /translation="MQGKSFFIDLTRCTACRGCQVACKQWHKLPAEETRNWGSHQNPKD
FT                   LSFITYKLVRFQEITQNGRMQDWLFFPEQCRHCVDPPCKLTADMYDDKAILQDPVTGAV
FT                   IFTERTKKLDIMEIRGSCPYDIPRQDADSKIMGKCDMCLDRVQNGLLPACVQVCPTGAM
FT                   NFGDREEMMDLAKERLKTVQKRYPEAVLGDAEAVRVIYLYARKPEQYHSFAVASAAPLR
FT                   QFTRKELLARLRKPVTTMLG"
FT   gene            286705..287649
FT                   /locus_tag="Dret_0228"
FT   CDS_pept        286705..287649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0228"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: dvl:Dvul_2728
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67530"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ5"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACV67530.1"
FT                   /translation="MRTFRNAMSIMTFILVLCLGAFAGCDTEDSPVHVDWDKREELRLE
FT                   PQREALTYAYLPQYSHTVSYQRHNKLVEYLRRTTGLPIRQVYPDTFDEHIHMVAQGKID
FT                   ISFSNPMVYAKIAEQFGARAFARIVEPNGRAQFRGQIICRRDNKAITSLADCRGKSWIA
FT                   VDPYSAGGYLFDLGVFLEHGLTREDFSEIAFAPGPGGKQEKVALAVFAGRYDIGSIREG
FT                   TLDIVKDTIDVDQLRILAHTPWYPGWVYAARKGLPDKTIAKIRQALLDLDLAHPRDQEI
FT                   LDRAGFKAIIPSSDADYEPVRALMRTIGVEGDA"
FT   sig_peptide     286705..286776
FT                   /locus_tag="Dret_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 24"
FT   gene            287642..289747
FT                   /locus_tag="Dret_0229"
FT   CDS_pept        287642..289747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0229"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dvm:DvMF_2189 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; histidine kinase HAMP
FT                   region domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67531"
FT                   /db_xref="GOA:C8WZQ6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ6"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67531.1"
FT                   /translation="MLSWRWPFGRLRFRSKLGWGMAAIVLVFGLLLGHLLTDMAAHSLL
FT                   EQHHKLGETVARNLARRAAEPLLATDLLRLENMVDEVTARTENAEYAFVVDAAHQVLAH
FT                   SFERGFPVELIAANMPEDNRSHRQLLRSQPGLIDDFAAPVLIEGDRIGWVRVGVSRGAV
FT                   SKTYTRLWMVGLGLTLAAIAFGLVLVSLFARTVARRLARLRDCAEEIVKGNLDVVSSED
FT                   NRVNCWEIMDCQMGNCPAYGEKRLRCWYQAGTLCPQCGPGGYPDKLSSCRHCPVYRRCA
FT                   GDELQELAEAFDVMAATLKDYLGQIQTARQDMARQRQLLRTILDVTPDLVSLQDVNLVY
FT                   QAANKAFCKYFNLEEKDIVGRTDFDIFSEAQADQNYHEDKQILVTGEALSKEIAVAGER
FT                   NRRWFHILKVPVYDRDRITGLLLTARDITVVKQYQEQLVHSQKMEDLGRLAGGIAHEIN
FT                   TPLGIILGYTQLLLEDFEEGTQSRTDLETIEKQARICRKLVADLLGFSRQSGFTRAEME
FT                   LNDSIREVISLVEHTFSLNKVWIRSDFDANIPPIEADKERLKQVWMNLFNNAFDAIGED
FT                   GFIFVRTKLCAHRRRVVVTVADTGPGIGEDDLDKIFDPFFSTKPVGKGTGLGLSVTFGI
FT                   IKDHGGRINALSPAPNEYMPSEMEEQIQIGAGTVFIIELPVVDDVLPEDECEEATRHVV
FT                   RSEQSSA"
FT   sig_peptide     287642..287764
FT                   /locus_tag="Dret_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.439 at
FT                   residue 41"
FT   gene            289716..289835
FT                   /locus_tag="Dret_0230"
FT   CDS_pept        289716..289835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67532"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67532.1"
FT                   /translation="MWCAANRALHDRRAVPVEPENEGRRLPAGSEFPVYNHRS"
FT   gene            289916..290278
FT                   /locus_tag="Dret_0231"
FT   CDS_pept        289916..290278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0231"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: dma:DMR_38710 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67533"
FT                   /db_xref="GOA:C8WZQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV67533.1"
FT                   /translation="MAEILVLDDVSDAGELVRRILERKGHSVHAFTEEEEALAHVREAQ
FT                   VDVAILDMKLKKMSGVEVLEELLRIAPQTKVLMLTGYPTLETARESLQLGAKQYLVKPI
FT                   DKDELEEKVAEVLAEA"
FT   gene            290664..295196
FT                   /locus_tag="Dret_0232"
FT   CDS_pept        290664..295196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0232"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamine
FT                   amidotransferase class-II; KEGG: gur:Gura_0393 glutamate
FT                   synthase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67534"
FT                   /db_xref="GOA:C8WZQ9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZQ9"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ACV67534.1"
FT                   /translation="MSIAERDACAIIALVNKQGQATHANIVRTIQALKHMAHRSGDING
FT                   EGDGCGITTDIPTAIWGRHLESQGLSRHLAESRRFFVGHLLLPKDQARDVGDLQRRARD
FT                   VFAQRDLEILVEKEDGARSAELGPRGQTEAPFFWQIAGLVPDGDRQQARRTLFDLELAL
FT                   EREVPAWAPASLSVESVVYKLRGAPDLLPRVYPELQDESTRSVMTLGHSRYSTNTLPTV
FT                   ERSQPFSLLGHNGEINTIERLRSAARVLGIPPVPGGSDSQDLNRILEGLIHLQGFDPLE
FT                   ALEMVFPAVDSLVQRYDPELQNVYALYRWFFPPSAQGPAAVVARSGDVCMGSVDALGLR
FT                   PLWFGESDYDWYLSSEKGVVDLELTMSDPVPLAPGEKKAIVAGRGRPAEVKDYSAIQSE
FT                   LAALLKRRQTLWESTRSLYTAPIPLSEDHSGDKASEALPEEVPLAALRAFGWQHYDLDI
FT                   RKQVVRTGRPVIGSMGHQAPLACLRQEALPTLAEFFKEEVAVVTNPAIDREREGEHFST
FT                   RILLGSRPDWRHLNDSSPVGLMLETPVLLDRLVQDHLTQEEYKDLCRTSGTVALEEVQA
FT                   FFTAQGREQERFVSLDASFCPGTQSLQARLEGLTAEAIEAVDGGASILVLDDQRCFERA
FT                   CAPVDPGLAVSTIGTALEGQGRRRRCGLVVRSGAVRNLHDLMFLLGLGADAVAPYLLWQ
FT                   VALQTRGTAIPAHEAVQRTMHVLQVGMEKVMSTMGIHELCGYGRIFASVGLGADVAAHF
FT                   ATANFCAGITGGLDFAALERLARLRVEAFNASSQERLHKDPPRNPKVGRLIRGAATGQL
FT                   GYAELAKGLDALEEEHPTALRHIWDVAPLSAQPGKRLAMDEVDIGIGEHAMPVVIAAMS
FT                   FGSQGENSFRAYARAAQKANIVCLNGEGGEIPDMLGRFRAHRGQQVASGRFGVSMELLN
FT                   SSDFLEIKVGQGAKPGEGGHLPGNKVSDMVAQARHCRPGIDLISPSNHHDIYSIEDLTQ
FT                   LITELKTAQPTARVSVKIPVTSGVGTIAVGVAKAGADIINLSGFEGGTGAAREHAKKYV
FT                   GLPVEIGVVEAHNALLEAGLREHVELWCDGGLRSGKDILRMVLLGANRVGLGTAALMAI
FT                   GCISCQRCHLDRCPRGISTQLRDAAQAKAKGVKGFSPLDLKEETENLARLLRALGEDLK
FT                   RRVADLGAHRLQDLVGRRDLLVQNRLKETVDTASLLKLPDTSGTEVCTYPHLVRRPLNF
FT                   LTKLIADLSLERFAAGSGLVQFVDEGVHSTDRAVGTYLSGAMIREYGMQEHRRAQLRLQ
FT                   ASVPGNGLCAFNIPAIDTIVSGGAQDGTGKGSFGGKVAVLKGSNLQGSRVDGSTGKSFA
FT                   YGAIHGLFFVQNYADSRACIRLSGADVVFGGRIKGPIKEAGNIAPYAHLKGFAFEYMTG
FT                   GRVVVLGDPGPWICAGMTGGVVYQCLYPEWGFDRDALQHRLSKGAFVDIVDMDETATTD
FT                   VRDLLAGYIQELEASFQEAEAEAVRALADRVVDRFVAIRPRGSREVEAE"
FT   gene            295313..296158
FT                   /locus_tag="Dret_0233"
FT   CDS_pept        295313..296158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0233"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: dvm:DvMF_0946
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67535"
FT                   /db_xref="GOA:C8WZR0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR0"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACV67535.1"
FT                   /translation="MTNQLKTGLLLGLLTGLLLLFGSMLGGNGGLAIAFVFAIAMNVGS
FT                   YWYSDRIVLSMYKAKELRREDAPQLHNIVEELAAKAEIPKPRVFLMPEQAPNAFATGRT
FT                   PKQGVVAVTEGILRLLSPEELKGVLAHEMGHIRNRDILIQTVAATLAGVIMFVANIVKW
FT                   GALFGGFGGDDEEGGSPLIALAMAIVAPIAAMLVQMGISRSREYLADETGARLSGNPEY
FT                   LASALQKLDNYSHQARMKSGNPATAHMFIVNPFAGLSMANLFSTHPATADRIARLRQMR
FT                   "
FT   sig_peptide     295313..295417
FT                   /locus_tag="Dret_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.414 at
FT                   residue 35"
FT   gene            296455..297024
FT                   /locus_tag="Dret_0234"
FT   CDS_pept        296455..297024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67536"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR1"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1145"
FT                   /protein_id="ACV67536.1"
FT                   /translation="MLQSTQDMGQPFVDLLRSHKKPLLEQWFHRILATYPDDTAKFYGS
FT                   KKDPFANPVGNTLHKEIDAIFDELLLEQSSDLLPSAVDAIVRVRAVQDYTASAAVSFFL
FT                   LLKDVVRENVGQEALDNGLYLDLLAFEGRVDQLCLLAFDAYMQCREKIWSMKANEVQQR
FT                   TKNLLRQANIVWTVPEDTPESGGGHP"
FT   gene            297062..298060
FT                   /gene="dsrM"
FT                   /locus_tag="Dret_0235"
FT   CDS_pept        297062..298060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrM"
FT                   /locus_tag="Dret_0235"
FT                   /product="membrane-bound menaquinol oxidoreductase,
FT                   cytochrome b subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   sfu:Sfum_1146 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67537"
FT                   /db_xref="GOA:C8WZR2"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR2"
FT                   /inference="protein motif:PFAM:PF02665"
FT                   /protein_id="ACV67537.1"
FT                   /translation="MNALYSLVLVLAMTAVAVIGAGAAGWHFLFGVLIPYVAVALFVVG
FT                   FVYKVVDWARSPVPFRITTTCGQQESLPWIKQNKLDNPSTNAGTIGRMILEVLFFRSLF
FT                   RNTKLQLVQEKGPKLTYGSSKWLWLFALVFHWSFLIIVLRHMRFFTEPVPGVFLGLEAL
FT                   DGMLQIGAPTLYLTDLLIVAGLTYLFVRRVVVPQIRYISLPADYFPLFLLLGIALSGIF
FT                   MRYFAKTDIIAVKELTMGLATFNPVVPEAVGAIFYVHLFLVSILLVYFPLSKLMHMGGV
FT                   FMSPTRNLPNNNRMQRHTNPWNYPVKVHTYQAYEDEFRDVMKEAGIPVEKE"
FT   sig_peptide     297062..297133
FT                   /gene="dsrM"
FT                   /locus_tag="Dret_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.648 at
FT                   residue 24"
FT   gene            298064..299668
FT                   /gene="dsrK"
FT                   /locus_tag="Dret_0236"
FT   CDS_pept        298064..299668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrK"
FT                   /locus_tag="Dret_0236"
FT                   /product="membrane-bound menaquinol oxidoreductase,
FT                   cytoplasmic ferredoxin subunit"
FT                   /note="KEGG: sfu:Sfum_1147 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67538"
FT                   /db_xref="GOA:C8WZR3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR3"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1147"
FT                   /protein_id="ACV67538.1"
FT                   /translation="MSELPKPEHLADINHTPPRRNWMDIPAEFRPGTWCYPAAPKNLKY
FT                   LGFPNPREWSPLDDDWKLPENWQEIVHQGFRERLDKYRSLKVFMDTCVRCGACADKCHF
FT                   FVGGGDPKNMPVLRAELLRSVYRKDFTMAGKIMSKLTGSRVLTEDVLKEWFLYFYQCTE
FT                   CRRCSAYCPYGIDTAEITMMARELLHLVGININWIMEPAANCSRTGNHLGIPPHTFKDI
FT                   VDFMVEDIEDITGVKIDPPINKKGADILFITPSGDVFADPGTYTFMGYLMLFHELGLNY
FT                   TLSTYASEGGNFGLFTSHEMIKRLNAKMYAEAKRLGVKWILGGECGHMWRVINQYMDTM
FT                   NGPADFLEVPRNPITGTVFHNARSTKMVHITEFTADLLQHNALNLDPSRNDHLKVTYHD
FT                   SCNPARAMGLLEEPRQVIKGVCNNFYEMPDNTIREQTYCCGGGAGLNTDEFMEMRMRGG
FT                   MPRANAVQHVHDKYGVNMLSCVCAIDRATLPPLMEYWVPEVGVTGVHELVGNALVMKGE
FT                   KKRELDLRGEELPEKEG"
FT   gene            299673..300092
FT                   /gene="dsrJ"
FT                   /locus_tag="Dret_0237"
FT   CDS_pept        299673..300092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrJ"
FT                   /locus_tag="Dret_0237"
FT                   /product="membrane-bound menaquinol oxidoreductase,
FT                   cytochrome c subunit"
FT                   /note="KEGG: dde:Dde_2273 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67539"
FT                   /db_xref="GOA:C8WZR4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR4"
FT                   /inference="similar to AA sequence:KEGG:Dde_2273"
FT                   /protein_id="ACV67539.1"
FT                   /translation="MYDGGKVITGLIIFVGLMTFPFWFNLGNAAYERPELQEVKDAEEC
FT                   IEPTEYMRTEHMQLLNDWRDSVVREKNRIYVSTTGKEVTMSLQNTCMDCHTSKQEFCDK
FT                   CHNSAAVSPYCWDCHIAPEEEQQGTESAPKEESHG"
FT   gene            300085..300861
FT                   /gene="dsrO"
FT                   /locus_tag="Dret_0238"
FT   CDS_pept        300085..300861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrO"
FT                   /locus_tag="Dret_0238"
FT                   /product="membrane-bound menaquinol oxidoreductase,
FT                   periplasmic ferredoxin subunit"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Twin-arginine translocation pathway, signal
FT                   sequence; KEGG: dvl:Dvul_1778 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67540"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR5"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67540.1"
FT                   /translation="MDNTRRKFLKIAGMAAAVGMGSGVAGSAVASYKPHLSKHEQRKEA
FT                   LEGKRWGLVIDTRKFKSHKDFERCIEACHKIHNVPEIEGNKEVKWIWTDHFAHVFPGQP
FT                   NPYLAERLENQEFLLLCNHCDNPPCVRVCPTRATFQREDGIVMMDFHRCIGCRYCMAGC
FT                   PFGARSFNFGDPRPHIEEENTEFPARMKGVVEKCNLCAERLAEGKIPACVEASEGGIIF
FT                   GDLDDPDSEIRKVLKENYTIRRKVDLGTNPSVYYIV"
FT   sig_peptide     300085..300177
FT                   /gene="dsrO"
FT                   /locus_tag="Dret_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.682 at
FT                   residue 31"
FT   gene            300874..302034
FT                   /gene="dsrP"
FT                   /locus_tag="Dret_0239"
FT   CDS_pept        300874..302034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrP"
FT                   /locus_tag="Dret_0239"
FT                   /product="membrane-bound menaquinol oxidoreductase,
FT                   transmembrane subunit"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG: dvu:DVU1286
FT                   reductase, transmembrane subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67541"
FT                   /db_xref="GOA:C8WZR6"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR6"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACV67541.1"
FT                   /translation="MLEKALYGDKRYWSWVIFLLALIGIGSTFYFMQLSQGLKVTGMNR
FT                   DVSWGFYIAQFTYLVGVAASAVMLVLPYYLHGYKKFKNMIILGEFLAIAAVIMCLGFIV
FT                   VDLGQPQRLMNVILHPTPNSILFWDMIVLNGYLILNIVIGWTTLQAERKGISPASWVKP
FT                   LVYLSIFWAFSIHTVTAFLYQGLPGRHYWLTAIMAARFLSSAFCSGPAILLLLALILKR
FT                   VAKYDPGKEAVQTLAKIITYAMCVNVFFFLLEVFTAFYSNIPGHYTPLVYLFSGLHGQS
FT                   ALVGWMWAAVVFAVVSLVLLIPPRFRNNPELLVLALVFLVMATWIDKGLGLIVGGFIPN
FT                   PFHGVTEYGPTGPELMIALMIYATGALVLTVLWKVAIGVKKEIGAV"
FT   gene            302392..302580
FT                   /locus_tag="Dret_0240"
FT   CDS_pept        302392..302580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0240"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvm:DvMF_2120 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67542.1"
FT                   /translation="MGFVVTVDAEKCTGDSECVDVCPVEVFEMQDNKAVPVNMEECLGC
FT                   ESCVEVCEADAITVEEE"
FT   gene            302894..303613
FT                   /locus_tag="Dret_0241"
FT   CDS_pept        302894..303613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_39580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67543"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR8"
FT                   /inference="similar to AA sequence:KEGG:DMR_39580"
FT                   /protein_id="ACV67543.1"
FT                   /translation="MLYDEDYFFGKYSQIAAGADAVFERVKADFPNEVRCATGCSDCCY
FT                   ALFDLTLVEAMALNKAFRETLDEATREKVLERANSADRQTVKIKREANHARQKGVAPEE
FT                   ILQELGTKRVRCPLLEEDNTCLLYNNRPITCRLYGIPMVSGGQTHTCGLSAFEPGGQYP
FT                   TVDMDKITDRLLALAQEFSQSIPTKFTQLGEVLMPVSMALLTEFDEEYLGIRPERLQES
FT                   ADGGPQEWVLGTGAEKE"
FT   gene            303617..303964
FT                   /locus_tag="Dret_0242"
FT   CDS_pept        303617..303964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67544"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZR9"
FT                   /inference="similar to AA sequence:KEGG:Dde_3773"
FT                   /protein_id="ACV67544.1"
FT                   /translation="MDQEAQKKAIYERLSTRRRKYVDRIGYDRWDPFQEPKDPIDIRRE
FT                   VTRRSAQDLARDFFAACTAEDQNAAYTNGVREMCKGIVASEDRCRGMYDFALWYHEQIK
FT                   AMGLEKEMWER"
FT   gene            304057..304683
FT                   /locus_tag="Dret_0243"
FT   CDS_pept        304057..304683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0243"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide repeat; KEGG:
FT                   dma:DMR_39600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67545"
FT                   /db_xref="GOA:C8WZS0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACV67545.1"
FT                   /translation="MSESQFDIEAYMKDQRERIAENPKDSVAHYNLATVLIGRGQLQEA
FT                   EDHLKQAIQADPELAEAYVQLGGLAMHRNDLAACMSFNQRATEIRPRFAVPQGNLGFVH
FT                   LQQGNVDQAVKHLKRAISLDPQFVQAIATLGNAYLMDGDVDGCIEENQKAIDLQPTFGP
FT                   AYNNMMLAYMEKGDFAKASAYCKQAEENGFEVAQKVKDDLAEHTA"
FT   gene            304913..306226
FT                   /gene="dsrA"
FT                   /locus_tag="Dret_0244"
FT   CDS_pept        304913..306226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrA"
FT                   /locus_tag="Dret_0244"
FT                   /product="dissimilatory sulfite reductase, alpha subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="KEGG: dol:Dole_2669 sulfite reductase,
FT                   dissimilatory-type alpha subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type alpha subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67546"
FT                   /db_xref="GOA:C8WZS1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS1"
FT                   /inference="protein motif:TFAM:TIGR02064"
FT                   /protein_id="ACV67546.1"
FT                   /translation="MAKHQTPLLDQLESGPWPSFVSDIKRESDARHTNEKGVEYQIPED
FT                   VCDDLLGVLELSFKDGTTHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTMRVNQ
FT                   PAGKYYTSEYLRQLCDLWDFRGSGLTNMHGSTGDIVFLGTRTEQLEEIFYELTHNLDQD
FT                   LGGSGSNLRTPACCLGESRCEWSCYNTQELSYHLTQEYQDELHRPAFPYKFKFKFDGCP
FT                   NGCVASIARADMSFIGTWADDIKIDQEAVQAYIGGEIAPNGGAHADRDWGKFDIQKEVI
FT                   DLCPTECMWMEDGKLKINDRECTRCMHCINVMPRALRIGDDRGLSILVGAKAPILDGAQ
FT                   LSSMLVPFIKAEEPYDEIKEVIENIWDWWMEEGKNRERLGELIKRQGFQKLLQSTGIKA
FT                   LAQHVQEPRHNPYIYWHEEEVPGGWDRDINEFRKHHQR"
FT   gene            306243..307442
FT                   /gene="dsrB"
FT                   /locus_tag="Dret_0245"
FT   CDS_pept        306243..307442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsrB"
FT                   /locus_tag="Dret_0245"
FT                   /product="dissimilatory sulfite reductase, beta subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="KEGG: dol:Dole_2670 sulfite reductase,
FT                   dissimilatory-type beta subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type beta subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; nitrite/sulfite
FT                   reductase hemoprotein beta-component ferrodoxin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67547"
FT                   /db_xref="GOA:C8WZS2"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS2"
FT                   /inference="protein motif:TFAM:TIGR02066"
FT                   /protein_id="ACV67547.1"
FT                   /translation="MAFISSGYNPDKPMENRITDIGPRKYTDFLPPVIKNNFGKWAWHE
FT                   IIEPGVLMHKADSGDEVYTVRCGAARLMGVHTIREICDIADKHCDGYLRFTTRNNVEFM
FT                   VDSKDKVEPLKQDLASRKFDGGSYKFPIGGTGAGITNIVHTQGWVHCHTPATDASGPVK
FT                   AVMDELFEEFQQMQLPAQVRISLACCLNMCGAVHCSDIAILGYHRKPPLVDDEYLDNLC
FT                   EIPLAVAACPVGAVKPKKKEIVGEKGDTKTVKTVEVNDDRCMFCGNCYTMCPSLPLADQ
FT                   EGDGVVIMVGGKVSNRISAPKFSKVAVAFIPNEPPRWPKLCEAIHTILNAYKEGARKYE
FT                   RVGDWAERIGWERFFEVCGLDFSHHLIDDFRDPAYYTWRQTTNFKFTEQSVKYPDIKAE
FT                   "
FT   gene            307505..307744
FT                   /locus_tag="Dret_0246"
FT   CDS_pept        307505..307744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0246"
FT                   /product="Dissimilatory sulfite reductase D"
FT                   /note="PFAM: Dissimilatory sulfite reductase D; KEGG:
FT                   dol:Dole_2671 dissimilatory sulfite reductase D"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67548"
FT                   /db_xref="InterPro:IPR014793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS3"
FT                   /inference="protein motif:PFAM:PF08679"
FT                   /protein_id="ACV67548.1"
FT                   /translation="MADEEIKQKILDELKAKSKNKSKFYFSDLQKMTGMKPREAKKIIN
FT                   VMVTDGDLVYWSSGSTTMYSLPGAGKQSAAEGED"
FT   gene            307756..309147
FT                   /locus_tag="Dret_0247"
FT   CDS_pept        307756..309147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0247"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; KEGG: dma:DMR_03630
FT                   putative Dsr related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67549"
FT                   /db_xref="GOA:C8WZS4"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS4"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ACV67549.1"
FT                   /translation="MSLHMPRLILAGLSGGSGKTILTLGLCRHFAQNGFVVKPFKKGPD
FT                   YIDASWMALAANRSASNLDPFLMDASLIRSLFADASQGADMAVIEGNRGLFDGKDIEGS
FT                   CSTAELAKTLRAPVILVVDCTKMTRTTAALVQGCHDFDPEVFLAGVVLNRTAGQRHRRI
FT                   ARESVERYTDVPVLGTLPKLRENPIPERHMGLVSDQEYEADGPLEELGRTIADWVDVER
FT                   IRDIASSTPELPVDTGVLWPEAVTRETVRIGVVRDAALWFYYQENIKALEHAGAEIVHI
FT                   SLLDDADWPELHGLYLGGGFPETLAPRLSAQEGIRQRVGDLARSGLPIYAECGGLMYLC
FT                   QELAYEGTVYPMAGLFPVRAEMGRKPQGHGYTKARVVLPNPYHPQGAEIPGHEFHYSQC
FT                   HTLRGETPPLAFFMERGCGIQEGFDGFVFQNTLACYTHLHALSSPHWAPNFVSAALAYK
FT                   TSLHG"
FT   gene            309578..309922
FT                   /locus_tag="Dret_0248"
FT   CDS_pept        309578..309922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dal:Dalk_2382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67550"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS5"
FT                   /inference="similar to AA sequence:KEGG:Dalk_2382"
FT                   /protein_id="ACV67550.1"
FT                   /translation="MGQLSNYKDLLIDWEMTPEEAVTLYLEWGNNHRRGERPPVRSKNE
FT                   HSNYFVVSNWENRPKVYLVRRNSDGAEELAELPLPPTLGEHFQQEVGGHRGVYPVNTEI
FT                   RQWLEKQLFE"
FT   gene            310174..310824
FT                   /locus_tag="Dret_0249"
FT   CDS_pept        310174..310824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67551"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS6"
FT                   /inference="similar to AA sequence:KEGG:Dde_3467"
FT                   /protein_id="ACV67551.1"
FT                   /translation="MDEPHCQRCGTCCRNGGPALHSEDAVLYRDQILQKKHLLTLRRGE
FT                   WVYDNVQGRVEPLEQEILRVAGKTGSQVCIFFQDSACACAIYARRPLECRTLNCQAPEA
FT                   LASLYAHERLTRFDLIAADSGLGELMTWHETVCAYSQIADVCARLRAGNDPKARQELEA
FT                   IVRKDINARQTLREKGALDEQSLRFVFGRPCTETLPAFGVRVVADRETVQFLV"
FT   gene            complement(310847..312124)
FT                   /locus_tag="Dret_0250"
FT   CDS_pept        complement(310847..312124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67552"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS7"
FT                   /inference="similar to AA sequence:KEGG:DvMF_2764"
FT                   /protein_id="ACV67552.1"
FT                   /translation="MAENLAARSGKSTIALFWGHSQLWGTLLWRGLNELGAEVLVLRGR
FT                   DIARGALQHHAPAALIVPGGWAKQRALHLGTEGREAIREYLRHGGMYVGFCGGAGMALN
FT                   AENTAESLHLCPCGRKPIADRLVNCSGHMALELATDHPLCPPEDQAPLTAPVWWPSQFD
FT                   VPDRAELTVLARYQAPQEDFWVADLPYRDIPDAHLPAWEDLYGINLNADILRGEPAVLT
FT                   GRVGAGRYIISYLHLETPGSPQANRWLGHILSWATGQALGSEIPEWEPSSLPRQWDDAT
FT                   LHAFLPLLEDCLSLGQRHFLLNWRRPWLLGWRRGLPGFHLSTLHGLAHQIQALPPTPQA
FT                   LRYWAFAAPRFHRLSLRFRDLMRSYLLMERYAATAHAGRSTPIRSGCEEAQAVREKLIG
FT                   PFPGQGGICGELTTVLENLLYYCLNP"
FT   gene            312574..315234
FT                   /locus_tag="Dret_0251"
FT   CDS_pept        312574..315234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0251"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: dde:Dde_2839
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67553"
FT                   /db_xref="GOA:C8WZS8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS8"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ACV67553.1"
FT                   /translation="MAEAHLSKGYEPKDVEDRWLDHWRENQTFSPDAELEDGQPPYSIV
FT                   IPPPNVTGTLHMGHALNLTLQDILCRYNRQKGKKVLWVPGTDHAGIATQNVVEKALAQE
FT                   GTTRQELGREAFVERVWQWKEEYGGKILNQIQRMGASVDWSRLRFTMDEGLSRAVREVF
FT                   VQLYEDGLIYQGNYIINWCPRCHTALADLEVEYAEKEGGLYEIRYPLASGEGHLVVATT
FT                   RPETMLGDTALAVHPEDERFSHLIGQTAIVPLVEREIPIIGDSYVDREFGTGCLKVTPA
FT                   HDPNDFELGRSHSLDSVRVIDDAGIMTEAAGSAYAGLDRFAARKQVVRDLEAQGALASQ
FT                   KKYLHNVGHCYRCDTPIEPTVSKQWFVAVGPLAKRARDAVADGKTRIVPGNWDKTYFEW
FT                   LDNIRDWCISRQIWWGHRIPAWTCQECGKLIVSREDPTVCPDCGHTSLHQDEDVLDTWF
FT                   SSALWPFSTLGWPDETQELATFYPTSVLVTGFDILFFWVARMMMMGLHFKDEVPFHDVY
FT                   IHALVRDEDGRKMSKSTGNVIDPLDMVAKYGTDALRFTLTAFAAMGRDIKLSEKRIEGY
FT                   RHFMNKIWNAARFALMHLPGDMGEPEPDPSDSLVHRWILHRLEEVKQAVGAALEEYRFN
FT                   DAAQELYQFVWHEVCDWYLEMVKPELYGEDEAAKNRARSVLHTVLREVLVLLHPTIPFI
FT                   TAEIWNSLPGVGERDLAVEPLPASRPHLEDSSVQESMEFVQEVVVSVRTIRGELNINPS
FT                   LPLTTLVRTNGEQADVLRGQEEVIRFLARIDSLQVDAELEAPKGAGTAVVRGAEIFVPL
FT                   EGIVDFDAELARLEKELAKLDKTLQGIQGKLANANFVNKAPAAVVDKEKAKAAELEEKK
FT                   AKMVTLQQRLQVMSG"
FT   gene            315245..316780
FT                   /locus_tag="Dret_0252"
FT   CDS_pept        315245..316780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0252"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4;
FT                   KEGG: dvl:Dvul_2236 uroporphyrin-III C- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67554"
FT                   /db_xref="GOA:C8WZS9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZS9"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ACV67554.1"
FT                   /translation="MACVYLLGAGPGDPGLLTLKAKRILETADVVVYDYLANKAFLNFC
FT                   RPEAEILYVGKKGGDHTLPQDKINDLLVEKAKAGKVVARLKGGDPYVFGRGAEEAEELL
FT                   EAGMDFEVVPGVTSAVAGPAYAGIPLTHRKYASSVSFITGHEDPDKPESAHNWQALAAG
FT                   TSTLVFFMGVKNLPHISSSLIANGMDPETPAALVRWGTTCEQTSLAAPLHAIAEEAQKQ
FT                   GMRPPALLVVGQVVRLRETLGWFEKKPMLGCRVVVTRAREQASSFLSLLEEKGACCLQF
FT                   PTIAIEALPDYGEVQEAIGTLAEYDWLIFTSVNGVIWFWKELQRAGLDSRALGGRQVAA
FT                   IGPATADKLREKGIEPDFVPEKYVAEHVVEGLLARGVAGKKVLLPRAEVAREVLPRQLR
FT                   EAGTEVRVLPVYRTGLAQQGEEEAQLLEDLQAGKVQYVTFTSSSTVENFFSRIPAETIA
FT                   PYVGTSLRLACIGPITANTLQQYGFTAQVEPEEYTIPALAQALEEDCLHFRGQ"
FT   gene            316828..317517
FT                   /locus_tag="Dret_0253"
FT   CDS_pept        316828..317517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0253"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: dma:DMR_44060 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67555"
FT                   /db_xref="GOA:C8WZT0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT0"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ACV67555.1"
FT                   /translation="MSEPMPLAVLVSGGGSNLQSLIDSIEAGRVPARIVLVLANTPDAY
FT                   GLVRAEKHGLPTAVVPHTAYPDRESHDRDVVAAIRAAGAEAVVLAGYMRLLSPFFIQAF
FT                   PQRILNIHPALLPAFQGLHGQHQAAEYGVKLAGATVHFVDEELDNGPIIIQAALPTQEG
FT                   DDGDTLAQRILHLEHRIYPQAVKWLAEGRLQIRKRHVVVDNAPDPGPAPGSDASVCLFA
FT                   PGLEPGM"
FT   gene            317658..318482
FT                   /locus_tag="Dret_0254"
FT   CDS_pept        317658..318482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0254"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: dma:DMR_16970 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; zinc finger Fpg domain protein; DNA glycosylase/AP
FT                   lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67556"
FT                   /db_xref="GOA:C8WZT1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT1"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ACV67556.1"
FT                   /translation="MPELPEVETIARGLDAALTGQHIASVHLRRDAVACGDAQRIREDV
FT                   PGRCIKRVWRRAKLLLVDCVPDRHLVFHLKMSGKLLLGGPLAGQEKHVQAWFGLQSGES
FT                   FVFQDVRKFGYIRLFDGAELAKWPFFASLGPEPFDLDGPGFARILSGRRARIKSLLLDQ
FT                   TVIAGIGNIYADEALFRAGIHPATPADRLSPGALNRLVYALHAALNKGFASGGSSLRDY
FT                   VDALGKRGSHQNEFQVYGRCGASCPCCGRCLERTTVAGRTSTFCPRCQPLSD"
FT   gene            complement(318494..319201)
FT                   /locus_tag="Dret_0255"
FT   CDS_pept        complement(318494..319201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0255"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: dvl:Dvul_0752 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67557"
FT                   /db_xref="GOA:C8WZT2"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT2"
FT                   /inference="protein motif:PFAM:PF00697"
FT                   /protein_id="ACV67557.1"
FT                   /translation="MAASRLPFHAPCIQIAGIRDEQEVRLLLEAEVDYLGFPFRLPVHA
FT                   PDLSEASAAELIRKTGIHARAVCITYETTPEAIVGLCHTLGVAAVQLHAPMPLGALQEL
FT                   RRLAPELGILHSLVIGRDPLDQLAQQLQRLAPFVDGFLTDTFDPTTGASGATGYIHDWQ
FT                   TSAAIVRAAPRPVILAGGLTADNVAAAIAAVRPAGVDAHTGVEDHAGRKDPDRVQAFVR
FT                   EARKGFALLKTQD"
FT   gene            complement(319289..319837)
FT                   /locus_tag="Dret_0256"
FT   CDS_pept        complement(319289..319837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0256"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: tdn:Suden_1179 tellurite resistance protein
FT                   TehB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67558"
FT                   /db_xref="GOA:C8WZT3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT3"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACV67558.1"
FT                   /translation="MDKDRTRWNDRYRNNPPPERVCALLPDHVPDGEGKTALDLAGGTG
FT                   ANAAFLADKGYQVYSVDIADAAIQRLQERGHPRIHPVQADLDTYRPPAERFDLVLTVRF
FT                   LDRRLFPYLAEALVPGGVLLIHTLLDDPRRDCPQMTSNRDHLLRPNELVRSFSNLRIVF
FT                   YREHFSDTECLASLVAYRD"
FT   gene            complement(319830..320102)
FT                   /locus_tag="Dret_0257"
FT   CDS_pept        complement(319830..320102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_03400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67559"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT4"
FT                   /inference="similar to AA sequence:KEGG:DMR_03400"
FT                   /protein_id="ACV67559.1"
FT                   /translation="MQDFRGTYYFPVPNNRQVKMYVRDHDGVIQFRLCNEQEPDVWQRH
FT                   GWLSYEDVRQASQMYEGELKDPLQFYDFEIAKHLLFGSEDPQKHG"
FT   gene            complement(320167..320829)
FT                   /locus_tag="Dret_0258"
FT   CDS_pept        complement(320167..320829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0258"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: dal:Dalk_1233 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67560"
FT                   /db_xref="GOA:C8WZT5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT5"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACV67560.1"
FT                   /translation="MPYSTVFFDLDGTLLNTLDDLADSMNSVLEHNGHPPHPVQAYRYF
FT                   VGKGMEALVRQALPEHARSPEHIRHCLAQMQDSYARNWANKTHPYPGVPDMLATLKARG
FT                   MRLNILSNKPQANTEETVAHFFDPDLFDAVIGARDNVPKKPDPTALLELMSSFGLDKSH
FT                   CLFVGDSAVDVRTGRAAEVLTIGVLWGFRDAPELTENGAQELIKSPDQLVQLLFPEH"
FT   gene            complement(320851..321921)
FT                   /locus_tag="Dret_0259"
FT   CDS_pept        complement(320851..321921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0259"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   dol:Dole_2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67561"
FT                   /db_xref="GOA:C8WZT6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT6"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACV67561.1"
FT                   /translation="MNLIREWFRRHFSDPQVVILALILISCILLIMTVGDLIAPVLASV
FT                   VLAYLLEGLVRFLENRRVPRMLAVCLVFLIFVFFLFFLVLGLLPLLSQQIVQFFQELPS
FT                   MLAAGQRELMRLPERYPKFITEDQILDVVAALKSQLTGLGQRVLSISLASVRSLFNLLI
FT                   YMILVPIMVFFFLKDKSKIINYIKMFMPKDYTLTRRIWHDVDRQIGNFVRGKVWEILIV
FT                   WGAAYGLFLIIDLNYAILLSFLVGISVIVPYVGATVMTLPVALVAYFQWGWGQEFIYAI
FT                   IGYTILQILDGNLLVPLLLSEVVNLHPVAIIVAILFFGGIWGFWGVFFAIPLATLVQSI
FT                   INAWPRAGQPQPPAPK"
FT   gene            complement(322105..323952)
FT                   /locus_tag="Dret_0260"
FT   CDS_pept        complement(322105..323952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0260"
FT                   /product="Carboxylyase-related protein"
FT                   /note="PFAM: Carboxylyase-related protein; KEGG:
FT                   dvu:DVU2320 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67562"
FT                   /db_xref="GOA:C8WZT7"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT7"
FT                   /inference="protein motif:PFAM:PF01977"
FT                   /protein_id="ACV67562.1"
FT                   /translation="MGYTNLHDCVHDLEAAGQLRRIDTEIDPRLEMGVIQRRAFQAGGP
FT                   ALLFTRVKGSGFPMLGNLFGTLSRTRFLFRDTLKRVETLVQLKVDPAETLRRPWRLGSL
FT                   PRALWHTRPMLRRSGPVLANTTTISNLPQLVSWPEDGGGYVTLPQVLSRSPRRADWQHT
FT                   NLGMYRVQLSGNHFVPDTEVGLHYQIHRGIGPHHTEALEKGESLPVNIFVGGPPAMTLA
FT                   AVMPLPENLPELFFAGLLGGHRPTLVQSEHHPLPLLAEADFCICGHVPPGALKPEGPFG
FT                   DHLGYYSLTHDFPVLKVDAVYHRNGAIWPFTTVGRPPQEDTVFGTFIHELTEPLVGSVF
FT                   QGVHEVHAVDAAGVHPLLLAIGSERYVPFASERQPQELLTNALSLLGSTQTSLSKYLFI
FT                   GAREDDSRLSTKDIPAFFRHILGRVDWRRDLHLITRTTMDTLDYSGISLNQGSKGIIAA
FT                   AGPDTNRLDSELPTDVSLPEGFSAPRCFAPGIAVLSAPRHTLPRDTQDPALDQLCRHLE
FT                   ESPADWSGFQLVVVVDASEEAANSWDDFLWQTFTRSDPATDSYGLGAFVQSKHWGCTGA
FT                   LVIDARLKSYHAPPLEPDPEVEKRVDELAAPGGPLHGLF"
FT   gene            complement(324013..324411)
FT                   /locus_tag="Dret_0261"
FT   CDS_pept        complement(324013..324411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0261"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   dat:HRM2_32730 FsxA"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67563"
FT                   /db_xref="GOA:C8WZT8"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT8"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ACV67563.1"
FT                   /translation="MLLRLFLAFTLIPVIELYILVKIGSVVGALNTILLVILTGFAGAW
FT                   LARLQGFQTMMRIRTNLAQGVMPAEEMVDAMIIFGAGLVLLTPGLLTDIFGLLLLFPPT
FT                   RGRFKAWLRRKFEDWIRQDRVHITYYHH"
FT   gene            complement(324577..324852)
FT                   /locus_tag="Dret_0262"
FT   CDS_pept        complement(324577..324852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67564"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67564.1"
FT                   /translation="MEPHNDDRFSDFQAKLDAIHDWPDTYTFKFIVPKNQVQAVCDLFE
FT                   ARDTVTTRPSRKGNYISVTAQTRATCSEEVISIYQAAAGIEGIISL"
FT   gene            complement(324962..325531)
FT                   /locus_tag="Dret_0263"
FT   CDS_pept        complement(324962..325531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0263"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: ppd:Ppro_2976
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67565"
FT                   /db_xref="GOA:C8WZU0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU0"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACV67565.1"
FT                   /translation="MPALIIIDMQEDFVLPHGSLCIQGAKDTVPRIREVLDGFRQRALP
FT                   IFHVVRSYRADGVDVEWPREQAFRKGHHAVVPGTPGARIVSELAPRPNEYVVTKKRFSA
FT                   FMHTELDLLLRRLHIRELAVCGTQLPVCVRCSVFDAIALDYRVTLIADGTSAQTEAIAE
FT                   ANRFDMANIGTRCLNAADYLSQLAGA"
FT   gene            complement(325641..326855)
FT                   /locus_tag="Dret_0264"
FT   CDS_pept        complement(325641..326855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0264"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: dma:DMR_33050 phosphoserine phosphatase;
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD- superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; amino acid-binding
FT                   ACT domain protein; HAD- superfamily hydrolase subfamily IB
FT                   hypothetical 1; Haloacid dehalogenase domain protein
FT                   hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67566"
FT                   /db_xref="GOA:C8WZU1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU1"
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /protein_id="ACV67566.1"
FT                   /translation="MHEIIQITISGPDRPGLSAALMEVLARYKTPVLDISQAVLHETLS
FT                   LGLLIEVPPEAESSPLLKDLLYQAHTLGVQLEFQPISAEQYEHWVQAQGKQRHIITLLG
FT                   RQLTAEHIARLTQIVFANGLNIDFITRLSGRLSLETIRHSPETACVEFSVRGTPHDKTA
FT                   MRAAFLEMSKDLEVDIGLQEDNAYRRNRRLVAFDMDSTLIQAEVIDELAKEAGAGEEVA
FT                   RITERAMRGEIDFEQSLRQRVALLAGLPEAALEAVSHRLPLTEGASRLIVNLKRLGYKI
FT                   AILSGGFTYFGNQLQTQFGIDYLCANELEIHDGRLTGGLSGPVVDGEHKARRLREIANR
FT                   EHISLEQVIAVGDGANDLPMLEMAGLGIAFHAKPKVRAGAQHAISNLGLDSILYFIGLR
FT                   DREAT"
FT   gene            327349..328302
FT                   /gene="hydB"
FT                   /locus_tag="Dret_0265"
FT   CDS_pept        327349..328302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydB"
FT                   /locus_tag="Dret_0265"
FT                   /product="periplasmic [NiFe] hydrogenase, small subunit"
FT                   /EC_number="1.12.2.1"
FT                   /note="KEGG: dde:Dde_2137 hydrogenase (NiFe) small subunit
FT                   (HydA); TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67567"
FT                   /db_xref="GOA:C8WZU2"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU2"
FT                   /inference="protein motif:TFAM:TIGR00391"
FT                   /protein_id="ACV67567.1"
FT                   /translation="MKCFVGMGKDGVEERLAERGVSRRDFMKFCAGVAAFMGMEASMGP
FT                   KIAQALTSKTRPSVVWLHNAECTGCSESVLRTVSPYIDELLLDTISLDYHETLMQASGE
FT                   AAEEALHHAVKNPNGYICVIEGGIPTKDGGVYGKVAGRTMLDMSSDIAPKAKAVIAIGN
FT                   CACFGGVQAAKPNPTEAKGVKAALGHLGVNPVNVSGCPPNPYNFVGTVVHYLTKGVPEL
FT                   DDNNRPMLFYGETVHDNCPRLGHFNMGEFAPSFDSEEAKKGWCLYELGCKGPYTFNNCP
FT                   KVLFNQTNWPVDAGHPCIGCSEPGFWDGMSPFYEYF"
FT   gene            328370..330070
FT                   /gene="hydA"
FT                   /locus_tag="Dret_0266"
FT   CDS_pept        328370..330070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydA"
FT                   /locus_tag="Dret_0266"
FT                   /product="periplasmic [NiFe] hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: dde:Dde_2138 periplasmic (NiFe) hydrogenase, large
FT                   subunit, isozyme 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67568"
FT                   /db_xref="GOA:C8WZU3"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU3"
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /protein_id="ACV67568.1"
FT                   /translation="MAGCKAQKAPAVPVTPQSSYSGPIVIDPVTRIEGHLRVEVEVDNG
FT                   KVSNVWSSSQLFRGLETILKGRDPRDAQHFTQRSCGVCTYVHALASTRCVDNAVGVKIP
FT                   ENAHLVRNLVLSAQYLHDHIVHFYHLHALDWVDVTSALKADPAKAAKIANNISPRVTKA
FT                   EDLKAVQQKLQSFVDSGQLGIFTNAYFLGGHEAYYLPPEVNLIATAHYLEALRLQVKAA
FT                   RAMAVFGAKNPHTQFTVVGGVTCYNSLTPERISEFKSLYEETRKFVEECYIPDLLAVAG
FT                   YYKDWGSIGGCTNFLSFGEFGNDDYSMADNYIPQGVIMNRNLGQVTDFDPNAIAEHVKH
FT                   SWYKDGPAKHPYEGVTEPQYTSLEDKDRYSWMKAPRYQGEAMEVGPLAHVLVAYARGHK
FT                   DTVEAVDYVCGQLGVGKEALFSTLGRTAARGIETLVTARKMETWINQLAENVSSGNNDL
FT                   YTPWEMPNEAEGVGFVNAPRGGLSHWVRIKNKKIENFQLVVPSTWNLGPRCGANKLGPV
FT                   EEALMGTPVVDPERPVEILRTVHAFDPCIACGVHVIDSKTNKVHKFRVL"
FT   gene            330432..330929
FT                   /locus_tag="Dret_0267"
FT   CDS_pept        330432..330929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0267"
FT                   /product="hydrogenase expression/formation protein"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein;
FT                   hydrogenase maturation protease; PFAM: peptidase M52
FT                   hydrogen uptake protein; KEGG: dvl:Dvul_1244 hydrogenase
FT                   expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67569"
FT                   /db_xref="GOA:C8WZU4"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU4"
FT                   /inference="protein motif:TFAM:TIGR00140"
FT                   /protein_id="ACV67569.1"
FT                   /translation="MSIETQRILVLGVGNILFTDEGIGVRAIEEMQSGYQFSENVTLMD
FT                   GGTLGTRLMDYIMESDYLIVVDAVLGDSDPGSVYRLTGEDLRQSLAFKNSMHQTDLVDT
FT                   LVYCDLAGHCPEAVVIGMEPADYETMAVGLSEPAQAALPHMMQRVAEEIRKAGATAEPV
FT                   SQ"
FT   gene            330945..331181
FT                   /locus_tag="Dret_0268"
FT   CDS_pept        330945..331181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0268"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: dds:Ddes_0384 hydrogenase assembly chaperone
FT                   HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67570"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU5"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ACV67570.1"
FT                   /translation="MCLAVPVRIESIENEMAVCSVGESGTTLKASLMLLEEEPQIGDYV
FT                   IVHAGFALRILDPQEAQESLQILREMAQVGQVV"
FT   gene            331286..332707
FT                   /locus_tag="Dret_0269"
FT   CDS_pept        331286..332707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0269"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: dma:DMR_18000 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67571"
FT                   /db_xref="GOA:C8WZU6"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU6"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ACV67571.1"
FT                   /translation="MDTPSPDSISAFADCRALILAGGSGTRLWPLSRTLLPKQLLPLNG
FT                   GESLLQQTVRRTLGVLPPEHVWVVTNEEHVFEVRNQLRTLDPLLDRQVLSEPQGRNTLP
FT                   AILLGLEPIVRDTPGAIVGVFPSDHMIGDQDGWEAAFGRAQGLARDGWFVTFGIEPNTP
FT                   ETGYGYIARDRALSDGCYAVDRFVEKPDVATAREFVDSGRYYWNSGMFVFGVQPFLEAV
FT                   QEYQPTLWQWWTGRDERSLTAGYASLPDVSVDYGIMEKVGNQAVVQADFDWDDLGSWEA
FT                   LYRLGEQDSSGCVVQGDVSALDCRDSMLYSQGGKLAAIGLEDMIVVQTRDATLVCSMDA
FT                   VQKVKNVVQDLKAEGSSLVEAHVTVYRPWGSYTVLEESPFYKIKRITVNPGATLSLQMH
FT                   HHRSEHWVVVSGTAEVHVGGEDKLLTENQSVDIPKTAVHRLANPGKVPVEIIEIQNGPY
FT                   LEEDDIVRLEDVYGR"
FT   gene            333097..333633
FT                   /gene="mopA"
FT                   /locus_tag="Dret_0270"
FT   CDS_pept        333097..333633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopA"
FT                   /locus_tag="Dret_0270"
FT                   /product="molybdopterin oxidoreductase, cytochrome subunit"
FT                   /note="KEGG: dde:Dde_2932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67572"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU7"
FT                   /inference="similar to AA sequence:KEGG:Dde_2932"
FT                   /protein_id="ACV67572.1"
FT                   /translation="MAKRKRGGALPFLLGLAAALIFGWWGFPQILYSQKDQPFRFSHEV
FT                   HEMQGMACSDCHYYREDGSFAGLPSLSDCTQCHFDVMTGDPAEKTFIEEYVYPEKEIDW
FT                   KVYQKQPDNVYFSHIAHDDYDCSRCHPDMAGRDDMPTYKENRITGYSKDTMKMWQCERC
FT                   HAENGASNACYVCHK"
FT   sig_peptide     333097..333198
FT                   /gene="mopA"
FT                   /locus_tag="Dret_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.632 at
FT                   residue 34"
FT   gene            333651..335717
FT                   /gene="mopB"
FT                   /locus_tag="Dret_0271"
FT   CDS_pept        333651..335717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopB"
FT                   /locus_tag="Dret_0271"
FT                   /product="molybdopterin oxidoreductase, molybdopterin
FT                   binding subunit"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: dde:Dde_2933
FT                   molybdopterin oxidoreductase, molybdopterin-binding
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67573"
FT                   /db_xref="GOA:C8WZU8"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU8"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACV67573.1"
FT                   /translation="MGLDRRGFLQFVIGGAVGTLATPVPWKLIDDSSIWTQNWPWIPKL
FT                   KYGAEGTVKTTVKLGGPEYGIAVNTVDGRPVTAQGDPDHPLSQGGIDPLAAGSLQLLYS
FT                   PARVKGPMHKAEDGSWSAISWKDAEALLAEKLKGAGDKVAAISGDETSTSNEILAGLLA
FT                   AVGSDEFYFMPSDGLSTQRTWTGFMNGEGRVGYDIENADFVLSLGADLMANWGAVIKNQ
FT                   KAFGQEDAFLFYCGPAQTKTASVAQGWIPVESKAMGHLALGLAYYCIQAGATFKGEGFN
FT                   AFKAFVEREYLPAKAEFKSGVGRNVLALLAEKMLAAKRPLAVPGTMAGEGAGSFELMAG
FT                   MALNLLLGNLNAKGGMQAVPEAPQVIPGAPKMAALRRKDVVSTLQDLAKGRGAVPDVLL
FT                   VHEANPAYGLPQAEEGRKALEKIPFVVSFSPFMDETAAMADLILPAPLYLERQDDSYSP
FT                   FGATEGLYSLCTPVVEPQADVKPAGDVVLAAAAALDIDLGAGSYEEALKAKAKALGAKW
FT                   RSLTRGEAWRSTKRSSQPALRIWHELLPASADQESNSNGNFPLALAAQDDLRAGTASSG
FT                   AAPLALKTLRADELDGNGMYVRLNGETARRYKLADGDAVEITGAYGSIRAQVKIFEGVM
FT                   PKTVAVPQGLGHTAWDAFNKGKGDNVFKVFTVRREPVTGLATWNDSRVGIAKI"
FT   gene            335730..336506
FT                   /gene="mopC"
FT                   /locus_tag="Dret_0272"
FT   CDS_pept        335730..336506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopC"
FT                   /locus_tag="Dret_0272"
FT                   /product="molybdopterin oxidoreductase, ferredoxin subunit"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_2270 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67574"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZU9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67574.1"
FT                   /translation="MSRDVHHHFEVRWGMVIDIDKCTGCGACMVACEAENNIPPSKDSF
FT                   DRLRTLHWLIVYELSNGKSYPNHDTAYLPRPCMQCGNPSCSTVCPVIATTKDEEGGIVS
FT                   QIYPRCIGCRYCMAACPYHSRVFNWYDPVWPEGMEKTLTQNVSVRPRGVVEKCTFCHHR
FT                   FAAAKDKARAEGRDPLHLKEGDYKPACLEACPTGAITFGDLNNPEHEVSKLAHSKHAFR
FT                   LLERLGTEPQVYYLSRREWVRRQGDNYLENEKERGE"
FT   gene            336510..337739
FT                   /gene="mopD"
FT                   /locus_tag="Dret_0273"
FT   CDS_pept        336510..337739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopD"
FT                   /locus_tag="Dret_0273"
FT                   /product="molybdopterin oxidoreductase, transmembrane
FT                   subunit"
FT                   /note="KEGG: dde:Dde_2935 molybdopterin oxidoreductase,
FT                   transmembrane subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67575"
FT                   /db_xref="GOA:C8WZV0"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV0"
FT                   /inference="similar to AA sequence:KEGG:Dde_2935"
FT                   /protein_id="ACV67575.1"
FT                   /translation="MRDAKFIPEGVERCSGGRFLIWLAFLGLFLAWGAYAAFQILWNGL
FT                   GVTGLDNYFGFGLWITFDLAVIALGAGAFFSGFLKYILRIDELENIINLAVIVGFLCYS
FT                   GAMCILALDVGQPTRAWFGYWHPNVHSMLTEVIFCITCYLTVLVIEFIPIILENRQLDK
FT                   VPFLHHLAHNFHIHMPLFAGIGTFLSTFHQGSLGGMYGVLFGRPFVFRDGFFIWPWTFF
FT                   LFILSAVASGPVFTMLIATLMEKLGGKKLVSFKVKSLMGKISGFMLVIYLFFKLLDTWA
FT                   WAAGILPGMGLTFDEMFNSVYGKWLLWAELGVCGVLPAVLLIVPSLRNQAWLLYIAALL
FT                   TCTGIVINRFVFTVQALAIPVMPFDNWYTYIPNWTEWATSIMILAYGAVVVSLTYRYLP
FT                   IFPQERQLNS"
FT   gene            complement(337891..338382)
FT                   /locus_tag="Dret_0274"
FT   CDS_pept        complement(337891..338382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll7773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67576"
FT                   /db_xref="GOA:C8WZV1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV1"
FT                   /inference="similar to AA sequence:KEGG:bll7773"
FT                   /protein_id="ACV67576.1"
FT                   /translation="MPVAFAILALMALALYLLARRRHDDSHRRGLRIGWRMGKGLLPLL
FT                   VCAFALAGLIQVALPPELIRAWLGEEAGLRGICIGTVAGALIAGGPYVSFPIIAGIYQA
FT                   GAGIGTIVALITGWAMLGVGQLPFEITLVGPRFTLVRLATVFLTPVAAGLLAQAIFGAG
FT                   "
FT   sig_peptide     complement(338323..338382)
FT                   /locus_tag="Dret_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.726 at
FT                   residue 20"
FT   gene            complement(338393..338953)
FT                   /locus_tag="Dret_0275"
FT   CDS_pept        complement(338393..338953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67577"
FT                   /db_xref="GOA:C8WZV2"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV2"
FT                   /inference="similar to AA sequence:KEGG:Hhal_1487"
FT                   /protein_id="ACV67577.1"
FT                   /translation="MRNTVLGMAVAVVVFAALALSRGGWPLLMHGLVLGGTMAVQVLPL
FT                   LIAAFAVAGLITVLISQDQVSRWLGRESGLKGILLAALAGALVPGGPYVYFPLAATFLL
FT                   AGAELGTVVAFVTAKNLWTLSRLPMEMALLNPEITLIRYAVTFVFPPLLGVLANALFAK
FT                   RTPAIRDGIRQLQHAGDSDSQSP"
FT   sig_peptide     complement(338894..338953)
FT                   /locus_tag="Dret_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.544 at
FT                   residue 20"
FT   gene            339230..340450
FT                   /locus_tag="Dret_0276"
FT   CDS_pept        339230..340450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0276"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   dol:Dole_2013 peptidase M29 aminopeptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67578"
FT                   /db_xref="GOA:C8WZV3"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV3"
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /protein_id="ACV67578.1"
FT                   /translation="MHYLTQDQLEKYADVLLWGLTKARAGEYAAGDVVLLRYDLDARPL
FT                   ADLLFHKSLERGWHPVPRMGLSPQMEKSLFTVGGDQQLEFIAPGDKEFMRRLNANIALL
FT                   APESLTHLKDVDSKRIGKTAIARKQLRDILDEREAEGQFGWTLCLLPTEELAANAGLSI
FT                   EEYTAQIIKACYLDSPDPVAEWERIYEQAGRIKSWLNSLDVDSFHVQSAHCDLTVTPGQ
FT                   DRQWVGISGHNIPSFELFLSPDWRGTQGIYYADQPSYRSGNLVQGVRLEFKDGEVVDVQ
FT                   AEEGEAFTKDQLDMDVGARRLGEFSLTDTRFSRIDKFMAHTLFDENFGGPYGNCHVAVG
FT                   ASYADTYALGAGALDKAKKEAFGFNDSALHWDLVNTEDKRVTARLKDGSTVLIYESGRF
FT                   AGPEEAS"
FT   gene            340546..341523
FT                   /locus_tag="Dret_0277"
FT   CDS_pept        340546..341523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0277"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dma:DMR_31000 hypothetical membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67579"
FT                   /db_xref="GOA:C8WZV4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV67579.1"
FT                   /translation="MCSLSRCDESAMNTPLVYVKLLATVSFWGGTFVAGRVLSQDLGPF
FT                   EAAFLRFLIASVFLVGLTLRVEKGLPRLPWRDVFVVMILGATGVFAYNACFFAGLQTVP
FT                   AGRAALIIASNPACIALVGALVLKQRLRALQAVGVGLCLAGAAVVISDGAPWQLWRGGV
FT                   GVGELFILGCVASWVAYSLVGKVAMHRLSPFAAVTYSCLAGTLFLAIPASGEGLWGHIW
FT                   QFSGLQWGCLAYLGICGTGLGFSWYYQGIKAIGPARASVFINFVPVTAILAGFVFLDET
FT                   IGASLIVGALCVGVGVYLTNRFSMAEHEPKVQGAVAKGPAEELA"
FT   gene            341578..342225
FT                   /locus_tag="Dret_0278"
FT   CDS_pept        341578..342225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0278"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A, putative"
FT                   /note="KEGG: dvu:DVU0579 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67580"
FT                   /db_xref="GOA:C8WZV5"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV5"
FT                   /inference="similar to AA sequence:KEGG:DVU0579"
FT                   /protein_id="ACV67580.1"
FT                   /translation="MADAVPPVAGVVLAGGKSSRLGLDKAEVQFRGVNLLDRAVAVVQN
FT                   VASEVWIAGRCPLGWVGPWLQDEQPGLGPLGGILTALRAIRKPLLVISCDLPLLGPATL
FT                   DQLLSTRREQLTDQAMTTFWQKETGFIEALVAVYEPEAEPLLEAARANGIYKLSRAIPF
FT                   EKRLHIPYSQVDALPFFNVNYPADLALLRFYEQHGKDALQEYLRAKEEEETS"
FT   gene            342354..343238
FT                   /locus_tag="Dret_0279"
FT   CDS_pept        342354..343238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0279"
FT                   /product="formate dehydrogenase accessory protein"
FT                   /note="PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   dde:Dde_0706 formate dehydrogenase formation protein FdhE,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67581"
FT                   /db_xref="GOA:C8WZV6"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV6"
FT                   /inference="protein motif:PFAM:PF04216"
FT                   /protein_id="ACV67581.1"
FT                   /translation="MAFQLEREQRRLERKIEALRGREDLPEPVVDLVAALARLQLEAIS
FT                   TAEAEVPSKQDMASAEMVLQGAPLWPRESFAVDLKQSRELAGKVLDLLAETGERNADAA
FT                   ATLRRALESGELDWAEAVNKLIMADDSFFQTWAEQTPDAPDALRFVIQASITPSLQAVA
FT                   MGVDEQREKGTWIHGHCPVCGSLPLIGHLEGKEGQQHFTCAFCRTAYRSKRLMCPFCGE
FT                   QDHTKLSYFYADEEPGFQVHVCESCKMYFKDVDFRELDRTSVPVLDDLESLVMDMLAQE
FT                   KGYVRPVPSAWGF"
FT   gene            343344..344528
FT                   /locus_tag="Dret_0280"
FT   CDS_pept        343344..344528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0280"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: mca:MCA2125 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67582"
FT                   /db_xref="GOA:C8WZV7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV7"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ACV67582.1"
FT                   /translation="MASDVKPPVRPKDRFLVFGAPQIKQAEIDEVVDSLKSGWLGTGPK
FT                   VARFEQALREYVGAPYAAAVNSCTAALHLALIAAGVGPGDEVVTTPLTFCATVNAILHA
FT                   GATPVLADVDPKTMNIDPVRVAGRITPRTKALLPVHFAGRPCDMDSLVDLARQHNLQLI
FT                   EDCAHAIETEYHGQKAGTFGDFGCFSFYVTKNVVTGEGGMVTARDEEAIKRIKMLALHG
FT                   MSADAWKRFSDEGYKHYFVAEAGFKYNMMDIQAAIGIHQLDRVEANWQRRCAIWDRYVK
FT                   AFADLPLTLPTAPEPQTRHARHLFPLLIDTDRAGISRDGFLSAMHAQNIGTGVHYLSLP
FT                   EHPYYQERLGWTPEDWPNAMRIGRQTVSLPLSARLSDADADDVIRAVRRVLDRE"
FT   gene            344557..344709
FT                   /locus_tag="Dret_0281"
FT   CDS_pept        344557..344709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67583"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67583.1"
FT                   /translation="MACTTRPCMEDCLSAGESRYRLAAVRVDASQAPVSQGSLFCIFLI
FT                   PIGIF"
FT   gene            344824..345876
FT                   /locus_tag="Dret_0282"
FT   CDS_pept        344824..345876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0282"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   dvu:DVU0998 heptosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67584"
FT                   /db_xref="GOA:C8WZV9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZV9"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACV67584.1"
FT                   /translation="MPKNTPLADLQPRRILVCQLKQIGDVILATPTIQLLKKRWPEAEI
FT                   HVLTESKCAPVLEHHPALHTIWPIDKAALRPFWKALAYYRRVAGQGFDLIVDLQQLPRC
FT                   KYVVALSKAPVRLSYPPPWYNRPLYTHWAQPQHGYAARFKASFLAPLGITWNDERPRMA
FT                   LTREERSWAEHFVRDKGLKAGERLIVAAPSHKAANRRWPAANYGEVIRLAGQERPDWKW
FT                   LLVYGPGERATAEAVRAAADNAPVLLPFEDIFDLRRIAALVDRADFFLGNCSAPRHMAV
FT                   ALDTPSLAVLGASSTAWTFPSPEHEDIASGLSCQPCNEEGCRFDGVPCLRDLTALTVWQ
FT                   RLSQRFDLLS"
FT   gene            345965..349153
FT                   /locus_tag="Dret_0283"
FT   CDS_pept        345965..349153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0283"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; zinc finger SWIM domain
FT                   protein; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein; KEGG: dvm:DvMF_0789 non-specific
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67585"
FT                   /db_xref="GOA:C8WZW0"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW0"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACV67585.1"
FT                   /translation="MVKGKHMPAESKNVWQKQLSEYFRKHIRNRGNTYFREGRVRLRQA
FT                   TATSVKGTVDGGQSYTVHLIAEEDGFRVYCSCPYFSQGGACKHLWAAIRAADAKLAERA
FT                   AASRSKRDPQSQYTSWRQVWGEEENTASSQCVPMPGEFCPFYGLERFSQRWYLQVWQRY
FT                   ICKDGSIGRRQSNITYRLLEKGLLSEPDRRIIQWMFESGASFLLSARALGAEQLSYLLP
FT                   LLAKTERCAIYHNDSCVVEQFKLGRPMTAAARYQGKLVGKEQDLFLSRVLVLGEQEVAP
FT                   DNVAVFFPTEPFFVIHNSRLYALREEVGTDIQAVQANQPIQVPRAELPQFLETVARAGE
FT                   LESFSLPQEIAPERIAPEHIRPCLTLVPQREALLGLVSFYYGDREVAAHSGIRNVFDAQ
FT                   HWAYIERDDTVEASAWSALQAQGFEHTGEDGVRRAWEENMAEALHTLRQQGWLLQAQNK
FT                   QRVKTGSVSNVQITSGQDWFDLSADVDFEGQELMDLPAVLQAYKDRQRFVVLDDGSLGM
FT                   LPEKWLADNGLALQLGRTATRKEAAEDNPSKDALRFTTGQGVLLDSVAQTTDHVREDEQ
FT                   FSRYREKLHDFKGLRSVTPPQGLQATLREYQQQGLSWLAFLEEFGLGGILADDMGLGKT
FT                   IQVLAHLLQAKERGASGQALVVAPTSLALNWASEARRFTPELAVHLHTGPQRFACEEAW
FT                   ETADVVVTTYGLLRQDTVFLAQREFAHLILDESQAIKNAQTQTAQCARQLQARHRLCLT
FT                   GTPLENHAGELWSQMEFLNPGLLGSLKTFEEVWSEAQQSNTPEKWQQLHRFLRPFLLRR
FT                   TKEEVMADLPEKMEQVVSCSMTPQQAKLYSEIRDHYRAQVLSRVEEKGLAQSKMHVLEG
FT                   LLRLRQVACHPKLVGGNGQYESGKLQELRERITAVVGSGHKALVFSQFTRFLRLIKDML
FT                   ESEGIAYCSLDGRTPAKRRQERVARFQDVDGPPVFTISLKAGGTGLNLTAADYVFIADP
FT                   WWNPAVEMQAVDRTHRIGQDKTVFTYRFVTEGTVEEKIRTLQNQKQELVQSVLSGSKGV
FT                   LKELSREDLEVLLS"
FT   gene            complement(349660..350223)
FT                   /locus_tag="Dret_0284"
FT   CDS_pept        complement(349660..350223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67586"
FT                   /db_xref="GOA:C8WZW1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW1"
FT                   /inference="similar to AA sequence:KEGG:MCA0837"
FT                   /protein_id="ACV67586.1"
FT                   /translation="MDDTIPLLRGNRRSIRLNGYDYTQAGAYFVTLCVRGRRCLFGQIH
FT                   NEAMVLNRIGQMVQEEWIQSANIRREIELDVFVVMPNHLHGIVVIANMENRDGSDESSL
FT                   RKHISRMPIPPASQSLGAFIAGFKASVTKRYNCLKGGGDGPVWQRNYHDHIIRNEEDLR
FT                   VIREYVAMNPICWEKDGFHPVFGG"
FT   gene            complement(350712..352922)
FT                   /locus_tag="Dret_0285"
FT   CDS_pept        complement(350712..352922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0285"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase STT3 subunit; KEGG:
FT                   dvl:Dvul_1810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67587"
FT                   /db_xref="GOA:C8WZW2"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW2"
FT                   /inference="protein motif:PFAM:PF02516"
FT                   /protein_id="ACV67587.1"
FT                   /translation="MKKLFFTKLLIVCFLTYVAGLFLRFWELPLWLDASYWVAGEPLMA
FT                   THDAYAWMAGAKGAGRLVGRPMSELLAGLHALTGLNVGVINFWLPAICAPLAAIPVCLL
FT                   CAYWRRPEAGLAAGVMASGSLGFLLRTRLGFGDTDILTLFLPLLFVAALVYWLTPFLSQ
FT                   NWGQVFPFRKPSSQTSKKKNADAPERELLFSGPRFYWAAFGAGLIFLAYSWFYPNAYPI
FT                   AMYVLITAVGVACLLNRSLPWQDFWAGLAVVLALGKLGWVGLIIGGGITWLGLQRPDII
FT                   RTRFTGTALLAGVLVLFPVFHGAAVVTKLIEPALSYAKINLSRETESLLKLPTVKQSIR
FT                   EAQNIDWLAIMDRLAGHWALFIPALLGTAWMVIKRPLALSLLPLLGLSILSFKLGNRFA
FT                   MYGGPVLGLGLGFGTVSLLSTMSSKRTILWFGALCVAFVASCPLSNTADMLRPGPVIPK
FT                   IYAQTFMELAENTPQDAQLWQWWDYGYAAQYYAQRRSFGDGGAHSGPHLYPLAKIHSTN
FT                   SPAKAAQLMRLIGAHGKEQRLECQHNGTKPQNPGASVLYYPTKPLAPLEAMGPEKAQDF
FT                   VDTLDAGTDLTLPEQPDPQYFVLSWENLRLAYWITYFGNWNLETGNSFHGRVQRVRRQA
FT                   QFDLQQGVLQTTDRQVPLVSLDVIDESGRNHRSWPNSGNIHAVLNQLSRELYIMDDTVY
FT                   NSLLVQMLIGESDQFAPHFELVQDRFPWTRVYRVSAADTSGQ"
FT   gene            complement(352968..353762)
FT                   /locus_tag="Dret_0286"
FT   CDS_pept        complement(352968..353762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_4582 sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67588"
FT                   /db_xref="GOA:C8WZW3"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67588.1"
FT                   /translation="MIFWNISNRRTRIKNADIFFISLGKSGRTWIRTFVNKYFSIKYNT
FT                   PFHLYLTDETEKEWKNIFFTHELWEHYTKATFPQRLTGKYIIPNKYLRSKKSIFLYRDP
FT                   RDIVTSLYYQMTKRSSSSQSFSKHEFIRHEVYGIQNIISTLNKWHARLYGLNNSLWNSY
FT                   ENFLLDPYTNFFNLAYFIESKHPQMDAFEQSLSFSDFKNMQNLEKNDSFNTSILRPKNI
FT                   NDPNSFKVRKGKIGGYLDEFSDEDINYMNHELQNLHPFFNYK"
FT   gene            complement(354987..356234)
FT                   /locus_tag="Dret_0287"
FT   CDS_pept        complement(354987..356234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0287"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: dat:HRM2_25350
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67589"
FT                   /db_xref="GOA:C8WZW4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW4"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACV67589.1"
FT                   /translation="MRNIFKNNYIEPVYVSFFLISFSIIPFWYHGIEKTRYILLFLFAI
FT                   ILYKNSKIISYLIKNTFTYLLLAFSFFVFISLQTNNISLTNLDEVLNWAITFYLTITAS
FT                   IILKDKEKYILYSLIISVFLFFIISNLLFFLNIAEENQNSHIYFQNLFDFNYLHLALVF
FT                   GATSIINIVFLTQSKSYGLKFFHFLAFLASAFMLIKTTSRGVIGGCALSASIYYFYHAK
FT                   LNSKHILIFILIAFSFSIILFKTPQGIRTKNEIIQTFTATEKDKSLRMRFFLWYASFKS
FT                   FLDKPFSGNGFENFRNTYEKQYHIYKNNKKLQKKFPLVKSSDKNAHNFFLHFLLETGIF
FT                   GTLAITLFFCSIIFYGFNRFSMTSIASALALITSLVHYQVNMDLYSPLPSTLTFTLCGV
FT                   IAGSHIKKQLQIPQTL"
FT   gene            complement(356239..357354)
FT                   /locus_tag="Dret_0288"
FT   CDS_pept        complement(356239..357354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0288"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   geo:Geob_2965 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67590"
FT                   /db_xref="GOA:C8WZW5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67590.1"
FT                   /translation="MNICRLTNNLNIGGVQKRLFTLLPLLAEEHKVTCITYKEKGYYYE
FT                   KLPNLGVNTFFHPIKSKTNIKDIIKLKKKLQSHNTDIIHTHSLGANIPGILAGALAKTP
FT                   VKIAQVHRKNYHWYAKNSIQRKKQICLESMVHRMFTDKILFVSKESLDYFQKKTKISNK
FT                   KLKILHNGIEIPNHTTNKRKYRKELNIPPEKKAIAFIGRIGKGKGLDFFIDFALNALHH
FT                   SSDFVFLVIGDGPEKKHYENIIAKAEKTGNIIFYGTQSNVSKFYESIDLLLFTSEPGAE
FT                   GMSGVALEACSFKVPILARKTEPLTELKQYYNNITFINEEEKPSLNIHRALEKRLNTYD
FT                   KFINEFSLNNMHYKTIQLYNKLLSKNQQMKR"
FT   gene            complement(357323..359125)
FT                   /locus_tag="Dret_0289"
FT   CDS_pept        complement(357323..359125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0289"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="KEGG: dde:Dde_1960 lipid A export ATP-
FT                   binding/permease protein MsbA; TIGRFAM: lipid A ABC
FT                   exporter, fused ATPase and inner membrane subunits MsbA;
FT                   PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67591"
FT                   /db_xref="GOA:C8WZW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW6"
FT                   /inference="protein motif:TFAM:TIGR02203"
FT                   /protein_id="ACV67591.1"
FT                   /translation="MKLQDQPETSSSWQLAKRTFSYFAPYKVRIVLAMLAMIVVAACSG
FT                   ATAFLVKPALDDIFIAKDKTALALIPALIVGVFLLKGAARFLQNYEMNVTGLKVLEKLR
FT                   QQLYDKMLCLPVRFFDDNQVGNLMARILNDVTQVRSSLPALVTLSREVLTMVGLLIVVF
FT                   YRDPFLASIAIFVLPLAMYPFYFFGRKIRKLGRRNQAKISNISTFLQEIFSGVKVVKAF
FT                   AMERREAKRFEAENSRLVSIATRQVVYNEMSSPIMETIGALGMGLVVWYGGKQVIEGAS
FT                   TPGTFFSFMTALIMLYDPVKKLNKANLTIQKALAAAERIFDILDNPQICEEQSGRIEYA
FT                   PPFQGLAFENVTFHYPDSATPALEHVTFRIEPGEQIAIVGPSGGGKSTLINLIPRFHDP
FT                   TEGQIVLNGHPVQDYTLASLRRNLGIVSQDNFLFNASIRDNIAYGQEDIDPSKLEKAAQ
FT                   AAYAHDFISNLPNGYETIIGERGVKLSGGQRQRIAIARALLKDPDLLILDEATSALDTE
FT                   SERIVQQALENLMQHRTSLVIAHRLSTVLKADRIIVMQDGKVIDQAPHSILIQRCYLYQ
FT                   RLYNMQFKNNERQKNEHLQTYQQP"
FT   sig_peptide     complement(358979..359125)
FT                   /locus_tag="Dret_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.795 at
FT                   residue 49"
FT   gene            complement(359338..360306)
FT                   /locus_tag="Dret_0290"
FT   CDS_pept        complement(359338..360306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0290"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   smt:Smal_2837 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67592"
FT                   /db_xref="GOA:C8WZW7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW7"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACV67592.1"
FT                   /translation="MPITWRSIPILCYHNTCGPDGHDQAQLAAHLDCIRDMGFATLTTR
FT                   EIVDIVTGTTRLKRPAVGITFDDGHVSNWLYALPLLQQRGMRASFFVCSDFSSDGPARR
FT                   TEEIPHLLGGAQSFYQATVLGDTSQFCTTTELYHLAHTHGMDVLPHSARHAFCFHETAP
FT                   RPQAREIHWGAHLVYGRDVTYEDLPCPKGGSAYAHSGWWPQETQKGIRWTSRSEQERYR
FT                   FCREDFTRCKTRLEAILKQPLDIFCWPWGEYDQVAERALKDTGFQAALTLERGRVERGT
FT                   NPMRIGRLSVSPRKSLSWLKSRLRLMRFAPSAGLTYKNGSL"
FT   gene            complement(360297..361427)
FT                   /locus_tag="Dret_0291"
FT   CDS_pept        complement(360297..361427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0291"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   dvu:DVU2635 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67593"
FT                   /db_xref="GOA:C8WZW8"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67593.1"
FT                   /translation="MLSGTSPQRIALMLPRLSRYGGAERFASRLANHLGQTGFDVDFIC
FT                   ARQESEAPQGVTPRVVGRKGLCRSGKILWYAMAAERQRRAGNYDLTLSMGKTWNQDVLR
FT                   LSGGPLPVFWRLSKQAYDPGMARTWKMLRRKTAPANRLINCIERRQMRTTSHFVAVSDK
FT                   LVDWVQEAYPSFDTSRIQVIYNQPDLTAFEPYPRAKQRAERQQRGLAPDMIYIGTAGTN
FT                   FALKGVGCLIAALAQLPDSHHLLVAGDRNPDRYRKQAQRLGVAHRVTFLGRVEDMTGFY
FT                   NCLDAFALPTFYDACSNAVLEALRCGIPTLSSSANGSSVFLDPENTIKDPHDTQNLART
FT                   LRRLCAEPRRNAFAWPNHIRAGLEAYTELIETALCR"
FT   gene            complement(361500..363233)
FT                   /locus_tag="Dret_0292"
FT   CDS_pept        complement(361500..363233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0292"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: dde:Dde_2715
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67594"
FT                   /db_xref="GOA:C8WZW9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZW9"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACV67594.1"
FT                   /translation="MPNTQWIFREQPASEKTAEFSTWAKQLEISPFLCDLLWQRGLSSP
FT                   QEMDVFLSPGLRHLAPPHTWSGLNEAAAVLAAALEQDTGPLAVWGDYDVDGITATALVT
FT                   EILRGRGYAVLPHLPNRMEDGYGLNTAGIEALYDQGVRALLTVDCGMGDLEAITRAKEL
FT                   GMRVVVSDHHQPHATLPPADAIVNPCVDACPCPELAGVGTAFFLMAALNRLLPGTPSDL
FT                   RPSLDLVALGTIADVVSLRGQNRIVAKNGLLLLSEGSRPGIYALKEASRLPGKAPIGAG
FT                   QVAFGLAPRINAAGRMGSATEALDLLLAPDLATAQPLAAKLEAANQERRTCEDGILEQA
FT                   VTQVEERGVTEGLVLADAQWHQGIIGIVASRVVERFYRPTILLTRHNGYWKGSGRSIVD
FT                   VDLHAALTECADLLAGFGGHPQAAGLSLTEANLKPFTQRFSQAISKQLGGAEPLPRLKL
FT                   DGHIPFGQIDLDLIREIELLQPFGMGNPQPVFCSEPLQVQKHNVFGKKHVSLQLQDPKS
FT                   GIVLTGKAWRQAEALTPSIQGETVQLAFTPRLNHYQGLTSIDLDIKDWRLPHDREAANS
FT                   N"
FT   gene            complement(363508..364209)
FT                   /locus_tag="Dret_0293"
FT   CDS_pept        complement(363508..364209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0293"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: dvl:Dvul_2083 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67595"
FT                   /db_xref="GOA:C8WZX0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX0"
FT                   /inference="protein motif:TFAM:TIGR01740"
FT                   /protein_id="ACV67595.1"
FT                   /translation="MAELIAALDFPDAETAFAAVTPLRGELDWVKVGLELFTAAGPSII
FT                   FRLKELGFRVFVDLKLFDIPNTVQGAVRSLTRSGADMCTLHLLGGQAMAQAALAGREEA
FT                   TGQTGGPLLFGVTLLTSMDITDLPGTTATNSGRFALDLAGNAADWQLDGVVCSGHEVRA
FT                   IKQADPRLACLTPGIRLKKSADDQKRVMTPEKAVHAGSNFLVVGRPIFTATSPVEMVRT
FT                   IRKKMTLEFRD"
FT   gene            complement(364202..364840)
FT                   /locus_tag="Dret_0294"
FT   CDS_pept        complement(364202..364840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0294"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: dvl:Dvul_2084 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67596"
FT                   /db_xref="GOA:C8WZX1"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX1"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ACV67596.1"
FT                   /translation="MSHPERPGILLVLSAPSGTGKSTLIHRLTAEFPDFAFSVSYTTRA
FT                   PRSGEIDGRDYHFVDKDRFYELAEQDFFAEWAEVHGNCYGTPRQATLDMLSAGRHVLFD
FT                   IDIQGARLLKANLGQGHFVFLLPPSRQELEQRLRRRGSDNEEAIARRLENARQEIAAAR
FT                   EFDSWIVNDDLERAYDSLRAVYLALTTRPAAQPQLPETILASWQEPQHG"
FT   gene            complement(364827..365093)
FT                   /locus_tag="Dret_0295"
FT   CDS_pept        complement(364827..365093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0295"
FT                   /product="protein of unknown function DUF370"
FT                   /note="PFAM: protein of unknown function DUF370; KEGG:
FT                   dvm:DvMF_1139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67597"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX2"
FT                   /inference="protein motif:PFAM:PF04025"
FT                   /protein_id="ACV67597.1"
FT                   /translation="MTKQRLLNIGFGNYVVGSRIVAIVNPNSSPMRRLREDAKEAGRLV
FT                   DATQGRKTRSIIVTDSNHIVLSAIQADTVGQRYASEEDEDVAS"
FT   gene            complement(365270..366151)
FT                   /locus_tag="Dret_0296"
FT   CDS_pept        complement(365270..366151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0296"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="PFAM: domain of unknown function DUF1732; YicC
FT                   domain protein; KEGG: dvl:Dvul_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67598"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX3"
FT                   /inference="protein motif:PFAM:PF08340"
FT                   /protein_id="ACV67598.1"
FT                   /translation="MPKSMTGYGRWSGQSAALAQTWEIKSVNGKQLSIRWKMPQFLSMM
FT                   EQEWEKQVRETAERGRIDIQLHLHIFEAEELSPKLNSWIAQSMLDQLRQLAEANGETPE
FT                   LDYSHLLRMPSLWEEPDQTPPQEILDSLQTGLEMALSAWNDSREREGQAMIADLQNRLE
FT                   TVTNWVERIAERVPTLPEQRFALLKQRAEALLQEQSPSLSQERLHQEFALLTDRIDVSE
FT                   EITRLQTHLQELQRRFAMETPSGRHMDFVLQECFREINTCGNKAQDSEVSRLVVNVKTE
FT                   LEKCREQVQNIE"
FT   gene            complement(366376..366948)
FT                   /locus_tag="Dret_0297"
FT   CDS_pept        complement(366376..366948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_32830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67599"
FT                   /db_xref="InterPro:IPR025529"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX4"
FT                   /inference="similar to AA sequence:KEGG:DMR_32830"
FT                   /protein_id="ACV67599.1"
FT                   /translation="MSTPKSAPKAVLVIPVLTSVWQTVWPTLRPRLEAHFGPVHDFGDA
FT                   LFFTHTTYYNTELGTPLYRRLLYADRFYPQDRLAEAKLVTNALEDAFRDAEGNRRINLD
FT                   PGLLSLERLVLATGKGFTHRIYLKEGIWADLTLMYQKGGWRAFDWTFADYADAPLQAWL
FT                   TRLRDEYKQARKQTSQTGVESFSGLKT"
FT   gene            complement(366998..368293)
FT                   /locus_tag="Dret_0298"
FT   CDS_pept        complement(366998..368293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0298"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: dde:Dde_2722 hypothetical protein; TIGRFAM:
FT                   RNA modification enzyme, MiaB family; PFAM: Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67600"
FT                   /db_xref="GOA:C8WZX5"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX5"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACV67600.1"
FT                   /translation="MSEPRFALHTLGCKVNQYESQALREAWLQRGYREASTDEVPEWIV
FT                   VNSCAVTSGAVQDTRKLVRKLHRNHPEAAIVVTGCAAQVFTEEMAALPGVLRTVPQQAK
FT                   ADLCVGPDALHFACREADHFPEFPVTASSRARGLLKVQDGCSHGCTYCIVPHTRGPAVT
FT                   RSPEKSLAEARHLFRGGLRELSVSGINLRQYGRDLTPPLDFWDFLAWLDANLATEWAGR
FT                   ARLRLSSLEPSELTDKALDTLRRCRLVAPHLHLSLQSGSPEILRRMGRGHYHPDTIRTF
FT                   VDRLQEIWPHFGLGADFLLGFPGEDDAAFETTAALVRDLPFTYGHVFPYSPRPGTPAAT
FT                   FTDQVAEPIKRERCAILRSILEDKRTAFLQQQAQRDHIPFIVEKHPAQGISDTYVPCRE
FT                   ISGAAPAVRSLVQARPVGWDDKGLLVQLETTA"
FT   gene            complement(368298..369347)
FT                   /locus_tag="Dret_0299"
FT   CDS_pept        complement(368298..369347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0299"
FT                   /product="tRNA(5-methylaminomethyl-2-thiouridylate)-methyl
FT                   transferase"
FT                   /note="TIGRFAM: tRNA (5-methylaminomethyl-2-thiouridylate)-
FT                   methyltransferase; PFAM: tRNA methyl transferase-like;
FT                   KEGG: dma:DMR_17320 putative tRNA uridine-
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67601"
FT                   /db_xref="GOA:C8WZX6"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX6"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ACV67601.1"
FT                   /translation="MRTAVAVSGGADSLFALLALREAGHDVLALHAHFLAPDAVDADVQ
FT                   DRLRHCCKTLGVDLEIVDLHHKFAELVITPFIEHYAQGMTPNPCALCNPRIKFGILRDA
FT                   AKQLGCKGFATGHYVRLLQTPNGPLLCRGNDPRKEQSYFLSLVPQASLDNVVFPLGTRH
FT                   KSTIQGELEQRGFTIPESEESQEVCFIPDDDYRSFLQNTGAPLSGPGPIVDRAGNQLGH
FT                   HSGLWRYTLGQRRGLGIAYSEPLYVIDKEIRSNRLVVGTRAERQATGCSVHELNTLLPF
FT                   EKWPDQIWVQTNYRQQPVPCRIRIVSETGMEISFLEPKGPAAPGQVAAFYTAKGYVLGG
FT                   GIIHDSTRT"
FT   gene            complement(369509..370978)
FT                   /locus_tag="Dret_0300"
FT   CDS_pept        complement(369509..370978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0300"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: dma:DMR_17330
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67602"
FT                   /db_xref="GOA:C8WZX7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX7"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACV67602.1"
FT                   /translation="MQTTSLIQLRDALRCGDISAENAVNTCLDRIRTTEPVVQALVHTD
FT                   AENALNTARSLDAQGPSADMPLWGVPIILKDLLATKGQPTTCCSKMLENFTPFYNAHVV
FT                   DRLQQAGAIVLAKSNMDEFAMGSSTENSAVQQTKNPWDTTRVPGGSSGGSAAAVAAGQA
FT                   PGALGTDTGGSIRQPAGFCGIVGLKPTYGRVSRYGLVAYGSSLDQIGPMTRCVADSAAI
FT                   LQAIAGHDPKDSTSVAIEVPDYTAALEQTTDLSGWRIGVPREYWGDGLSDEVAETCRAF
FT                   LDQAREHGAELVDVSLPHTKYAIATYYILVMAEASSNLSRFDGVRYGHRADDAANLMEM
FT                   YSKSRSQGFGREVQRRILLGTYALSAGYYDAYYKKAAQVRRLIRDDYLQAFASCDLLCG
FT                   PVAPTTAFGLGEKTDDPLQMYLTDIFTNPLNLTGLPGLSLPAGIGRTSGLPVGVQLFGP
FT                   AFGESALLQAGHVLEQARGPLPEPTALAGLD"
FT   gene            complement(371048..371332)
FT                   /locus_tag="Dret_0301"
FT   CDS_pept        complement(371048..371332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0301"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: dma:DMR_17350 aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67603"
FT                   /db_xref="GOA:C8WZX8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX8"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ACV67603.1"
FT                   /translation="MKIDTREVAHVATLSRLELDEATLNEYRGQLDAILDYMETLGEVD
FT                   TTGVEPMYSPVEHHTVLREDTAADEFAREEVLGNAPDTDGAYFKVPKVL"
FT   gene            complement(371475..373592)
FT                   /locus_tag="Dret_0302"
FT   CDS_pept        complement(371475..373592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_2167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67604"
FT                   /db_xref="GOA:C8WZX9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZX9"
FT                   /inference="similar to AA sequence:KEGG:Dvul_2167"
FT                   /protein_id="ACV67604.1"
FT                   /translation="MIRAYDQTAPRHAVFAPRTQTGANGLYTRRRALMMPQKLCLICLI
FT                   GFVLISGCAVKPPLPTQEKPPTALEEQAARMWQAQNYARSLRLYQELLQTQDLDQETQR
FT                   TAWRRVSRSALELGRFERAVQSLRQWAQVDPKTRENWTWHELYTQALGETEGAQKAREH
FT                   LHTVAVAPNTVWSVRRPAAERLTTAYWQQGSFARFAAVQSAVHQAASTPEQRKLIESSL
FT                   LETVQDAPEAQWQNLLDQIGPLGPKRYPHNILQWVWTRRQLAEERIGWAAAWHRLEAVV
FT                   RGETLALTPVFRETLDALRQEYGTPEQEIGLLVPLSGSYARFGRDIVRGASAAQWQISR
FT                   HGGKITVHVINTAAENWQHQLNRLPENIQLIGGPLRQSSWKAITQLAPTKRAFFTFLSS
FT                   LPASTEGRQAWRFFASTADQSRALVKAASALGIDKIAILYPQETFGRRMAASFWEQSRQ
FT                   HNATITGLAHYLPDAPTRWSGTVGDFLRVPDKETSSETTGEGNQTARPEPDFGAVFLPD
FT                   TLSKAQLMVPNFFYHDEDRLLFLGPRLWSQALARGADLEQRYFRLALTPGAWSPGMQRT
FT                   GLDALRQELEMSGLPGPNFWSGLGYDFVRFAARFDDPAPGFTADELNSRLHAFSGFSWA
FT                   LAPIQWDREGHARQDLFVFQPVSGGLRPANLDALGRRLERTKKAHAARRQARNDSNSTQ
FT                   PKEQTVSSSEQ"
FT   gene            complement(374128..376041)
FT                   /locus_tag="Dret_0303"
FT   CDS_pept        complement(374128..376041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0303"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: dde:Dde_1023 molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67605"
FT                   /db_xref="GOA:C8WZY0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY0"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACV67605.1"
FT                   /translation="MGKIIGIDLGTTNSCVYVMEGKEAKCVNNPEGGRTTPSIIAFTDK
FT                   ERLVGDIAKRQSVTNPERTVHGVKRLMGRDYDDPQIKEWREKSPYKIVAGSKNDAYVEV
FT                   EDKKYSPPEISAMLLQKLKTDAEAYLGETVTDAVITVPAYFNDSQRQATRDAGRIAGLE
FT                   VKRIINEPTAASLAYGLDKKTNEKIAVFDLGGGTFDISILEVGDNVVEVRSTHGDTFLG
FT                   GEDFDQRIVNHLVDEFKKENGIDLSADRMALQRLREAAEKAKKELSTSMEAEINLPFIT
FT                   ADQTGPKHMNMKLSRAKLEALVEDLVERTMAPCKTALQDAELKAGEIDEVILVGGMTRM
FT                   PLVQKKVQEFFGKEPHRGVNPDEVVAMGAAIQGGILGGDVKDVLLLDVTPLSLGIETMG
FT                   GVSTKLIEKNTTIPARKSQVFTTAADNQPSVSIHVLQGERPMAQDNKSLGRFELTGIPA
FT                   APRGVPQIEVTFDIDANGMVNVSAKDLGTGKEQSISIQPSSGLSEDEIDKMVKEAESHA
FT                   EEDEKKRKLIEARNQADNLIYTTEKSLRDLGDKVEDDVKADIEQKIEALKKTMEGEDEE
FT                   AIKKATDELSQASHQLAQKLYEQQQGGQAAGDAGGEQAQQDASSGGQDDEDVVDADYTE
FT                   VK"
FT   gene            complement(376122..376709)
FT                   /locus_tag="Dret_0304"
FT   CDS_pept        complement(376122..376709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0304"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: dde:Dde_1025 heat shock
FT                   protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67606"
FT                   /db_xref="GOA:C8WZY1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY1"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACV67606.1"
FT                   /translation="MKQKNTPNEQEQQAAEAQEVEQPAETVPGEELTDEELYALCQDRI
FT                   CPDCPQMHEAKNEKLRALADAENYKRRMTKEKDDHVKFASEKVLEDIVPIIDTLELALQ
FT                   HGRNVEGCQDVVQGVEMTHKLFLDTLQKHGLDQLGSTGEEFDPAIHEALAEEERADMDK
FT                   GMVCQIMQRGYRLKGRLLRPAKVMVSKNCENS"
FT   gene            complement(376849..377877)
FT                   /locus_tag="Dret_0305"
FT   CDS_pept        complement(376849..377877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0305"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: dde:Dde_1026 heat-inducible transcription
FT                   repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67607"
FT                   /db_xref="GOA:C8WZY2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY2"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ACV67607.1"
FT                   /translation="MDLFSREQTILRIIVEAYIETASPVGSRYVARHSGLDLSPASIRN
FT                   SMADLTEACYLEQPHTSAGRVPTGRAFRFYLDTILQLRALSFDEESFIQHRLGAPGLEI
FT                   SQLLQRAAKLLASLSRQVSMVLAPQHDTIRWQQIDFVRVRADTVMAILVAQGGIIRQRL
FT                   ISVEEPLSQDDLIVLSNYLNTHFRDRPIHEVKTAILHELQQVHGALDALTARALQLAGA
FT                   TCLESDNDRNLFVNGTSRILDHPEFADLQNARELLSLLEERTRLYTLLDKISLDHPAVT
FT                   LGNEFDDKQLQDCSVVSAPYRLHGHPLGLVSVIGPMRMNYAKVVPVVDFTAQILTQLLQ
FT                   SR"
FT   gene            complement(377898..378779)
FT                   /locus_tag="Dret_0306"
FT   CDS_pept        complement(377898..378779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0306"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: dvl:Dvul_1705 dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; NAD- dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67608"
FT                   /db_xref="GOA:C8WZY3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY3"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ACV67608.1"
FT                   /translation="MNDANTDQTAVVFGGKRGLLGQALVQTLQEQGWRVCALGREDVDV
FT                   DSQEALTDLLSRLRPGAVFNTVAYTQVDAAETDVQNARLLNQSFPCRLGRALPSPEIPV
FT                   VHFSTDFVFGGDQRTPYTPLDTPRPGTVYGKTKLEGEKALLQLDLRRLFIVRTAWLFGP
FT                   GKENFVSKMLKLSAEHSRLRVVHDQIGSPTYTLDLAAYTLHLLEKTPAGLYHIANSGRA
FT                   SWCELASEALALYGSSCQVEAITAAEYPQQAVRPAYSVLDNTAFSQATGIKPRPWPQAL
FT                   RDYIYLSVECSG"
FT   gene            complement(378766..379785)
FT                   /locus_tag="Dret_0307"
FT   CDS_pept        complement(378766..379785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0307"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; dTDP-4-
FT                   dehydrorhamnose reductase; Male sterility domain; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: dvl:Dvul_1704
FT                   dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67609"
FT                   /db_xref="GOA:C8WZY4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY4"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ACV67609.1"
FT                   /translation="MRILVTGGCGFIGSNYLYHVFGTTNEDVVVNVDKLTYAGNPANIA
FT                   SLTEQYEGSRYFFEHADIADPEAMQRILETYDIEAVVNFAAESHVDRSIDDPAPFVTTN
FT                   VQGTQVLLEASRRHGLKRFVHVSTDEVYGSLGPEGKFTEDTPLAPNSPYSASKAAADLL
FT                   VRAYVMTYDFPGIVTRCSNNYGPYQFPEKLIPLMYLKARAGEHLPVYGDGGNIRDWIHV
FT                   ADHCRGVDTALRHGRPGAIYNFGGDAEVSNLELVKLLLRQLDRPESLIRFVTDRPGHDR
FT                   RYAMDYTRTHKELGWQPQINLEHGLQATIDWYGQHDHWLSEVQSGAYRQFMDRWYERR"
FT   gene            complement(379955..380884)
FT                   /locus_tag="Dret_0308"
FT   CDS_pept        complement(379955..380884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0308"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   dde:Dde_2409 K+-dependent Na+/Ca+ exchanger
FT                   related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67610"
FT                   /db_xref="GOA:C8WZY5"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY5"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ACV67610.1"
FT                   /translation="MTHIIPVVQITISVLLLWKGADWIIESAAALARRLRISELVIGLT
FT                   VVAMGTSLPEFLVTSTAAFKGYSDISLSNIVGSNVFNLSIILGLMALMRPVPTRRVMLV
FT                   REGSVLLGVVGFVLLASWDLVMGRGAGLILVTTLIVFLLLLFTRAQRLPPGLETETQRE
FT                   GSFKDVAIILLGFAAVALGGNWLVEGASTLARGFGISEWIIGVTIVAAGTSLPELVTCL
FT                   QASLKGKNDMIMGNLLGSDLFNFAGVLGLTCLLNPLHVSASALPSLRLLVLSLVVVLAC
FT                   TRTGWRISRGEGALLVCIGLARWTLDIL"
FT   gene            complement(380952..382001)
FT                   /locus_tag="Dret_0309"
FT   CDS_pept        complement(380952..382001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_43250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67611"
FT                   /db_xref="GOA:C8WZY6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY6"
FT                   /inference="similar to AA sequence:KEGG:DMR_43250"
FT                   /protein_id="ACV67611.1"
FT                   /translation="MAHEHYDGLTLFSGGLDSILATKVLQAQGLRVLGVHFVTPFFGAP
FT                   DRLAHWQRTYDIPLQAIDAGQAFVDMLLAGPESGFGKVLNPCVDCKILLLQLAKQHMAA
FT                   YSARFLATGEVLGQRPMSQRSDTLQAIRKKADVEDILVRPLSAQLLPPSAVEQQGIVNR
FT                   EHLLSVRGRGRKEQLRLAEQFGITEIPQPAGGCLLTEPESAKRYWPLLKRGHTPPASDF
FT                   HLANLGRQFWADARWLCVGRNQSDNILLAETAAVDDFVFKLKDLPGPLALARPLPGAQW
FT                   DETAIRSAAALTASFSSKARQHKEDILMLVSHQGHTRELAISLDWAQDLPWREPDWDDV
FT                   DKSRLPGGW"
FT   gene            382259..383326
FT                   /locus_tag="Dret_0310"
FT   CDS_pept        382259..383326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0310"
FT                   /product="recA protein"
FT                   /note="KEGG: dma:DMR_43280 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67612"
FT                   /db_xref="GOA:C8WZY7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY7"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ACV67612.1"
FT                   /translation="MARKPNVSPEELRKEALDTALTTIERKYGQGAVMRLSDDAHQAVP
FT                   FIPTGSVGLDLALGIGGIPRGRVVEIYGPESSGKTTLALEIIAQAQKGGGNAAFVDAEH
FT                   ALDVNYARRLGVKTDELVVSQPDYGEQALEIADLLVRSGALDVIVVDSVAALIPQAELE
FT                   GNMGETQVGSQARLMSHAMRKLTGSIHRSKTSVIFINQIRMKIGMTGYGSPETTTGGNA
FT                   LKFYSSVRLDIRRIQTLKDKEEFYGNRARVKVVKNKVAPPFREAQFDILYGTGISKEGE
FT                   LLDMGVEHGIVDKSGSWYAYGSERLGQGKENVRAFLQQNPEISQDIENKLLVHLGMKDN
FT                   GQEPAADGGEEQTEE"
FT   gene            383393..386035
FT                   /locus_tag="Dret_0311"
FT   CDS_pept        383393..386035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0311"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: dvm:DvMF_0877 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: Alanyl-tRNA synthetase, class
FT                   IIc-like; phosphoesterase DHHA1; Threonyl/alanyl tRNA
FT                   synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67613"
FT                   /db_xref="GOA:C8WZY8"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY8"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ACV67613.1"
FT                   /translation="MVTAAEIRQRFLEYFARQGHEIVKSSPLVPKDDPSLLFTNAGMVQ
FT                   FKKVFLGQDKRNYVRATTSQKCLRVGGKHNDLENVGRTARHHTFFEMLGNFSFGDYFKR
FT                   EAVDFAWRFLTEELGLPKDRLYASVYREDDEAYELWKEIAGLPDERIYRLGEKDNFWSM
FT                   GDTGPCGPCSEILIDQGSHMSCGPECEIGVCECDRFLEIWNLVFMQFDRDASGTMTPLP
FT                   QPSIDTGMGLERIAAVCQGVYSNFDTDLFSGLIRTTAERAGVVYGKDEEINTALRVIGD
FT                   HSRAVAFMLADGILPSNEGRGYVLRRLIRRAFRFGRLIGLRDPFLFDVCSQVVSEMGDD
FT                   YPELHETAAFMVKVVRQEEERFGTTLDKGLALLEEELESLQGAGQTQVPGGVAFKLYDT
FT                   FGFPIDIVNDVAEARGFTVDEAGFQEHMQAQKERSKAAWSGSGATDMAARFVALLEAGV
FT                   QSDFVGYETLQSTSRIAALLKDDGQEVQELAAGENGYLVTARTPFYGESGGQVGDSGRV
FT                   IGPRGDGAVLDTIKPAAQLTVHSITVKQGSLAVDDEAELIVDEGERVATARNHTVTHLL
FT                   HAALREVLGEHVKQAGSLVASDRLRFDLTHIQALTAEEIQAVEDKVNQSILADTPVESA
FT                   HMDYSQAVQGGAVALFGEKYEDEVRVIDIPGVSRELCGGTHLRATGQAGFFCILSEAAV
FT                   SAGVRRIEAATGWQAVRTFTEQRTRLREAAQLLKAPQTEITGRIQDLQEQLKSLRKEKE
FT                   ALEGQLQSAKGGDLMSQVEELGGIPVLTAEVEAPDVKTLRGMMDDVRSKLSSGVVLLAA
FT                   KQEAKAMLILFVSQDLHDRFTAPGLIKQVAQEIGGSGGGRPDVAQAGGGNPEGIPAALD
FT                   SLRNLVGGQ"
FT   gene            386177..387031
FT                   /locus_tag="Dret_0312"
FT   CDS_pept        386177..387031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0312"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain; KEGG:
FT                   dde:Dde_1251 ferredoxin-NADP(+) reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67614"
FT                   /db_xref="GOA:C8WZY9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZY9"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACV67614.1"
FT                   /translation="MAVPILHKRKLIPGRVSELVLEAPQIAAKAEPGNFIILRLADDGE
FT                   RIPLTIADTDAAKGTITLVYLVVGKSTAHLETFEAGDTILDVCGPLGRPTHIEPVGTVL
FT                   CVGGGTGIAAMHHIAKGHQLAGNHVVSVIGARSEDLLLFEKELTAISAEVLVATDDGSR
FT                   GHKGLVTEVLEQRIQQGIEAGESIGEIVAVGPVPMMRAVAELTRPYGIKTTVSLNSIMV
FT                   DGIGMCGSCRVTVGDAVRFACVDGPEFDAHQVDFEEMMRRQCTFSEQEKLSYDHFCRKC
FT                   HHD"
FT   gene            387024..388445
FT                   /locus_tag="Dret_0313"
FT   CDS_pept        387024..388445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0313"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dvm:DvMF_0938 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67615"
FT                   /db_xref="GOA:C8WZZ0"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ0"
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /protein_id="ACV67615.1"
FT                   /translation="MTKKKSKILPRRSMPMQDPAARVGNFNEVANGYSLELAQEEARRC
FT                   LQCKTPTCQDGCPVEVDCKRFIRELAEGQVEQAFRTIKETNSLPAVCGRVCPQENQCEG
FT                   RCKLRPTGQPVAIGRLERYVADAFYAGTACEATVGREDCPMIREDLRVAAIGSGPASLT
FT                   LAGYLAAQGVKVEVFEALHLPGGVLSYGIPEFRLPKSIVRTEVETLKEQGVEFHMNWVG
FT                   GKTMTVGDLFDQGFKAVFLGLGAGLPRFMKLPGENLIGVFSANEYLTRVNLMGGYRFPD
FT                   YDTPVFPGRKVTVIGGGNVAMDAARTALRLGAEEVRIVYRRTQEEMPARLEELEHALEE
FT                   GVQLEILACPVAFQGDEGGRLTSMRVQKMCLGEPDESGRCRPMPVEDEAYDLETDLAII
FT                   AVGSGPNQILLNATPNLGLNSRGYIEVDQETLETNMPMVFAGGDIVTGAATVVEAMGAG
FT                   RQAGKEISRRLLKQG"
FT   gene            388568..389722
FT                   /locus_tag="Dret_0314"
FT   CDS_pept        388568..389722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0314"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: dma:DMR_08030
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67616"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ1"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ACV67616.1"
FT                   /translation="MTQNSNNETRPDEVEPLNDTVSSDTGPSGEETPLYAGIKFRDQGQ
FT                   IYYFKANPYVVAPQDSVLVQTDQGLGIGRVAVVRDTLPEGLAEQEIKPIYRLATEEDLE
FT                   QEQENLALGRDAYYYCRERIEDHGLEMKLVDVDVFFDRGKMMFYFTAPGRVDFRELVKD
FT                   LVKKYRTRIELRQIGVRHEAQMVGGIGNCGQVCCCRRFMRQFEPVTIKMAKEQQLFLNP
FT                   AKISGVCGRLLCCLSFEKEAYADFQRRCPKVGKNYETAWGRVKVLRANLMRDSLVLLTA
FT                   EGEEQELKLEEWERLVGEADGAPPQQNSGAGTPEPKIHTPAPEKRRENSPSSPSPDNEG
FT                   KPAENKANKPEKTTSSAQTQGQGQKKRRSGKSRKKRRSKRHNDT"
FT   gene            389990..391936
FT                   /locus_tag="Dret_0315"
FT   CDS_pept        389990..391936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0315"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein; KEGG: dvm:DvMF_0759
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67617"
FT                   /db_xref="GOA:C8WZZ2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ2"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACV67617.1"
FT                   /translation="MSRYYITTPIYYVNANPHLGHAYTTIVADCVNRFHRLLGQETFFL
FT                   TGTDEHGDKIVQAAEDAGQSPQEYVDRISSKFQQQLPDLNISNDRFIRTTDSDHKDCVQ
FT                   RFLQQVYDNGDIYFGEYGGYYCFGCERFYTEKELVDGLCPDHLKPPKYIEEKNYFFRMQ
FT                   KYQDWLVQYIQDNPGFIQPERYRNEVLGMLREPLDDLCISRPKTRLTWGIELPFDDRYV
FT                   TYVWFDALINYITALGWPDGDRYRQFWPVAHHLVAKDILKPHAIFWPTMLKAAGLEPYQ
FT                   GLHVHGYWTVNETKMSKSLGNVVAPLTMRDTYGLDGFRYFLLREMQFGLDASFSEEGLV
FT                   ARFNADLANDLGNLFNRALAMTHKYFGGRVPSPGALEDEDHAIRQLGVRAVQGYVDSGK
FT                   SFAFAAGLRQLWDLVRGLNKYIDATAPWTLYKAGETERLGTVMYTVLEGMRQVALALWP
FT                   VMPDASGSMLQQLGQPTDPSGRNMEEDVRQWDILAVGTEVAKKSNLFPRQEAVAKKEET
FT                   PSEGQSGKNKPKKQASAQKEPETGVASFEDFQKVELLVGTILAAEPVAKADKLLQLQVD
FT                   VGEEEPRQVVSGIAEHFAPEAVVGQQVVVVANLKPRKVFGILSQGMILAVHAEKGLQLV
FT                   QPGGAVPAGSRVS"
FT   gene            complement(392380..394557)
FT                   /locus_tag="Dret_0316"
FT   CDS_pept        complement(392380..394557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0316"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: Ferrous iron transport protein B
FT                   domain protein; GTP-binding protein HSR1-related;
FT                   nucleoside recognition domain protein; Miro domain protein;
FT                   Ferrous iron transport B domain protein; KEGG:
FT                   dvm:DvMF_1015 ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67618"
FT                   /db_xref="GOA:C8WZZ3"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ3"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ACV67618.1"
FT                   /translation="MANTLSVALAGNPNSGKTTLFNALTGSRQHVGNYPGITVDKKEGF
FT                   VQAAGQELHIVDLPGTYSLTAYSQEELVARNFLADTRPDVVVDVANASSLERNLYLAVQ
FT                   FLEMGAPLVLVLNMIDEARKHGLAIDSDLLSQRLGVPVVETVARYGQGKQALLKAVQQR
FT                   GKQTEGDWEPLYISYGPDLDPVLQEMTEWIEREHFLTDRYPARWVALKYMESDDEIRVL
FT                   GRKHGQLASALEEATRKVAEHCEKTLNTYPEAIIADYRYGFITSALRGVIRRDEHPQRL
FT                   AVSDQMDKVLTHRMLGPAIMFGILYLVYQLTFSVGEIPMGWVENFFAWLGDTTRAALPD
FT                   GLLQSLLVSGVIDGVGGVLGFVPLIMIIFLCIAVLEDSGYMARIAYMLDRVFRLFGLHG
FT                   CSIMPYIVSGGIAGGCAVPGVMASRSLRSPREKLATLITAPFMVCGAKVPVFILLAGVF
FT                   FPQYAPQVLFLITLVAWAMALLVAKFLRLTIIRGPSTPFVMELPPYRTPTLRGVLIHTW
FT                   ERTWQYIKKAGTVILALSILIWAGMTFPQLPQDEVRSFQAQKQNLEDKLAAADTETTKA
FT                   ALNEDLNTLQQRHAQAKISNTVAGRLGQALEPVSEWAGFDWRTNIALIGGVAAKEVIVS
FT                   TLGTAYSLEVGPEEAKPLAERLAADPQWTKRTAVSAILFILLYAPCFVTVVAMAKETGN
FT                   WRWPLFSVVFNTVLAFGIAVGTYQLGGLFMA"
FT   gene            complement(394550..394804)
FT                   /locus_tag="Dret_0317"
FT   CDS_pept        complement(394550..394804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0317"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: dma:DMR_19560
FT                   ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67619"
FT                   /db_xref="GOA:C8WZZ4"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ4"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACV67619.1"
FT                   /translation="MSKPSICLRHLKAGQRARIISLAAQGELGRRIRDMGLIPGTEVRI
FT                   IGRAPLKDPVALRLKDFTLSLRNNEADHIYVEPLEDENG"
FT   gene            complement(394797..394982)
FT                   /locus_tag="Dret_0318"
FT   CDS_pept        complement(394797..394982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67620"
FT                   /db_xref="GOA:C8WZZ5"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67620.1"
FT                   /translation="MLEKIIVIGIVLAALAFVLRRWRASWKAAQRGESLCSGCGGCGPD
FT                   QTTCQSQTTIKDMRDE"
FT   gene            complement(395036..395272)
FT                   /locus_tag="Dret_0319"
FT   CDS_pept        complement(395036..395272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0319"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: dma:DMR_19550
FT                   putative ferrous iron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67621"
FT                   /db_xref="GOA:C8WZZ6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ6"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACV67621.1"
FT                   /translation="MTSRPLCQFPSGSKVRVTGLESGGGARCRLCALGLTPGTVIEVTQ
FT                   NGPGPCRLKVRGSDLVLGQGLAHKVMALPADAA"
FT   gene            395568..398804
FT                   /locus_tag="Dret_0320"
FT   CDS_pept        395568..398804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0320"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; phosphoribosylglycinamide synthetase;
FT                   RimK domain protein ATP-grasp; MGS domain protein;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: dma:DMR_22160 carbamoyl-phosphate synthase large
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67622"
FT                   /db_xref="GOA:C8WZZ7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ7"
FT                   /inference="protein motif:TFAM:TIGR01369"
FT                   /protein_id="ACV67622.1"
FT                   /translation="MPKRTDIRKIMLIGSGPIIIGQACEFDYSGTQALKALKEEGYEVV
FT                   LINSNPATIMTDPGLADRTYVEPLEPESVAKIIAKERPDALLPTLGGQTGLNTAVSVAE
FT                   SGVLEKYGVELIGASLEVIQKAESRRQFRTAMENIGLTVPQSGIASSLEEVREWTNTLS
FT                   FPMIVRPAFTLGGTGGGVAYNREDLEEIARQGLAASPSHEVMLEESVLGWKEYELEVMR
FT                   DKHDNCVIICSIENLDAMGVHTGDSVTVAPAQTLTDREFQKMRDASLAIMREIGVETGG
FT                   SNVQFAVNPENGDMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEIPNDIT
FT                   RETMASFEPTIDYCVVKIPRFTFEKFPGSQDFLTTTMKSVGETMAIGRTFKESLQKGLR
FT                   SLEVGMAGLGNGTGEDDLDAESLMALLKTPNSQRLFAIRDALRQGMPLETLYQATFVDP
FT                   WFLQQIKAIVDCEAELKHFSLEQAISADNPHMEEVLRHAKEFGFSDLQLANLWKRTEDD
FT                   IRQLRIQMGITATYKLVDTCAAEFEAYTPYYYSSYERENENRATGKRKVVILGGGPNRI
FT                   GQGIEFDYCCVHASYALRDMDIESVMVNSNPETVSTDYDTSDRLYFEPLTREDVLNIIE
FT                   QEQPEGVIVQFGGQTPLNLAVPLLRAGVPILGTTPDSIDRAEDRERFHALLNKLGLKQP
FT                   DNGLATSEEGALDVAERIGYPVVVRPSYVLGGRAMEIVYDSDELKNYFRDAVVASPDHP
FT                   ILIDKFLQGAVEIDVDALCDGTQTYVGGVMEHIEEAGVHSGDSACVLPPHTVSQETIDE
FT                   IRRQSSALAEELGVVGLMNVQFAVQNGEIFILEVNPRASRTVPFVSKATGVPLAKLATQ
FT                   VMMGRTLEDLNPWSMRQWGHLAVKEAVMPFNRFPGVDVLLGPEMRSTGEVMGVDTEFGL
FT                   AFMKAQLGAGQKLPASGTVFISVNDADKDAVVEAARTFARIGLRIVSTEGTAAYLTRAG
FT                   VDCERVNKVYEGRPNAIDLIKNGEIDLVINTSSGKKTIRDSSSLRQTTLLYGIPYTTTV
FT                   AGARAMAQAIAALQGHGLEVKSLQEYYGME"
FT   gene            399414..400799
FT                   /locus_tag="Dret_0321"
FT   CDS_pept        399414..400799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0321"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: dma:DMR_22150
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67623"
FT                   /db_xref="GOA:C8WZZ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ8"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACV67623.1"
FT                   /translation="MLKKEYCGLFGISGHAEAARMTYFGLYAMQHRGQESAGIVTWDGQ
FT                   KLREQRGMGLVADVFREEHLSRQLKGTVGMGHIRYSTTGASLLRNAQPFMVRYKDMGLA
FT                   VAHNGNLVNTVELRRELENNGSLFQTSMDSEIVMHLVAQTLSDSSLEEAMSTACRRLKG
FT                   AYSLLFMANNKLIGLRDPWGFRPLCLGRVGDAYVLASETCAFDLLEAEYLRDIEPGEMV
FT                   VIENGRLHSYRFCEPERTSPCIFELIYFARPDSIVFGKNVYESRKAMGRTLAREAPVDA
FT                   DFVMPFPDSGVYAAVGYAQESGLPYEMAMIRNHYVGRTFIQPSQDMRDFGVRVKLNPVK
FT                   SMINGKRIVIVEDSVVRGTTIRTRVKKLRELGARELHLRVSCPPICHPCYYGIDFSSKG
FT                   ELIAANHSVEDIARYMNLDSLHYLSVDGLLDSVQAKSEYCLACFQGTYPVPPPQGGSKS
FT                   CLE"
FT   gene            400811..401833
FT                   /locus_tag="Dret_0322"
FT   CDS_pept        400811..401833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0322"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: dvm:DvMF_2308 KpsF/GutQ family protein;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: sugar isomerase
FT                   (SIS); CBS domain containing protein; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67624"
FT                   /db_xref="GOA:C8WZZ9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C8WZZ9"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ACV67624.1"
FT                   /translation="MDHNQSNTSSPQCDADPQADWLRLGCDVLDVEIEGLQAIRASLGE
FT                   SFVEAVEVLAGCRGRVVVTGLGKSGLVGRKIAATLSSTGTPAYFLHPVEGAHGDMGLIR
FT                   KGDVVLALSNSGETDELNAILPTLRSLGARLIALTSDPDSRMARESDVVLQTRVPREAC
FT                   PLGLAPTASTTAALAMGDALAVCLLTHRSFDSQDFKRYHPGGSLGRRLRQCLKDLMHTV
FT                   QVPLVMEGVSLQQALEVLNSGGLGTVVVVDQEHRLAGVLTDGDVRRLVCRGGLDVAVPV
FT                   ETLMTVRPSAVHPEQSAAEALDILEQKAITVLPVVDAERRLQGIIHLHDLLGKGRLRFA
FT                   "
FT   gene            401988..403574
FT                   /locus_tag="Dret_0323"
FT   CDS_pept        401988..403574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0323"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase family protein"
FT                   /note="KEGG: dde:Dde_3122 dolichyl-phosphate-mannose-
FT                   protein mannosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67625"
FT                   /db_xref="GOA:C8X000"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C8X000"
FT                   /inference="similar to AA sequence:KEGG:Dde_3122"
FT                   /protein_id="ACV67625.1"
FT                   /translation="MPQTQSLFARHLQRRPGLWAGVIICVTTLVRVWFVASGQLDLVQD
FT                   EAHYWDWTRHLQLSYYSKGPLIAYLIALGTKIFGATELGVRSMAIAGSAAIQGVVYWGL
FT                   ARLWGRPLTGLWALVIANTMLLFMAAGVLMTTDNPLLLSWVVGLFALYAASVREENSRR
FT                   YFWILALAIAFGTWAKYMMVVFPLIAVLYSAGVQRQAMLPQRYWRRLVLACLGGVVVGL
FT                   LPIVLWNAGHDWVGFRHVLHRGGVGGAGLLEWFDWEEFPEYLGSQVGVLTPWWFVFLLF
FT                   GAWGAVKRLQRPGADGMGLQRRQAWLLTVGFWPVWLFFLIWSLHTHIEANWSAVSYGAG
FT                   ILLAALAWERYWNTASGRHKKLRYLWPCLGVLLFILVHMQNLLPLPAEYNPAARLKGWS
FT                   DLGAQVQTLKREEFALPQRVFVFSDRYNTTAALSFYVPGQKRAFCVNTGRRLNQYDFWP
FT                   GPVKRHGWDAIYVRQELGESMAPEVRKMFARVSERIDYRSQHRGQSAQGFSIYLCYGFH
FT                   GPWPEPPQGSF"
FT   gene            403985..406393
FT                   /locus_tag="Dret_0324"
FT   CDS_pept        403985..406393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0324"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin- binding
FT                   protein transpeptidase; KEGG: dde:Dde_3124
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67626"
FT                   /db_xref="GOA:C8X001"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C8X001"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACV67626.1"
FT                   /translation="MHRELEVEDRRRMNRFLKIALIGVIICLFLGAGGAAGVYYWAAKD
FT                   LPGFKKITDYNPPLVTTVYSANKEVLGYFSKERRFLVPLSRMAPVIKKAFLAAEDAEFY
FT                   SHEGVDLWGIMRAAWKNFQAGEIVQGGSTITQQVIKSMLLSSERSYQRKLKEAILAYRL
FT                   EKNLDKDEILTIYLNEIYLGAGAYGVEAAARMYFGKHAEALTLPEAALLAGLPKAPSAY
FT                   NPLRHPEAARERQVYVLSRMLEQGWISQDEYEEAKAAELEYSSMADPSWKVGSYYLEEV
FT                   RRWLIDRFGEETVYTGGLNVYTAVDLKHQRAAEQAVREGLRASSKRRGWKGPVRSVNAT
FT                   AVDDFLEQQELPEQEALRDGTWVQAVVTSVDKQAAAVRFGNHTGRVAVETMGWARTPNP
FT                   EKAPEEVPQVKDARKVLETGDVVWTSVVEIPEGTQQPWSLALEQQPEVQGALVSLEPGT
FT                   GFVKALVGGYSFDESQFNRATQAQRQPGSAFKPIVYSAALDSGLTPATVLLDAPIVYND
FT                   QSTNSTWKPENFEGVFYGPTLLRTALVKSRNLVTIRVAQKIGIDTIIQRAKTLGLKAEF
FT                   PRDLSVSLGSAAVSPLNLCQAYTAFARKDGAYVEPRFVLRVEDAWGEELFVSEPVQNEA
FT                   ISPQTSYIIKHLLQQVVQSGTAWRVRALGRPVAGKTGTTNDQRDAWFMGFSPELLTGVY
FT                   VGFDHLDPMGKYETGSRAASPIWLSYRQAVKGDVPVQDFPRPAGIVMARIDADTGKLAG
FT                   PDTEQSYFLPFKSGTQPMEVSPPLKQDSPESGGSSGGETGGDDLLKEVF"
FT   sig_peptide     403985..404092
FT                   /locus_tag="Dret_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.235 at
FT                   residue 36"
FT   gene            406390..407367
FT                   /locus_tag="Dret_0325"
FT   CDS_pept        406390..407367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0325"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   sfu:Sfum_3415 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67627"
FT                   /db_xref="GOA:C8X002"
FT                   /db_xref="UniProtKB/TrEMBL:C8X002"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACV67627.1"
FT                   /translation="MTLRGRVFQLGQAGMAVLREASAAAGMLFKIMIPIIIGVKVLQEL
FT                   GLIPYLARPLAPIMEIVGLPGSMGLVWATALVNNLYAAMVVYFSLAADDPLTCAQITIL
FT                   ATMMLMAHALPLEGKIAQKAGTRFIFQALARAGGAFIVGWVLHLGYSATGWLQEPSRLF
FT                   WEPAETGSGGLGFWALDQVRNLAMIFCIILVLVALMRLLQYFGVTQALVRVLQPVLRLL
FT                   GISGEAAPIAIVGMTMGLAYGGGLILHEAKSGRVARQDIFFSLTLMGLCHSIIEDTLLM
FT                   TLLGAHVSGLLWARLLFSLLFVFLLVRLVRALPASLINRFLYQQ"
FT   gene            complement(407494..407847)
FT                   /locus_tag="Dret_0326"
FT   CDS_pept        complement(407494..407847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0326"
FT                   /product="macrophage migration inhibitory factor family
FT                   protein"
FT                   /note="PFAM: macrophage migration inhibitory factor family
FT                   protein; KEGG: mca:MCA2795 phenylpyruvate tautomerase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67628"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:C8X003"
FT                   /inference="protein motif:PFAM:PF01187"
FT                   /protein_id="ACV67628.1"
FT                   /translation="MPYLKIQTNTFTGDENGFLRRASFRAAAILEKPEEAMCVALEPSV
FT                   PMLLGGTDAPAVFAKLKGLNFPEERTAEIASQLSAFIAEELEVPTERIYCIFENVSRHM
FT                   WAWKGTTFDAMGK"
FT   gene            complement(408030..410000)
FT                   /locus_tag="Dret_0327"
FT   CDS_pept        complement(408030..410000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0327"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: dvl:Dvul_0074 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67629"
FT                   /db_xref="GOA:C8X004"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:C8X004"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ACV67629.1"
FT                   /translation="MPDISAFKPEILAPAGNKESFLAAVDAGADAIYCGLKHFSARMEA
FT                   DNFALRDLSRLQGLAQKHGTRTYVALNTLIKPNELDQAGRLLDQLTRYVHPDALIVQDP
FT                   AALKLARQAGFTGELHFSTLANIGLASALPSVLALGADRVVLPRELTVDEIKTLDTACP
FT                   DALDLEVFVHGALCYAVSGRCYWSSYLGGKSGLRGRCVQPCRRIYTAGGPPQRLFSCQD
FT                   LGLDILTKALLEAPRVKAWKIEGRKKGPHYVTYTVRAYALLRDNPLDPQAKKEAVDLLD
FT                   QALSRPTTHYSFLPQRPHPPVTPDQSTASGGYLGRLQAKNTKIQLRPHKALLPQDLLRI
FT                   GYEDEPGHRIYKVSKYIPKGGLLTIQGRNTEKQKGMSVFLIDRREPELVQRLKKMDQEF
FT                   QAEPAPEITPSSFTPTLPGTRTQAGRPSLVRVYRNLPPGKTGKTPGLWVQPKPPRGISS
FT                   TRYSHIWWWLPPVLWPEEERLWQETIDRLLARGAKRFVLNAPWQVGFFNDSEDLMLWAG
FT                   PFCNLANALALESMVELGFSGAFASPELAGPDLLALPGQSPLPMGLVLGGAWPFCLSRV
FT                   QPPHLEPGQRVTSPKKEISWTKRYGPTTWHYPNWDLDLYKHQRELEQAGYTLFAHLYEP
FT                   RPKSAPRPHRTSTFNWDLQLL"
FT   gene            410325..410792
FT                   /locus_tag="Dret_0328"
FT   CDS_pept        410325..410792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0328"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sfu:Sfum_3091 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67630"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8X005"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACV67630.1"
FT                   /translation="MREIPKDKETRKYMETTEWIQCAPFERLLQMEIMEARDGGASLRM
FT                   PVTPDVTQGGGLLHGGALMGLADTAVAMAIKSLLEPGTRFATTEAHSEFLAPVREGDVF
FT                   VRAQVTGHEDRHLRGEALVYDAANREVMRFSARFTIAREDFEQLQGAPHDV"
FT   gene            410939..412069
FT                   /locus_tag="Dret_0329"
FT   CDS_pept        410939..412069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0329"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   esa:ESA_02022 cyclopropane fatty acyl phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67631"
FT                   /db_xref="GOA:C8X006"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8X006"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACV67631.1"
FT                   /translation="MRYARHKCAELLEHAGITLNGSAPWDIQVHDDRLYWRVLRDKHLG
FT                   LGEAYMDGWWDCQRLDMCIDRILRSGVRKAANRSLAHGALAALSLLTNRQKLSRSRQIA
FT                   EHHYDLDNDLFLSFLDPYNQYSCGFFNGDCSLEEAQETKLALTCRKLELSRDDSLLDIG
FT                   CGWGGFAKYAAEHFGCHVTGVNISEEQIAFARQDCQGLPVDIVEQDYRDVTDTYDKVVS
FT                   IGMFEHVGPKNYESFMRVVQRCLKEDGIFLLHTIGSNKSRLNVDPWISKYIFPNGVLPS
FT                   VSQIGRAAEPYFIMEDWHNLGPHYDKTLMAWNSRFQEAWPRLRKKYSRRFKRMWEYYLQ
FT                   SCAGAFRSRSIQLWQVVFSKGRCPQPECRLAVQQGD"
FT   gene            412467..414062
FT                   /locus_tag="Dret_0330"
FT   CDS_pept        412467..414062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0330"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: cvi:CV_0964 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; PAS fold domain protein; PAS fold-4
FT                   domain protein; SMART: GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67632"
FT                   /db_xref="GOA:C8X007"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8X007"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV67632.1"
FT                   /translation="MLDLAALYQFGFLSYFYFFASSIAIALTFLLWRRRTLIGAWYLMW
FT                   FEVAVAAWSCAAAFELAATVVPLKIWWTQISYVGVTSAPVFFFLFAAEFGQQSHWLSTQ
FT                   RIAALFILPAFFLFAAATNQFHGLIWQEVWMRPESFWAMYEHGPLFWALVVYEYSLLVA
FT                   GIVFLLQAQRLFPDFYRIQNTFLLIGVLLPLAGNLVDVFGFTPLPGLNWTPMSFALSGV
FT                   ILALGILCFRVLDVVPIARKQVIDAMSEGVAAVDNSGRIVDANPAACQFLQSDVAGLIG
FT                   MRARDVFAPWYATLVVMEPGSGSVEIRLPYGFKEMSWLEIERSEIRDARGRLWGQLVLM
FT                   RDVSERKEAESRLLQMAATDELTGLYNRRRFFELARGEFNRAKRYSSPMTILLLDIDYF
FT                   KRINDEYGHDAGDTALRCIVSMIASQLRSLDVLARLGGEEFVALLPETHQFDAERIAER
FT                   IRSEIESTAINLFETTLFVTVSIGVAGYSKEMQDVGELINRADEAMYRAKRDGRNQVCL
FT                   ATPRNLVQSKTRLT"
FT   gene            414405..416594
FT                   /locus_tag="Dret_0331"
FT   CDS_pept        414405..416594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0331"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: aeh:Mlg_1646 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: Malate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67633"
FT                   /db_xref="GOA:C8X008"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:C8X008"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ACV67633.1"
FT                   /translation="MTEYVRSGGLQVAAPLAELVAQEVTPGIGVDPEKFWTALAQAVRD
FT                   FAPRNAALLKERDRLQEQIDQWFQDRRGQAHDAAAHKKFLYDIGYLIPEGEDFSIRTSD
FT                   VDPEISAVAGPQLVVPVNNPRYALNAANSRWGSLYDALYGTDVLPETDGAEKTAEYNPV
FT                   RGEKVVEHAARFLDQAVPLAQGSYTGVTGYAVRHDDGVARLEVALDDGSVTGLRDGQQF
FT                   VGYVGEDRLSAVLFRHNGLHIEIQIDPEDPIGRNHPAGVKDVVVEAAMTTILDCEDSVT
FT                   AVDGVDKTVAYRNLLGLFRGDLETSFSKGGQTVERRLHPDRSYTSPEGRLFHLHGRSLM
FT                   LVRTVGHLMTSDAVLDEEGRQIPEGILDTFMTALIGLHDLKKTGPFQNSRSGSLYIVKP
FT                   KMHGPEEVAFTCELFAAAEESLGLPSRTLKVGVMDEERRTTLNLKECIRQAQDRIIFIN
FT                   TGFLDRTGDEIHTNMEAGPMVRKNEMKQEPWMQAYEDWNVDVGLAAGFRGRAQIGKGMW
FT                   PKPNKMREMLETKQVHPEAGANCAWVPSPTAATLHALHYHQVEVNARQVALEGQRRASL
FT                   DDLLTIPVLRSAAPSEAEIQQELENNAQSILGYVVRWVEQGIGCSTVPDINDIGLMEDR
FT                   ATLRISSQHIANWLYHGICSKDEVLAVLKRMAAVVDRQNSGDPFYRPMAEDFDNSVAFQ
FT                   AACDLVFKGCEQPNGYTEPILHARRREAKAKFGIE"
FT   gene            416812..417234
FT                   /locus_tag="Dret_0332"
FT   CDS_pept        416812..417234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0332"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101; KEGG:
FT                   mca:MCA0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67634"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:C8X009"
FT                   /inference="protein motif:PFAM:PF01951"
FT                   /protein_id="ACV67634.1"
FT                   /translation="MATAGWSTFDHGADIGIRGWGASLEGAFAQAAVALMSLMDGSWER
FT                   VQPQQSFELQVTSYDVEGLFVAWINGLLAEAELRKMVFCSFVPTIAGTTLSATVWGEPV
FT                   AVREHEWGVEVKGATFSELFAGRQNDGWAAQCVVDV"
FT   gene            417251..418681
FT                   /locus_tag="Dret_0333"
FT   CDS_pept        417251..418681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0333"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   tgr:Tgr7_1950 protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67635"
FT                   /db_xref="GOA:C8X010"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C8X010"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACV67635.1"
FT                   /translation="MDTSLLRRINAYCWEVPQQGAMRVPGRLFGSGALIRDLDDMVLEQ
FT                   VSQVAALPGIVRASLAMPDAHWGYGFPIGGVAAFDPDRGGIISVGGVGYDISCGVRTLR
FT                   TGLSKEDVLSVLPELVDLLATVIPAGVGRGGQLRLSGSELDDVLRLGARWAVAQGYGES
FT                   RDLEYIEDGGCLSGANPEVVSETAKKRQQDQVGTLGSGNHYLEVQYVDAIYDQAAAFAF
FT                   GLKEGGVVVSLHCGSRALGHQIGTDYIQILGRAAQKRSLHLPSRDLVCAPIDSKEGRDY
FT                   YQAMACGVNCALANRQVLGHLVRQAFAEMFPLARLELLYDVSHNTCKVEDHDVDGLRKS
FT                   LYVHRKGATRSFGPGRQELPAAYRGVGQPVLIGGTMGTASYILAGTVESEAMAWGSACH
FT                   GAGRAMSRKQATKRWKGKSVLHELEHRGILVRAASQRGVAEEAPGAYKDVDEVVESTHH
FT                   AGLARKVGRLRPLACIKG"
FT   gene            418989..419549
FT                   /locus_tag="Dret_0334"
FT   CDS_pept        418989..419549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd3498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67636"
FT                   /db_xref="UniProtKB/TrEMBL:C8X011"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67636.1"
FT                   /translation="MQGFGAPPLLETLGKRFAMAAAGVESVSFFTVAPLEGWTMELPRL
FT                   SIGVVGLSLLFFLVSCGGDSTEKTGAEDVKKETKEAVEAVQDYASEKKADFEEQIRQQL
FT                   DALKQDIAQLESKVEAMGQDAQEGMEEQLAALKEQRQNLQAKLEQLQDAGNDTWQELKK
FT                   ESSQAMEDLKQSYEDLQSSTSEN"
FT   gene            419811..420101
FT                   /locus_tag="Dret_0335"
FT   CDS_pept        419811..420101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_2059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67637"
FT                   /db_xref="UniProtKB/TrEMBL:C8X012"
FT                   /inference="similar to AA sequence:KEGG:DvMF_2059"
FT                   /protein_id="ACV67637.1"
FT                   /translation="MKSRDEHIQELKQQLDKWNAKIDELEVQAKLAEMENREKYEAEIH
FT                   RFKKKRDELRKTIEEMAHSGEAAFSELQRGAEQAWEALSEAYKNARQHFKK"
FT   gene            420126..420269
FT                   /locus_tag="Dret_0336"
FT   CDS_pept        420126..420269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0336"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67638"
FT                   /db_xref="GOA:C8X013"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:C8X013"
FT                   /inference="protein motif:PFAM:PF08085"
FT                   /protein_id="ACV67638.1"
FT                   /translation="MKRIVPVLGIICVTVVLFFSTIGCNTIEGMGEDLEATGEAIEQEA
FT                   EE"
FT   gene            420372..420509
FT                   /locus_tag="Dret_0337"
FT   CDS_pept        420372..420509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67639"
FT                   /db_xref="GOA:C8X014"
FT                   /db_xref="InterPro:IPR021446"
FT                   /db_xref="UniProtKB/TrEMBL:C8X014"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1149"
FT                   /protein_id="ACV67639.1"
FT                   /translation="MDLHIELQPLLAITAGVLVLIFPKLLNSIIAIYLIAYGVLSITSF
FT                   "
FT   gene            complement(420623..421369)
FT                   /locus_tag="Dret_0338"
FT   CDS_pept        complement(420623..421369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0338"
FT                   /product="protein of unknown function DUF364"
FT                   /note="PFAM: protein of unknown function DUF364; KEGG:
FT                   sfu:Sfum_0019 conserved hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67640"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:C8X015"
FT                   /inference="protein motif:PFAM:PF04016"
FT                   /protein_id="ACV67640.1"
FT                   /translation="MQLDQNLYDIFQDKARQTTITTLNLGLAYTAVVTSDGGIGVAHTC
FT                   LEQSGPCGLAHENRIYEGHCAADLLPCILEADPLKRSMALALINALNHSAAVALPEDTT
FT                   TRLFEHLKIGHGTRVAMVGYFGPLMPVFQEKGAVVEAIDRGRAIGDPAAFQAKLHDWAD
FT                   VLLLTSTSILNQSTEEILGHTSDTVRTVILGPSTPMVPDAFASLPVNLLAGTVPLDSKG
FT                   VLQCIRHGAGTRSIHKFSRKAFTELG"
FT   gene            421659..422228
FT                   /locus_tag="Dret_0339"
FT   CDS_pept        421659..422228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0339"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: dma:DMR_28800 GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67641"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C8X016"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACV67641.1"
FT                   /translation="MQHEQSMSYFRTLYEVVKAVNSSLDPKTVLSQVADKARWAMGVKA
FT                   CSIRLLSEDRKYLLAGASAGLSQAYLRKGKVEVAKSVLDQEVLQGQNVYVCNACTDTRF
FT                   QYSKEAQAEGIASVMAVPLHLQGREVIGVLRVYSSTERDFTSDEVEFLNAMADLCALAI
FT                   HNSLAYDKVRYEHELLNRYTYQLFED"
FT   gene            422243..423259
FT                   /locus_tag="Dret_0340"
FT   CDS_pept        422243..423259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0340"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: dvm:DvMF_1440 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67642"
FT                   /db_xref="GOA:C8X017"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X017"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ACV67642.1"
FT                   /translation="MTKLRIGINGFGRIGRQVLKALRLNYPQTVQVVAINDLFDAQQNA
FT                   NLFRHDSTYGRFPESVDVDGDVMTIGDWSIHNFDYTDPKRIPWADMGVDVVIESTGIFR
FT                   TGPQARAHLEAGAKKVLITAPGKEVDRTIVLGVNEATYQPQSDQILSNASCTTNCLAPV
FT                   AWVLQQNFGIRIGSMCTVHAYTNDQRILDLPHKDPRRARAAGQNIIPTTTGAAKLVGQV
FT                   IPELEGKIDGYAMRVPVPTVSVVDFTAWVDRATTTEELNATLQAAANGELEGILGYNHE
FT                   PLVSSDFVMDPRSSIVDPAFTSVRDGNWIKVMAWYDNEWGYSCRVADLAELIRQKGV"
FT   gene            423484..423560
FT                   /locus_tag="Dret_R0003"
FT                   /note="tRNA-Pro1"
FT   tRNA            423484..423560
FT                   /locus_tag="Dret_R0003"
FT                   /product="tRNA-Pro"
FT   gene            423782..425008
FT                   /locus_tag="Dret_0341"
FT   CDS_pept        423782..425008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0341"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: glo:Glov_2843 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67643"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C8X018"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACV67643.1"
FT                   /translation="MLVSQLTKLTLDIQGFRVGRVQGDTSGITVDIAPDRRHLLFCSRC
FT                   GSAAKYRDTLTNRYFRHVPLWGIPVWLRYSPRRVRCRHCGIKVEYFPWSTGKHRFTTAF
FT                   AHFLASWARLLPWKHMAQLFGCSWGTVAAAVDQMVEYGLAHQDLSNLTHIGIDEISREK
FT                   GQVYLTNVYDLNTSRLVWSGEKRTKATITNIFTSLGPNKTNKLEGVCCDMWDPYIQVIQ
FT                   DKAPKAAMVFDKFHIVRHLNEAVDQVRRDEIREKGQKHKDLVKDTRYIWLKNPWNLTDK
FT                   QASRLSALEKLNLKINRAYLLKESFRQFWSYECRASAKDFLDKWFWWATYSRLKPMRNF
FT                   AWMLRRKEENILSYFDMPISNGSVEGLNNKAKVISHRAYGFRSAKNYIRNLYHCMGGLP
FT                   EPQTMHRFV"
FT   gene            complement(425126..427225)
FT                   /locus_tag="Dret_0342"
FT   CDS_pept        complement(425126..427225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0342"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: dal:Dalk_0094
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67644"
FT                   /db_xref="GOA:C8X019"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C8X019"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACV67644.1"
FT                   /translation="MGLKNQNLQIKIVGLGCLAVVVSVGLILGILSYQGRGLEKDMAKE
FT                   VDHMAERELGHIAEDIRHMVEAQNESVQQKVESDLRVASHLLEQQGGIYTATQTETVSW
FT                   QAVNQYTGQSKTMDLPKMLMGSNWLGKVRAMDKTAPLVDQVQDLVGGTCTVFQRMNEAG
FT                   DMLRVATNVEKKNGDRAIGTYIPATNPDGQPNPVISTVMQGQTFYGRAYVVNAWYITAY
FT                   KPIRDQRGEITGILYVGVKQENVESLRKGIESKQIGNEGYAFVLGGSGDYKGQYIVSND
FT                   GQRDGENILDAQTEDGTYFVQEMIEKAKQAQGETVFYSYPWNGQKKTAALTYYEPWDWV
FT                   IGASVYNSFYNSIENRIVDSVRSMTITTIIFGVGLILVMIAIAYLLARSIVRPIKTISQ
FT                   QLFAGSEQTANASDEIASSSQRLAEGANEQASSLEETSSSLEELSSQTKQNAENASQAD
FT                   QYTQEVNQVIQDGVGSMEQMETTIGSIKESSEQTSKIMKTIDDIAFQTNLLALNAAVEA
FT                   ARAGEAGKGFAVVAEEVRSLAQRSAEAARNTSSIIEDAQANADQGVQVAAEVSQNLSRI
FT                   QETAKQVGILVSEIAAASKEQSEGIEQINTAVSEMDKVVQQNASDSEETASASEELSAQ
FT                   AEELEKAVRNLMVIIEGGQDALDQKGPTADQNQDRQDWGRASTHKQAQSGLQSSGKALM
FT                   SGKEK"
FT   gene            427906..428847
FT                   /locus_tag="Dret_0343"
FT   CDS_pept        427906..428847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0343"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: dde:Dde_0145 putative
FT                   glycine betaine/L- proline ABC transporter, solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67645"
FT                   /db_xref="GOA:C8X020"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:C8X020"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACV67645.1"
FT                   /translation="MSKRLSIGRILFTVLVFSLLALPAMASGPVKFGVPSWPGVTVKSE
FT                   VASQLIRAMGYEVEQTVASPSIIFKAMTLGELNAYLGGWSPVEDPMIDPLVEKGEIIRV
FT                   GANIEEAVTALVVPSFVAEAGVTSIEDLAAHKDKFESTIYGIESGSGANNDIQEAIDAN
FT                   AAGLGDWELAASSTASMLAQVQSLSENKRWAVFWGWEPHWMNAVMDLHYLQSETPATEK
FT                   IGASVSVVYTITSNDLPEANPQAYAFLEQLKVPSDVQSQWIYEYRQQDKEPEDLAPQWI
FT                   KANLDGLVGQWLEGVRAANGEPALKVVRAAFK"
FT   sig_peptide     427906..427986
FT                   /locus_tag="Dret_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            428954..429826
FT                   /locus_tag="Dret_0344"
FT   CDS_pept        428954..429826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0344"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bxe:Bxe_B0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67646"
FT                   /db_xref="GOA:C8X021"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X021"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACV67646.1"
FT                   /translation="MRQDVILTCALTGAGDTTAKNPHVPVTPEAIVADALEAHEAGAAV
FT                   VHIHVRDPETKQAARRHDLYAEVMQRLQDSGSEVIVNLTAGMGGDFAPDAENPAQGGPG
FT                   TDMATAHERVAHVLDLKPEICTLDCGSLNFPDAAYVATPDQLREMAQAITSAGIKPEIE
FT                   CFELGHIWLAKTLLTEGYLNHPPLFQLCMGIPFGAEATPMNMLCMRDNLPQGSQWAAFG
FT                   IGRMQMPFAAQSALLGGHVRVGLEDNIYLEKGVPATNAQLVTKARTMLEAMGCRLLDAN
FT                   AARDHLGLA"
FT   gene            429871..430854
FT                   /locus_tag="Dret_0345"
FT   CDS_pept        429871..430854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0345"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   csa:Csal_3173 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67647"
FT                   /db_xref="GOA:C8X022"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X022"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACV67647.1"
FT                   /translation="MRTTPEAVQKVGIIGAGVIGGGWALHFLRLGKKVLVYDPSEAAGE
FT                   HLRETAKTTWPTLERIGLACGACLENLELVSSLEALNAAEVVQENAPEDLEQKQALYQE
FT                   LDTALDWDVPVLSSTSGFAMTDMQKTCRSAARTCVGHPFNPPYIVPFVEVVGGEKTDPE
FT                   TVRWAEAFYTACEKKVIAMQRELPGFIANRLQEALWREALHMVAEGEATPEEIDASIVY
FT                   GPGLRWAFHGPCMTFHLAGGEGGMAHMLKHFEPALKEPWTRLEAPELSDTLRERMVQGC
FT                   ERQTAGRSIAEVVQERDECLIRVMQALQEIQPTNPIAQKDAYASCS"
FT   gene            430838..431317
FT                   /locus_tag="Dret_0346"
FT   CDS_pept        430838..431317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_0325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67648"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8X023"
FT                   /inference="similar to AA sequence:KEGG:PputGB1_0325"
FT                   /protein_id="ACV67648.1"
FT                   /translation="MPLVHNSRVQPEWIDYNGHMSEAFYVLIFGHATDAFLDAIGLDAE
FT                   TRSQAKVSAYTVEAHIRYVREVQEGEAVEVQTQLVGHDAKRAHLFHTMARAADGTVVAT
FT                   EEILVLHVDTQAGGTAPFQPVAANALEQLQKRHDRLPRPQDVARAITMPSRSVTG"
FT   gene            complement(431346..432314)
FT                   /locus_tag="Dret_0347"
FT   CDS_pept        complement(431346..432314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0347"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; SMART:
FT                   Helix-turn-helix, AraC domain; KEGG: pap:PSPA7_6176
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67649"
FT                   /db_xref="GOA:C8X024"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8X024"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACV67649.1"
FT                   /translation="MQSKHNTPEYILFFIAPGFSMMGLTSAVDPLRVANRFAPETFSWE
FT                   FVSARGGAVTASNRMTVLTRSIQRSRHQPDLVLVCTGFDVDAAVTPNVLEWLRKQAQNS
FT                   VRLGGIDTGSVLLARAGLLKNRRATIHWEALAAFQEDFLDVNAVDDLFVLDRDCMTCSG
FT                   GTAALDMMLQHIGLRYGESLAKDVSEQFLVDRIREPGQGQRMDATARFGIHSPPLRKAV
FT                   QCIERHLDAPLTQQQLAEHVGISVRHLQRLFQEHLQTTPTTFDRTLRLERAWRLLRQTD
FT                   LPVVEVAVACGFASASHFARVFREHYKRSPKNVRSPTEHPV"
FT   sig_peptide     complement(432231..432314)
FT                   /locus_tag="Dret_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.871 at
FT                   residue 28"
FT   gene            432648..433547
FT                   /locus_tag="Dret_0348"
FT   CDS_pept        432648..433547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0348"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: csa:Csal_0039 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67650"
FT                   /db_xref="GOA:C8X025"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8X025"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV67650.1"
FT                   /translation="MSKLSAALVALAAFCWGLSGGIGGVLMAEGWDPVVVSFYRGAIGL
FT                   LFVCGWLALRPMQSGLKSPRLWSWSAIAGLGVAGNFAFYFVSISEGSVAVAATLMYCAP
FT                   VFVYLVSFALKLEKPTLPKWAAIGLVMIGVVLLTRVYDVGAGSVTLVGIGAGLLSGLSY
FT                   AVFIFGFKYAAPHGSPQAILVIAFAALAAILFWLGDAEQTVAVLSTPSWPWFAVLGVLG
FT                   AGLSFLFYIVGLHHTAPSVASIVAMVEPVTASLFGVVVLHENLAGPQILGMALILVTVT
FT                   ALSVYSSAQTEPCEDPLV"
FT   sig_peptide     432648..432734
FT                   /locus_tag="Dret_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 29"
FT   gene            complement(433942..436221)
FT                   /locus_tag="Dret_0349"
FT   CDS_pept        complement(433942..436221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0349"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   csa:Csal_3104 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67651"
FT                   /db_xref="GOA:C8X026"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C8X026"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACV67651.1"
FT                   /translation="MLVLLRKTFLGVVLSGLVAVAVLAAPVQAADQEQDTQPAAYATLA
FT                   DILENEQARNKLIQDLREMAAKQGESGAVGAPQAASPEKLSLPRRMAHIVSGFAATIGT
FT                   RFETIAGNLKGIFATAPGDKAPFDYKALGQAALNLGLVILTVIAAFFLFRRLAHPFFAR
FT                   LSAWSRQGSGKSALLRLTGIVALAAGGDVLVVGLAYVTGNLVATFAVGESGALSTQVAL
FT                   FLNAFLLIELLKAGIRMLFASRYDGLRLLPLAAEHAAYWNRFLARLAGFVGYGMLFVVP
FT                   LTAQNMSNAAGQGVGLLIMLAAFIYATTIVLQNRVAVRDGFSARAEKFSMGTSQVLLRI
FT                   AARIWHLLAITYLVVVLLVTLIRPSDALPFVMLATLKSLIFIGAGVLVSGIVAQFLGKR
FT                   VTLSPELRRKLPLLETRLNAYVPIVFKVVRTIIILVVGLFILDAWGLFDFSGWYTSVAG
FT                   RNLIGTGANVAVILLFALGVWIALASLIEHRLNPDTGTGAPTARAKTLLSLFRNAVAIT
FT                   ITTITAMILLAEIGINIGPLIAGAGVLGLAIGFGAQKLVQDIITGVFIQVENAMNTGDV
FT                   VTAGGITGVAERLSIRSVGLRDLSGTYHIVPFSSVDTVSNFMRDFAFHVGEYGIAYRED
FT                   IDEAVTHLRAAFDELAADPEYADALLEPLEVSGVTALADSSVNIRVRIKTTPGMQWGVG
FT                   RAYNRLVKRHFDAAGIEIPFPHTTIYFGENKDGSAPAANLRMVQDALEQEAQDTAPGEA
FT                   KNENAK"
FT   sig_peptide     complement(436132..436221)
FT                   /locus_tag="Dret_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 30"
FT   gene            complement(436506..437267)
FT                   /locus_tag="Dret_0350"
FT   CDS_pept        complement(436506..437267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0350"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   dol:Dole_0585 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67652"
FT                   /db_xref="GOA:C8X027"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8X027"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV67652.1"
FT                   /translation="MDEYQLLLDLHKNADRQGPGGDAETWKALDLAQVDTSAPLQIADI
FT                   GCGTGASTLLLTQLPNARITAVDLFPEFLDELEKRAARTGVTDKISTLPCSMDNLPFDN
FT                   ETFDVLWSEGAIYNIGFTKGIRDWHRFLKPGGILVVSELTWTTGDRPSEIHTYWAEEYP
FT                   EIETASAKIGILENYGYAPIGYFVLPEHCWSANYYQPMQNRFKEFLDRNGNSDAARAIV
FT                   EAEKKEIALYESYKTYYSYGVYIARKVEGPN"
FT   gene            complement(437518..438366)
FT                   /locus_tag="Dret_0351"
FT   CDS_pept        complement(437518..438366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0351"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: csa:Csal_2886
FT                   substrate-binding region of ABC- type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67653"
FT                   /db_xref="GOA:C8X028"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C8X028"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACV67653.1"
FT                   /translation="MNRLQKMVTLLIVGIVLGLCAHPASAKEQTLRIGMNNWAENVAVS
FT                   NMWKLLLEERGYDVELMDVGNAVMYGGVASGDLDIGMEVWLPTADKPMVERFGDQFDIQ
FT                   EPWYKNTRLGLVVPAYVDIDSIEDLKTQAEAINNEIFGIDSGSSLNALTRDAIKEYDLD
FT                   VEFTESSEPAMLGRLDQSYQAQEPVVVTLWNPHWSFAEYDLKYLEDPANVYGEGDDIFF
FT                   ITREGFAEDFGPVLEWMNTWFMTDAQLSSLMKTIKDTGDPVKGASMWIEDNQKLVDSWF
FT                   Q"
FT   sig_peptide     complement(438286..438366)
FT                   /locus_tag="Dret_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(438513..439820)
FT                   /locus_tag="Dret_0352"
FT   CDS_pept        complement(438513..439820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0352"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   dat:HRM2_30680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67654"
FT                   /db_xref="GOA:C8X029"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C8X029"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV67654.1"
FT                   /translation="MTLYKRGAERYEKTRHPLHFGVFHELRTPEATLHFNLNHEILRAQ
FT                   GHSANWPSELEWLKRTRGNDWVYYSTGGYAGTYETIGENLLTAPISFRIPTPYNEVVKA
FT                   TGEYYLPNVTYPSNAVLGHDPFANAAVQDLIANWPAIVERVWATAGDLPDAHQDALHQV
FT                   RQKTPEALQAAAERFAAIAGGRVSVLPPDARHVDYNILPLTVADGCRYKCRFCTIKNRK
FT                   PFAPRSQKEISDQLGALRDCCGQDLVNTNAVFFGEHDALSAPAEILEYAAATARETLQP
FT                   ETSFMQDWNCLCFGSVDGLLEASDRFFHRLNALGATVYINIGFESADQETLDTIGKPLG
FT                   VEQVEAAFARMLDLNARFANIEITGNFLMDDQLPSGHYPSFLRLVRDSISAPKGKGTIY
FT                   LSPLMHSNPSSKMLFTFNQLKTLSRLPTYLYLIQRL"
FT   gene            440172..440741
FT                   /locus_tag="Dret_0353"
FT   CDS_pept        440172..440741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67655"
FT                   /db_xref="UniProtKB/TrEMBL:C8X030"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67655.1"
FT                   /translation="MKNAAKSATPASSCSPPPWQGGGSREGHNHVRFQAVTTHRGRQTR
FT                   ACATRPYTDNTILCFVTRLLPPSVLLPSGFSSCLRAAACPDCLCQCGFKARPSGRCGGK
FT                   GQHCGFTCRGVWRTPFFRLAPELTSCAPSRALIVSASAGTRPASLVAVEARDNIVVSLV
FT                   GACGARPSFGWRRSRPPARRCAPFLS"
FT   gene            complement(440738..441997)
FT                   /locus_tag="Dret_0354"
FT   CDS_pept        complement(440738..441997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0354"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: csa:Csal_2884 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67656"
FT                   /db_xref="GOA:C8X031"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C8X031"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACV67656.1"
FT                   /translation="MALLEWHSESTAPTWLALLDQAPESIGIDLPAVRTYRLQRVRQEM
FT                   QRHNVQALILSDPVNIRYATGARNMQVFSARNAPSRYLVLTANHSILYEFTGCLHLGRG
FT                   FETIDEVRPSSTASFVAAGPAIADKERAWAQNILATLRELLGGEPETLGLERMNAGVAL
FT                   EIARQGVRVSDAQEPVELARSIKSDEEIKCMMASLQATEIATGHLRDSIRPGITENELW
FT                   SVLHQSIIALNGDYVETRLLNSGERTNPWFQESSNKVIGPNELIGFDTDVVGCHGYYSD
FT                   FSRTFHSGPDQPTETQRTLYTMAYEQIQHNLDIIRPGMSFREYADKAWEIPDRYFANRY
FT                   YLSAHGVGMTGEYPYLYHRADFPDAGYDGTILPNMTLCVESYIGDEGGGEGVKLEEQLL
FT                   VTENGTELLTHYPFEEDLLR"
FT   gene            442579..443475
FT                   /locus_tag="Dret_0355"
FT   CDS_pept        442579..443475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0355"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dvl:Dvul_2672 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67657"
FT                   /db_xref="GOA:C8X032"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X032"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACV67657.1"
FT                   /translation="MVEYSLDQLECFVTAAKAGSFSEAGRQLNKAQSAVSTSVANLEID
FT                   FGVPLFDRSGKYLELTSEGEVLLREAETILYRCARLQNRALAFAADVETRVRVAIDEAL
FT                   RSPLLEVLPEFAAQFPATEMDVSEGLFTDVHRAVALGHADIGLLIGTGIPEPTVKYKLL
FT                   GYIPFQAAVAAHHPLAAKKQVAVSDLEDERQIIITSRGEQRHSEITPFSHRLWVAESYA
FT                   SGLGMIRKGVGWAFLPEPVLQDATGDGSIVALSLELEHRVHTSPLYLLWKRDDVVGQAG
FT                   QWLFEMFAEMGSRLADG"
FT   gene            443798..445909
FT                   /locus_tag="Dret_0356"
FT   CDS_pept        443798..445909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0356"
FT                   /product="Tex-like protein protein-like protein"
FT                   /note="PFAM: Tex-like protein-like; RNA binding S1 domain
FT                   protein; SMART: Resolvase RNase H domain protein fold;
FT                   KEGG: sun:SUN_0722 transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67658"
FT                   /db_xref="GOA:C8X033"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C8X033"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ACV67658.1"
FT                   /translation="MDALHTYLVEKTGIPAKAVGNILALFESGATIPFIARYRKDQTGG
FT                   VEEEQLRAFEEAYRSAERLLERKAAVLRLIEERGHLTDAIRAKVDGAQSLTEVEDIYRP
FT                   YKEKKSTRAGRALAQGLGPLADVLQQAALSEAAFRDKARAYVGGEVADVDQAVQGAQDI
FT                   LAERLSDDPREREVLRNQVRRHGVLEVKPGKAFDTQGVYAGYGDYREKLAGVVSHRYLA
FT                   IMRGVRDKQLRVAIRVDLERTLANILRSKIPKRATSVAELLRAAYQDGLKRLLFPAVER
FT                   EMHAELKERADRQAVAVFGANLRQMLMTPPVSGQVLMGVDPAYRTGCKLAVIDPNGKLL
FT                   ETGVIFPTPPQNDVSGAAATVRELVRRHQVQGVAIGNGTASRETQEFFAGLNRDQGLGL
FT                   KYTVVSEAGASVYSASKLAQAEYPDLDVTLRGAISIAQRLRDPMAELVKIDPKSLGIGQ
FT                   YQHDVDQKLLARKLHETIEDLVNQVGVEVNSASAALLGYVAGLGPKLARGIVADRETKG
FT                   PFGGKKDLLRVAGLGPKAFEQCAGFLRIRQGRDLLDNTGVHPESYGAATRLREEYDPHV
FT                   LSVQDCGPIAAKLGVGRQTLTDIVFELQKPGFDPRQTLPAVPFRDDVRDIEALREGDIV
FT                   SGVVRSIVDFGAFVDVGLKNDGLIHISELSHSRVSHPLEVLAVNQYLPRIRVLRVFPEK
FT                   GQVALSLKE"
FT   gene            complement(446020..446910)
FT                   /locus_tag="Dret_0357"
FT   CDS_pept        complement(446020..446910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0357"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   sat:SYN_03766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67659"
FT                   /db_xref="GOA:C8X034"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:C8X034"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ACV67659.1"
FT                   /translation="MTKIDEHSDKTKEIIYIAHPGQVSPQADDEIDLVELWLILWRRKW
FT                   LVAGVTILATLAATFITVFGIQPAYKATATIRAVETEEFSNKDFLESVLTSNIFKRKVI
FT                   EQNSLLPHYFPEKWNPQEGTWRSGVDIPTSTQVLASGRFPLKIQTSGHEISLTWTDADP
FT                   HFAANQLEKTLDVFRSHLSQATPAETKQIATIDTHIQSLQEIKGATEAPEELNIELASL
FT                   IRKKAELESQRDLYQSFTLINEPLPPSSPTKPRTQLILALTLATSLFAGVFLAFLLEFI
FT                   KNARQRIREGYYEKE"
FT   gene            447158..447475
FT                   /locus_tag="Dret_0358"
FT   CDS_pept        447158..447475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0358"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: afr:AFE_0075
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67660"
FT                   /db_xref="InterPro:IPR026433"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X035"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV67660.1"
FT                   /translation="MDDSTHYHFLKALEANPEISQRQLARELGVSLGKTNYCLRALIEK
FT                   GWVKAENFYRNPDKGRYFYVLTPKGIEARARLTKRFLHRKLREYEELKAEIARLQDEVE
FT                   G"
FT   gene            447487..447639
FT                   /locus_tag="Dret_0359"
FT   CDS_pept        447487..447639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X036"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67661.1"
FT                   /translation="MRVMADLSPNYAQSKNIWHATTRRHEDDRTLRIADKSIEIAIGIG
FT                   IEIDS"
FT   gene            448343..448939
FT                   /locus_tag="Dret_0360"
FT   CDS_pept        448343..448939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0360"
FT                   /product="death-on-curing family protein"
FT                   /note="KEGG: psa:PST_1470 death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67662"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:C8X037"
FT                   /inference="similar to AA sequence:KEGG:PST_1470"
FT                   /protein_id="ACV67662.1"
FT                   /translation="MEQGRRAGEIAIYEAESGIFEVHVKEETVWLTQAQMSALFQRDQS
FT                   VISRHVRNVFDEGELERETNMQKMHIASSDKPVAEFSLDVIISVGYRVKSQQGVRFRQW
FT                   ANRVLKEHLTRGYTINRHRFEENARELEAALQLVRKAAAAPALDAQAGQGLVEILSHYT
FT                   RTFLWLQRYDERGCFRSLPVSPAALPSLPVRAQAV"
FT   gene            449376..450194
FT                   /locus_tag="Dret_0361"
FT   CDS_pept        449376..450194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0361"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: dol:Dole_2032
FT                   3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67663"
FT                   /db_xref="GOA:C8X038"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C8X038"
FT                   /inference="protein motif:TFAM:TIGR01331"
FT                   /protein_id="ACV67663.1"
FT                   /translation="MSLSDPQAYLLTAVHAALHAGRAILDVYETENFDVEMKSDDSPLT
FT                   RADRQAHAVIQAALEPTEVPILSEEGKAIDYSERSAWPELWIVDPLDGTKEFIKRNGEF
FT                   TVNIALVQDHLPVLGVIYVPVTQTCYWACAGLGAWRCQLPPDAAIADLDSLRAQSVELP
FT                   QPMGIPSPRALVIVGSRSHATPELEAFVADMRQHYGAVDFTAAGSSLKICRVAEGSADI
FT                   YPRLGPTMEWDTAAGQAIAEMAGKSVTVWETGERLRYNREELLNPWFIVR"
FT   gene            450478..450957
FT                   /locus_tag="Dret_0362"
FT   CDS_pept        450478..450957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67664"
FT                   /db_xref="UniProtKB/TrEMBL:C8X039"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67664.1"
FT                   /translation="MRSRDEAVPAEGKTRWPGGAPLTARSVHTLQFFFRFVLCHLAVSK
FT                   PLAKASQVPCGTSSSNREWVMNEAPLTAATVRRGEWLLSRMSSDCKERAVKYLLPSARK
FT                   RFQPPVCLALGPRATRNCILSFAQGRVWPGSQLRWPSLYSNYRGIYLNKLPDRSF"
FT   gene            451046..451249
FT                   /locus_tag="Dret_0363"
FT   CDS_pept        451046..451249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:p1B35 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67665"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:C8X040"
FT                   /inference="similar to AA sequence:KEGG:p1B35"
FT                   /protein_id="ACV67665.1"
FT                   /translation="MSQRGLTDADIEYLLQNGTARYKDTTRLWIAMNFPERNDNLVCIA
FT                   ISLEKKLIIKTVMHHFQWEVES"
FT   gene            451246..451437
FT                   /locus_tag="Dret_0364"
FT   CDS_pept        451246..451437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0364"
FT                   /product="Protein of unknown function DUF2283"
FT                   /note="PFAM: Protein of unknown function DUF2283; KEGG:
FT                   pna:Pnap_1349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67666"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:C8X041"
FT                   /inference="protein motif:PFAM:PF10049"
FT                   /protein_id="ACV67666.1"
FT                   /translation="MRVSYEEADDILVVRLSEKKIAKETSQDWNTHISYAEDGTIVEVV
FT                   ILEASKQGAWPLLRSEAA"
FT   gene            451450..451566
FT                   /locus_tag="Dret_0365"
FT   CDS_pept        451450..451566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67667"
FT                   /db_xref="UniProtKB/TrEMBL:C8X042"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67667.1"
FT                   /translation="MLKKNSSDRQASAWLLDEIHKDFYPRRYAKWHEGRHEE"
FT   gene            451569..452123
FT                   /locus_tag="Dret_0366"
FT   CDS_pept        451569..452123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67668"
FT                   /db_xref="UniProtKB/TrEMBL:C8X043"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67668.1"
FT                   /translation="MRPSQRQKTRWPGGAPLTARSVHTLQCFFQIVFFVILQFRSPWPK
FT                   LAKVPDGTRVSDREWVMNEAPLDCGQAPLPGRAKRNSPFVFLCALVSLCEEILHAKPQS
FT                   HQGVGRKGRRWIESPSRLPEVPCGTRSSDREWAMNEAPLPGQVLLPGRANGIRLVPPFA
FT                   GLSVPSRRKMLLPPSCLGDLA"
FT   gene            452185..453645
FT                   /locus_tag="Dret_0367"
FT   CDS_pept        452185..453645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0367"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: dal:Dalk_1490 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: Nucleotidyl transferase; Cupin 2 conserved
FT                   barrel domain protein; mannose-6-phosphate isomerase type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67669"
FT                   /db_xref="GOA:C8X044"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8X044"
FT                   /inference="protein motif:TFAM:TIGR01479"
FT                   /protein_id="ACV67669.1"
FT                   /translation="MPQNTAPSPTHPSPIVPVILCGGSGTRLWPMSRQLYPKQLLPMLG
FT                   GEETLLQATLSRLQSIPDAGAPMLLCNEAHRFMVAAQAQEAGATPAHILLEPVARNTAP
FT                   AIAVAALTAQAAGEDPLLLVLPADHHIANQDAFAQAVASGRAAAEQGGLVTFGIVPDCP
FT                   ETGYGYIRMDLDGDEPDAVPVFEFVEKPDQATAQSYLDAGGYVWNSGMFLFKASTYLEE
FT                   LGRHQPAILEACQNAVQHARNDLDFTRLDEAAFAASPEDSIDYAVMEKTDRAMVVPLAC
FT                   GWSDVGSWAALHETLDQDPDGNVFVGDVQAVDVRSSYIHSNARLVTALGVENLVLVETS
FT                   DAIMVSTLDRVQEVKTLVSALKDQQREVVNVHSKVFRPWGNYECIDCGHRYQVKRITVY
FT                   PGQVLSLQKHFHRSEHWVVVTGTAKVTKDDEEILLTEDQSVYLPLGATHRLENVGKFNL
FT                   ELIEVQTGSYLGEDDIVRLEDVYGRMKN"
FT   gene            454038..454580
FT                   /locus_tag="Dret_0368"
FT   CDS_pept        454038..454580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67670"
FT                   /db_xref="UniProtKB/TrEMBL:C8X045"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67670.1"
FT                   /translation="MSFAPVRRRGKTWEDAETLHNMVMKFPFQTTGANERSFEQGFAVT
FT                   LLNAKEKYNQTIYSQVDRDNHVQSVYCFGKHHRPDMTIGSDGIAVELKYISYAGLKDAI
FT                   GQGHLYRIQNKFVFLILIFSQERKQVYYDIEKGKESDLENTLRYLEENMNIFTYLVPSF
FT                   KLKGTAVRKVIPFSPWE"
FT   gene            455122..456078
FT                   /locus_tag="Dret_0369"
FT   CDS_pept        455122..456078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0369"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: dma:DMR_38190 NAD-dependent
FT                   epimerase/dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67671"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X046"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACV67671.1"
FT                   /translation="MRKTTLVTGGAGFLGSHLCERLLNYGHEVICMDNCFTGNKENIYH
FT                   LMNNPRFEFMRHDITFSLYVEVDEIYNLACPASPIHYQLDPVQTTKTSVHGAINMLGLA
FT                   KRVKAKIMQASTSEVYGDPTIHPQPESYWGNVNPIGRRACYDEGKRCAETLCFDYYRQH
FT                   NLPIKVARIFNTYGPRMYMHDGRVVSNFIVQALQNEPITIYGQGEQTRSFCYVDDMIEG
FT                   FIRLMDTEDEFTGPVNLGNSGEFTIRELAEKVLELTGSKSELIFEPLPEDDPKQRKPET
FT                   KLAQEKLGWEPKIGLEEGLPRTIEYFDAYLKGKLFDA"
FT   gene            456097..462952
FT                   /pseudo
FT                   /locus_tag="Dret_0370"
FT   gene            complement(456526..457044)
FT                   /locus_tag="Dret_0371"
FT   CDS_pept        complement(456526..457044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_19930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67672"
FT                   /db_xref="UniProtKB/TrEMBL:C8X047"
FT                   /inference="similar to AA sequence:KEGG:HRM2_19930"
FT                   /protein_id="ACV67672.1"
FT                   /translation="MEEAFPDARQILDYYHCQEHIHEFANARFADKAARDKWLRETTNR
FT                   LFQNKLGSVLAGLRRMKLTGEAAEKRDALCSYLSKNKDRMDYGKAKRGGYPLGSGAIES
FT                   ANKFISHIRLKRSGAWWKVNLANNILALRCSRYNKSFDRFFAAYEKSQRQDLGPARPSL
FT                   SLCQGGGRK"
FT   gene            complement(457124..458524)
FT                   /locus_tag="Dret_0372"
FT   CDS_pept        complement(457124..458524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_19930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67673"
FT                   /db_xref="UniProtKB/TrEMBL:C8X048"
FT                   /inference="similar to AA sequence:KEGG:HRM2_19930"
FT                   /protein_id="ACV67673.1"
FT                   /translation="MQTALNQSDIYKERAHRKYFSDMKELFDNVYDIIDVPGLSLFENI
FT                   EKLCEHKLYNLDPKMLSAIIETKLEHYFSGFECPLCGCKCSHNKKSKRHIETTYGTVSF
FT                   DSPYYKCKNCDKFYEPYVSALNLRKGKYQYDVQKIVAKVASSVPFDETAEILYDTHGLS
FT                   LSQATVHELTNELAAHARLEEISPEAATIHEIIEQATRPNKARPVLVFAADGAMSPTRT
FT                   EKGKPNAWKEAKGIRVYLLDGQHLAQVLSWHQICDKHRFKSFLQQIKQQNLFPEDKVRI
FT                   CCIGDGAGWIWEAMEEAFPDARQILDYYHCQEHIHEFANARFADKAARDKWLRETTNRL
FT                   FQNKLSSVLAGLRRMKLTGEAAEKRDALCSYLSKNKDRMDYGKAKRGGYPLGSGAIESA
FT                   NKFISHIRLKRSGAWWKVDLANNILALRCSRYNKSFDRFFAAYEKSQRQDLGSAQPHLS
FT                   LCQGGRRK"
FT   gene            complement(458627..459853)
FT                   /locus_tag="Dret_0373"
FT   CDS_pept        complement(458627..459853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0373"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: glo:Glov_2843 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67674"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:C8X049"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACV67674.1"
FT                   /translation="MLVSQLTKLTLDIQGFRVGRVQGDTSGITVDIAPDRRHLLFCSRC
FT                   GSAAKYRDTLKSRYFRHVPLWGIPVWLRYSPRRVRCGHCGIKVEYFPWSTGKHRFTTAF
FT                   AHFLASWARLLPWKHVAQLFGCSWGTVAAAVAQMVEYGLDHQDLSNLTHIGIDEISREK
FT                   GQVYLTNVYDLNTSSLVWSGEKRTKATITNFFTSLGPNKTDKLEGVCCDMWEPYAQVIR
FT                   EMAPKSTMVFDKFHIVRHLNEAVDQVRRDEIREKGQKHKDLVKDTRYIWLKNPWNLTDK
FT                   QASRLSALEKLNLKINRAYLLKESFRQFWSYECRASAKEFLDKWFWWATHSRLKPMRNF
FT                   AWMLRRKEENILSYFDMPISNGSVEGLNNKAKVISHRAYGFRSAKNYIRNLYHCMGGLP
FT                   EPQIMHRFV"
FT   gene            complement(459937..460818)
FT                   /locus_tag="Dret_0374"
FT   CDS_pept        complement(459937..460818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_19930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67675"
FT                   /db_xref="UniProtKB/TrEMBL:C8X050"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67675.1"
FT                   /translation="MQTALDQSDFYKDRAHRKYFSDMKELFDYVYDIIDVPGMSLFENI
FT                   EKLREHKLYNLDPKMLKAIIETKLEQCFSSFECPICGRKCSHNRKSKRHIETTYGTISF
FT                   DSPYYKCKNCDKFYEPYVSALNLRKGKYQYDVQKIVAKVASSVPFDETAEILYDTHGLS
FT                   LSQATVHELTNELAAHARLEEITPEAATIHEIIEQAIRPNKARPVLVFAADGAMSPTRT
FT                   ENGKPNAWKEAKGIRVYLLDGQHLAQVLSWHQICDKHRFKSFLQLIKQQSLFRVHSVAA
FT                   TVFKRFLTQICA"
FT   gene            461071..461553
FT                   /locus_tag="Dret_0375"
FT   CDS_pept        461071..461553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0375"
FT                   /product="putative transposase"
FT                   /note="KEGG: ppr:PBPRA2370 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67676"
FT                   /db_xref="GOA:C8X051"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C8X051"
FT                   /inference="similar to AA sequence:KEGG:PBPRA2370"
FT                   /protein_id="ACV67676.1"
FT                   /translation="MPPHLPKQMKEAAVHQALTGHSTTKQIAKEYGVGLSSLNRWIKNA
FT                   KNSGAPGMAQKEKRPKDWTREERLNALLEAAKLSDEELGAWCRQKGLHTHHLEKWRKEL
FT                   AQEQPSAEKTTSKQLKKEIKELKSELNRKDKALAETSALLVLKKKADAIWGDNEDD"
FT   gene            461619..462596
FT                   /locus_tag="Dret_0376"
FT   CDS_pept        461619..462596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0376"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   ppr:PBPRB1457 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67677"
FT                   /db_xref="GOA:C8X052"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C8X052"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACV67677.1"
FT                   /translation="MKKACEILGISVRSLQRWRQPETIEDKRKGSSIFPSNKISEIERQ
FT                   RILKVLSSAEFRDKTPHQIVAELADQGKYLASEASMYRILKEVGQNTHRQDSNPKKHQK
FT                   PTELVATDANQIWTWDITYLPSATKGSFFYLYMVMDLYSRKVVAWQVHDREDATLASEV
FT                   IREACYQEGVAREQLVLHSDNGSPMKGATMLATLQQLGVMPSFSRPHVSNDNPYSESLF
FT                   KTLKYRPWYPHRPFQCVSEAREWVEGFVQWYNFEHRHSKLEYVTPNERHTGQDKAILAN
FT                   RRAVYQRARQKQPERWSGQTRQWATTVAVTLNKHRTSKAEKSAA"
FT   gene            462978..464114
FT                   /locus_tag="Dret_0377"
FT   CDS_pept        462978..464114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0377"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gur:Gura_3776 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67678"
FT                   /db_xref="GOA:C8X053"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C8X053"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67678.1"
FT                   /translation="MVMVQKLKTVTLYQDFKEDKRTSIDIFSDFLETYLLKFINESYKI
FT                   YRFQPKIPSIINKLPDKINLRMRAARYIGYPLQAKKSQGEINHIMEEGYGHLLYTLDPN
FT                   RTVVSVHDLIPMLAWNNEIPGMTYSHRPRLAEFSFKALSRARKIIANSHSTKNDLIRLC
FT                   NINPDKINVIYQGLDPEFHNVSINNKQIPRQMLNFPDCSTHLILITGQQEYKNHKTCLK
FT                   VIEGLQEISRKPVQLVRLGRKTMNWDQQIKKANLKNFPICLQNLPRKEVIEVYKAVDCL
FT                   LFPSWYEGFGRPPLEAMACGTPVVTSNRASLPEVVGNAGLIADADNVNELTNKVNRILT
FT                   DDVFYQDLVEKGKKRSTSFTWESTVKQLMHVYESISSS"
FT   gene            464315..465361
FT                   /locus_tag="Dret_0378"
FT   CDS_pept        464315..465361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67679"
FT                   /db_xref="UniProtKB/TrEMBL:C8X054"
FT                   /inference="similar to AA sequence:KEGG:Gbem_1617"
FT                   /protein_id="ACV67679.1"
FT                   /translation="MKILVIGDLRKEIARSFQRYNALKELGHDVTGLSFFISHNKYNNI
FT                   NHKLLYRIFHKLGFPLDNTKINYRISDHIKKHHFDLIWIEKGLMVKPSVLRKAKTIHPY
FT                   LKLLSYTEDDMFARHNQSWYYKKCLPLYDIVITTKSYNCNSEELPALGARKVFFVDKAY
FT                   DKYRHRPIELTQQDIQKFGADVGFIGTYEKDRAEKMLYLAHNGIKVRIWGNGWGDWVGK
FT                   HPNLQVENKPVYGDDYVKAICATKINLCFLRKINRDLQTDRTMEIPACGAFMLAERTEE
FT                   HSRLFEENFEASFFDVNDPEELFEKVSYYLQHDDERQQIAKAGRQRCIESKYSHHDRLQ
FT                   YILSKIIG"
FT   gene            465367..466428
FT                   /locus_tag="Dret_0379"
FT   CDS_pept        465367..466428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_1264 SecC motif-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67680"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X055"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67680.1"
FT                   /translation="MNVLHRLHNLKSYIQNNGLKEVILRRVVDRLVHDYWKGKIYLHPR
FT                   NFYHPLNSIQIERPIFLLGTQGGGGTIVSRLLRQHPDVVYITGNNMFWGGEDELHNIQR
FT                   FKKLPDEWVLRSPGYNNLLGTEEYHPSFGYERSWLYATNALLPWYRLTESHWSEYVENS
FT                   IVNVLKRCIRAYAKDPHLARFHDMSQSFALKVPLLKKIFPDAKFILLIRNPFAMCWREV
FT                   TKKNNKYRHFAKIPDQKQALQWAVEHWYNTYSIALNDLDDNTDNYILRYEDFVLEPEKY
FT                   VYTLLDFCDLDKERYELPAYNMNIPLGTKSRNKWWPVSKHANFGYLQDIPKWAIDTIQY
FT                   HCSDIVDDFDYKY"
FT   gene            466478..467653
FT                   /locus_tag="Dret_0380"
FT   CDS_pept        466478..467653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0380"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pub:SAR11_0550 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67681"
FT                   /db_xref="GOA:C8X056"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C8X056"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67681.1"
FT                   /translation="MKVIVSVNGRFHAFDLAIQLHRHNVLHSLITSYPKFKVLEWNIKK
FT                   SQIKSLIFTEIFKRSIQRLPNLCSNLPTIAQKFIFDKRTASNIPSDADIFVGWSSNSLH
FT                   SIRKAKQMGLVTILERGSAHMLTQQKLLTDEYEKYGLKPKIAPDKIVEKELKEYEEADY
FT                   ISIPSSFVSQSFVEHGINKNKLIQVPYGVDLTHFKQIEKEDSIFRVIYAGRLSLQKGSH
FT                   YLLQAIYELDLPNFEFWHLGSMAQEIEPFLKKYDSKKIFLKGHKPQNELYKYYSQGNVF
FT                   CFPSIHDGFGMVIIQAMACALPVIGSEKTGTSDIVEDNKDGFVIPIRDVEAIKEKILYL
FT                   YENQDICYQMGQAAKEKVSSGFTWDDYGRKMIGQYQRILDARGQNQAHIHS"
FT   gene            467616..468533
FT                   /locus_tag="Dret_0381"
FT   CDS_pept        467616..468533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SM_b21237 sulfotransferase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67682"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X057"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67682.1"
FT                   /translation="MQEDKIKLIYIASNGRSGSTLLDLLLGCHPKIWTLGEFQILPWEI
FT                   MTPRQTCGCGLNVKECPFWCNIVQKFDDQLTEGSIHKFRESHGQGKVLRNSELFRILMS
FT                   QKSFLSHTNGFEGYGRENARVMNEIKRKVQDKKPVEYLVDASKDPYRLYWLAMSGYFSI
FT                   YAIHLTKDPRAFVYSMIKNNSSDTRKTVRMSLRYEVENRIIDLVCKKAPLKESMHIRYE
FT                   DLASHPQDTMKAVYQKFGIDFSDYDPDNFRQAENHAISGNQMRHRTDEISLDEKWRRNM
FT                   PKSTQKIVQTITALAGRRYGYYKA"
FT   gene            468530..469933
FT                   /locus_tag="Dret_0382"
FT   CDS_pept        468530..469933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0382"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   sme:SM_b20950 putative transport protein, Wzx"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67683"
FT                   /db_xref="GOA:C8X058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X058"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACV67683.1"
FT                   /translation="MSLAKSAIQGGLWMAGIRYIAFIINFVGNIWLARLLVPEDFGIFA
FT                   LAMSISEILFMIGGFGLAKACIQLQDQPKVFDTGLVFAWALTALLSVIGLISAWVATNV
FT                   YAHDVAIFLVVLCLIKSLQFPGSVYLAYLEKDFAFRKSAFISGFGRSIAICLAIALAIW
FT                   GLGKWSLLLREVMAIGFVFLGSLIFSPFRFGFSFDKNTAKKIWRFSFGMFFMRMSEVLF
FT                   NRAPNLVLGSLAGPATLGLFERSLYVSNLPNTMLSQFYGKVGFAVFSKVKNQPEKIAKG
FT                   LEWNLFFASRIMFLAGLLVFLFPELVLTTLLGQQWAEAAPFFQGFTPFIVTLPIFAILK
FT                   HGLLAIGATRPVTVSRIVGVFIVGVGTLMAWFSDSQWVVVPWFMSWASLIGIILLAIAC
FT                   YKHKMMINLFRVIKFPFFIAMLFIFAVMITPCVKPSLKFICITILAWAIIFIFLDKNKL
FT                   SIFYNICKR"
FT   gene            470086..471318
FT                   /locus_tag="Dret_0383"
FT   CDS_pept        470086..471318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67684"
FT                   /db_xref="GOA:C8X059"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C8X059"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67684.1"
FT                   /translation="MDIFLKRNNFVCISIFTSLVVIYRLINPLFSSLNTVNYILIMLFL
FT                   FLAFVYYYCYSLFKVSIDFKIDKVIALNTSLLFVFLIISTIRNDIDAILESFMFFGGIM
FT                   GYWTLTKVVNFNIPIFLKLSLYVLLPISIISALIFTQQVQGLSLFAFTGDQWRVYIVSI
FT                   ANTKRLANFLLLSGLFYFLSYRNKVTYNTYLSLFSISLGLYLSIFSGSRTNFIIVIILP
FT                   IILLTIKTFFARLKRYRYVLLLLPFIIIAFIYSTTLYIEYNNVKLPGFAGELTKTTSDH
FT                   GEVGAGRIWLWYYHLDLFKDNYLTGVSADKVDFKKGDMINGTRARAGGESYWTISLARY
FT                   GVFSFLFYISLLYFGYLGIKYKSIESTVLYFVGIILNTTMADIGQTYGLNSILFFLLWF
FT                   SSLHFHMNAKY"
FT   gene            471336..472514
FT                   /locus_tag="Dret_0384"
FT   CDS_pept        471336..472514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0384"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   geo:Geob_2133 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67685"
FT                   /db_xref="GOA:C8X060"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C8X060"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67685.1"
FT                   /translation="MSFSIVFTFVGYYLPGYKSGGPVRTIANMVEHLGDDFDFRIVTRD
FT                   RDALDTEPYPDVKIDSWNTVGKAQVFYASQETLGLCGVARLLRETPHDVLYLNSFFSFG
FT                   FTALPLLARRLGLAPKKPCVIAPRGEFSAGALALKAWKKKAYLRLTRAVGISSGLAWQA
FT                   SSQHEVDDIRYAIGNTANNIFIAPNLPSPLQNELQITSENNAIADDSYLRIIFLSRVSP
FT                   KKNLDFALKVLGQVTVPVVFDIYGVIDDNAYWDKCSQLINTLPEQIKVFYHGVVNHKDV
FT                   HELLSGYDLFFLPTHGENYGHAIYETLAAGVPPLISDQTPWRDLDEKGAGFVRRLADFD
FT                   EFVSVINAYAYKTDDERTFFQKSAHDYALQVASGSEVLEQNRKLFQLAACGE"
FT   gene            472519..473226
FT                   /pseudo
FT                   /locus_tag="Dret_0385"
FT   gene            473305..474609
FT                   /locus_tag="Dret_0386"
FT   CDS_pept        473305..474609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67686"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:C8X061"
FT                   /inference="similar to AA sequence:KEGG:sce7845"
FT                   /protein_id="ACV67686.1"
FT                   /translation="MNVDIQYKSLSLDKNNIDVRPGDWVVIKPNLVKECKESDESEWES
FT                   VITSPALIDRVCEIVCEKLNGKGKISICDAPQTDSSFFKISERAGLYAIAKKYMARYQI
FT                   SIEVFDLRNEEWTNKKGIISERKKLSGDPQGSIAFNVGRASFFYGYRGEGKYYGADYDS
FT                   AIVNKHHCGEKQEYLICATPVLCDVLINMPKLKTHKKTGVTLSLKNLVGINADKNWLPH
FT                   HTEGDPSSGGDQFPELSFKKRLEQVAVRNVRRMALAIPLLGPKMAQYLRKAGTKTFGSG
FT                   DEVIRSGNWYGNDTTWRMVLDLNRCLLYGNPDGTLRTSNPKRYYTVIDGIVGMEGNGPM
FT                   QGEPVASDLVISGADPVATDMVAAKLMGFDWRKIPVIREAFKVQNYPITLSSPKEVYIS
FT                   SNNSEWCGLFSDIEKKNFLSFKPHFGWQGHIEYEK"
FT   gene            474599..475999
FT                   /locus_tag="Dret_0387"
FT   CDS_pept        474599..475999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0387"
FT                   /product="Coenzyme F390 synthetase-like protein"
FT                   /note="KEGG: vha:VIBHAR_00696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67687"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8X062"
FT                   /inference="protein motif:COG:COG1541"
FT                   /protein_id="ACV67687.1"
FT                   /translation="MKNKIDIESIYLKLPIFLQNILVSIEGKRIQRRRYSRHFYNIFNE
FT                   VIDRFCDLDMAFQGDYQKKRLRDFLQKARLSPFWYKRFLDYEVDPDAEDVFQELRKLPV
FT                   LSKDEVKDHAHDIDISAQLDVDFFSCHTSGTTGSGLVFPVSKEAEREQWATWWRYRLWH
FT                   GIKFDTLCGYFGGRSLVSLSQQKPPYWRVNRPGRQIMFSAYHLSDKTAPDYIAALNRYR
FT                   VPWIHGYPSTIALLAGLKRDLGLPDIPSLQVATIGAESLLSQQRELIENVLKVPVREHY
FT                   GLAEGVANISECPNGRLHVDEDFAYVEFLPVNRDGTLFKIVGTNWSNPVFPLFRYDTGD
FT                   IATIEDNECSCEKEGRVVKCIDGRKEDYVSLPSGAKVGRLDHIFKDMININAAQIYQPN
FT                   VEDIVIRVVPGKNFNRKRDEKDILSETRKRLGNEISISFEYVSELPKTKSGKLRFVVSD
FT                   VQENKIAV"
FT   gene            475996..478161
FT                   /locus_tag="Dret_0388"
FT   CDS_pept        475996..478161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0388"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Semialdehyde
FT                   dehydrogenase NAD - binding; Alcohol dehydrogenase zinc-
FT                   binding domain protein; KEGG: vvy:VV0357 putatve
FT                   zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67688"
FT                   /db_xref="GOA:C8X063"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X063"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV67688.1"
FT                   /translation="MKQILQDLQNGKTELVEVPKPRTKSGHLYIQSSTSLISAGTERML
FT                   IDFGKGNYLQKARQQPEKVKEVLDKVRTDGLMPTVEAVRSKLGAPLPLGYCNVGRVEDP
FT                   ATSFKGQVLSFKKNDRVASNGPHAEYVCVPKNLCAKVPDNVSDEEAAFTVIGAIALQGV
FT                   RLAEPTLGEYFVVTGLGLVGLMTVQILSANGCSVLGIDFDPDKCRLAERFGAKAVCLGQ
FT                   GEDPLRVADGFSKGRGVDGVIICAATKSNDPIRQATEMCRRKGRIVLTGVTGLELSRDL
FT                   FFKKELSFQVSCSYGPGRYDPEYEDKGKDYPFEFVRWTEQRNFEAVLDLMAAGKLDVKP
FT                   LISHRFVFENAEDAYRMIADNSEPYVGIILDYQSSEGGGRKTEGGGWTVQLRSSQTSDL
FT                   RSPTSAVVGMIGAGGYTGQVLLPAMGKGSDVRFKTIASGTGVSGTHLGKKFGFEQSTTD
FT                   TEALLSDPEINTVFVTTRHNTHYRFVMQALEAGKHVFVEKPLCMNREELDDISNAYADR
FT                   GSLTSNHRPPILMLGFNRRFAPLIQQMQQALGAMSGPKSMIMTVNAGEIPLEHWTQDPQ
FT                   VGGGRIIGEACHFIDLLRYLAGAHITGYDKTVMQSAGGDTLTITLRFADGSIGAVHYFA
FT                   NGSKMFPKERLEVFCEGKILQMNNFRTLKGYGFPRKGRGGNKRLWRQDKGQQAEMQAFF
FT                   AAIREGQASPIPFEEITEVMRVTLALA"
FT   gene            478219..478605
FT                   /locus_tag="Dret_0389"
FT   CDS_pept        478219..478605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67689"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:C8X064"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67689.1"
FT                   /translation="MPCQDILRGHVEPEARKVSIYFWSPDEAHGFSKWLATSRLDIKVK
FT                   KKLLAQLAIFSTNGLPRTNKEKFRHVAGKICELKPTSQVRLLGFEVHPDFIIVCMGVKK
FT                   KQKLAPELIAKAQQRRELYYADGQ"
FT   gene            478589..478996
FT                   /locus_tag="Dret_0390"
FT   CDS_pept        478589..478996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0390"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: tau:Tola_2854
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67690"
FT                   /db_xref="GOA:C8X065"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C8X065"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACV67690.1"
FT                   /translation="MQTDNEYSGVIDGIFSQISEQEMQYEELLHTVSEEINRIMCKEGL
FT                   TKAELADKMGVSRPYITKLLRGTNVSLQTLAKVASALGYKTCISMIPKHWEARVFAVSP
FT                   VNKQRQGDRRARFADGFREKEGYAYAGVATR"
FT   gene            478968..479405
FT                   /locus_tag="Dret_0391"
FT   CDS_pept        478968..479405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67691"
FT                   /db_xref="GOA:C8X066"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C8X066"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67691.1"
FT                   /translation="MRMPVLQLVEYVFPEIECRENPDCPRNPDAVCPPEVQVNPRMAVK
FT                   EDDDAIYRLALEIRFGSEGEHCSYIGRVKVVGIFSVASEVEEKEKQVYINGASILYSAA
FT                   REFVLSITSRGPSFPLMLPTVRFNTCEHEEDFASQDQARPD"
FT   gene            479407..481080
FT                   /locus_tag="Dret_0392"
FT   CDS_pept        479407..481080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0392"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   dal:Dalk_1335 heparinase II/III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67692"
FT                   /db_xref="GOA:C8X067"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:C8X067"
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /protein_id="ACV67692.1"
FT                   /translation="MGRRFPAMDIQTYFHTLRHLKAGQIYARLIRKLRRPQIDSRPAPD
FT                   IRTGGRQDWVQPVKRPQSMLGPATFCFLNQTHTLHWPQGWNDAVADKLWLYNLHYFDDL
FT                   HAQGAEERTAWHHRLLLRWVDENPPGKGNGWEPYPTSLRVVNWVKWALAGNTLPEAAVH
FT                   SLAVQVRWLGKHLEYHLLGNHLFANAKALVFAGAFFEGQEARQWMDKGLAILAREIPEQ
FT                   ILPDGGHFERSPMYHAIAVEDMADLVNICRAYPHSLPQQGHELVRSWPDTVQRMLEWLQ
FT                   AMCHPDGNIVLLNDAALNIAPGPKQLAQYCQRLGIRPASRESGERLRVTQLPDTGYIRV
FT                   DAGEAVAFLDTAPIGPDYLPGHAHADTLTFALSVWGQRLIVDSGASCYGLGPERLRQRS
FT                   TAAHNTVVVDGKDSSEVWSGFRVARRAYPKGLTVRQDHEVVTVQCSHDGYTRLPGSPVH
FT                   TRRWEFTPGKLGMQDSISDAQSGAQARLHLHPAWHCRRVDGHTADLHLAPGKRVRVAIR
FT                   GGQMTMEESTWHPEFGASLPNICLVLDFYGQLYTEIGWDV"
FT   gene            481077..482288
FT                   /locus_tag="Dret_0393"
FT   CDS_pept        481077..482288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0393"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   dal:Dalk_1334 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67693"
FT                   /db_xref="GOA:C8X068"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C8X068"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67693.1"
FT                   /translation="MNIVFLTDNFPPEVNAPATRGYEHCQEWIRQGARVTVITCAPNFP
FT                   SGRVYPGYRNRLYRKEDMDGITVVRVWSYMAPNAGFARRVLDYASFAFTGFLAGIFHKA
FT                   DIVLTTSPQFFTNFAGLGLSVLKRRPWVFELRDLWPESIRTVGAMRESKVLDWLEAMEL
FT                   FFYRKASRVVAVTPAFKRNLVSRGIAAEKIEVVPNGANMQRFTPLPKDQALEAELGVSG
FT                   KFVIAYIGTHGLAHSLEFIVRSVAQLPDTDVHFLFVGDGAEKERVVQVARELGVKNATF
FT                   VPPVPKDQVGRYISVSDAALVPLIKAETFTTVIPSKIFESAAMRKPIILGVEGQAQEIV
FT                   EEHGAGVCFEPENEADFLRQVRRLKDDPDLYAQLQNGCARLAREYDRQKLAGEMLQVLQ
FT                   KAIG"
FT   gene            482459..482866
FT                   /pseudo
FT                   /locus_tag="Dret_0394"
FT   gene            482863..484083
FT                   /locus_tag="Dret_0395"
FT   CDS_pept        482863..484083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0395"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: dal:Dalk_1333 UDP-N-acetylglucosamine 2-
FT                   epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67694"
FT                   /db_xref="GOA:C8X069"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:C8X069"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ACV67694.1"
FT                   /translation="MKIMSVVGARPNFMKIAPFIRAIEDYNNAFREDSQPVPPSRPPSG
FT                   SLHHSATSPLQHILVHTGQHYDDKMSLAFFEALDIPQADINLEIGSGSHAEQVGQTMIA
FT                   FEKVLREHRPDWVVVVGDVNATCACSITAKKEHVKLAHIEAGLRSRDMTMPEEVNRLVT
FT                   DRLSDLLLTPDQLSSANLRAEGAAATAIHFVGNIMIDTLEHQRAKAERLEIATIVQENA
FT                   IAGQKRPEASPLRQDAFALMTMHRPSNVDDAGTLTAILDFLLEEVAAEMPLVWPIHPRT
FT                   QQRLQDCGLWEKVLDCPGVLLLHPLGYHELLRLNMAARVVLTDSGGLQEECCVLGTPCL
FT                   TLRWNTERPVTLQEHGGASILVGNDVHKIRDAYREMLVAERAPARPELWDGRTAQRIVQ
FT                   ALVAFEG"
FT   gene            484137..484286
FT                   /pseudo
FT                   /locus_tag="Dret_0396"
FT   gene            484885..485799
FT                   /locus_tag="Dret_0397"
FT   CDS_pept        484885..485799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0397"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   vei:Veis_2394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67695"
FT                   /db_xref="GOA:C8X070"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C8X070"
FT                   /inference="protein motif:PFAM:PF07605"
FT                   /protein_id="ACV67695.1"
FT                   /translation="MDIEDVVAAGGNQRVFRAKYKINQPGFISHITQRAAGKEPLFLEK
FT                   GDYLHFLALLKESASRFELGYYAFCLMPNHVHLLVEPHKPNLDSGMHSLFFRYATFFNR
FT                   KYQRRGHLFGGRYRQALCLAPDYLLTASVYIHLNPVRAGLTKRASDYPWSSAAVYCRQA
FT                   EQDSFLLPERICTLVAADPDEARQVYARLLHQGRADAPENAQEQPGVIEKFCDRLGARF
FT                   PKLFGRLQSKRVLPHDTSMPLQGSPSLEQLLAQFPTGSARRPETRQAKKYVLEQLEARG
FT                   FPRKEIAERLGIAPKTVYNLLHS"
FT   gene            complement(486104..487504)
FT                   /locus_tag="Dret_0398"
FT   CDS_pept        complement(486104..487504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_19930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67696"
FT                   /db_xref="UniProtKB/TrEMBL:C8X048"
FT                   /inference="similar to AA sequence:KEGG:HRM2_19930"
FT                   /protein_id="ACV67696.1"
FT                   /translation="MQTALNQSDIYKERAHRKYFSDMKELFDNVYDIIDVPGLSLFENI
FT                   EKLCEHKLYNLDPKMLSAIIETKLEHYFSGFECPLCGCKCSHNKKSKRHIETTYGTVSF
FT                   DSPYYKCKNCDKFYEPYVSALNLRKGKYQYDVQKIVAKVASSVPFDETAEILYDTHGLS
FT                   LSQATVHELTNELAAHARLEEISPEAATIHEIIEQATRPNKARPVLVFAADGAMSPTRT
FT                   EKGKPNAWKEAKGIRVYLLDGQHLAQVLSWHQICDKHRFKSFLQQIKQQNLFPEDKVRI
FT                   CCIGDGAGWIWEAMEEAFPDARQILDYYHCQEHIHEFANARFADKAARDKWLRETTNRL
FT                   FQNKLSSVLAGLRRMKLTGEAAEKRDALCSYLSKNKDRMDYGKAKRGGYPLGSGAIESA
FT                   NKFISHIRLKRSGAWWKVDLANNILALRCSRYNKSFDRFFAAYEKSQRQDLGSAQPHLS
FT                   LCQGGRRK"
FT   gene            complement(487489..488136)
FT                   /locus_tag="Dret_0399"
FT   CDS_pept        complement(487489..488136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0399"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tgr:Tgr7_2078 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67697"
FT                   /db_xref="GOA:C8X072"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8X072"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV67697.1"
FT                   /translation="MTAADSRFQGPLSDVEKLSAVHDLTHFDCGKNSLNVWLQRYARQN
FT                   QKAEAAQTYVVHREYRVTGYFTLTYGSVQPEEAPARIIKGLARHPVPVVLLARLAVDVN
FT                   EAGKGLGKALLKQSLIQVDAAADIAGARALLVHALDEPARGFYEHFGFEPSPVDTYTLL
FT                   LLMKDLRGVHSVAATVFKKSNCQISNCYLLKSFGKYCNISANLPEVLPCRLL"
FT   gene            complement(488133..488429)
FT                   /locus_tag="Dret_0400"
FT   CDS_pept        complement(488133..488429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0400"
FT                   /product="Protein of unknown function DUF1778"
FT                   /note="PFAM: Protein of unknown function DUF1778; KEGG:
FT                   hch:HCH_05628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67698"
FT                   /db_xref="GOA:C8X073"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:C8X073"
FT                   /inference="protein motif:PFAM:PF08681"
FT                   /protein_id="ACV67698.1"
FT                   /translation="MPNTTKREKCSERFSFRISARNNELIRSAAQLKNMSASQYAAESA
FT                   ANQAEMDLADRRSFSLSEGQMQEFLNALDRPIQEKTRLRQLFREKTILDRDSE"
FT   gene            complement(489047..490522)
FT                   /locus_tag="Dret_0401"
FT   CDS_pept        complement(489047..490522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0401"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: dma:DMR_04940 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67699"
FT                   /db_xref="GOA:C8X074"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C8X074"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACV67699.1"
FT                   /translation="MTTLLIAFLFAWGLCLLLTPIARRLGRQCGAVDEPNARKVHACPV
FT                   PRTGGVAIIAAHILGLLTIKLIGTDISSLLTSETALLSLWGGAALVFGIGLWDDCKGLA
FT                   AKPKLAVQVLAATCAFFGGVAIDPSPLFGWLPILDSWLGSYLLTLFWFVLLINAMNLID
FT                   GLDGLAGGIALFVCLVLSVIQVINRDFLLALYFLTLAGSVAGFLRYNFNPATIFMGDSG
FT                   SYYLGFMIAGLSILGSVKSHVGATLTLPLLAMGVPVFDTLFAPVRRIILGRRPFEPDRH
FT                   HLHHKLLALGLSSKRVVLVLYAVTAALCATALILVNLQDEQSGLLLVLLGVGVVIALNG
FT                   LGYFRYVDREKVGSWFRDVGFVTGLHRDRRRFLDLQVRINQSQTFDALWETIAHGLALL
FT                   DIDYGEIRLTSNSEATDVHRNWTRSKKGIDLQAQGLLKMELPLQCQEGRYLGELWLVKD
FT                   IKRSDLGHYTLSRIEHLRRAVVRTLSRWDKPST"
FT   gene            491026..492666
FT                   /locus_tag="Dret_0402"
FT   CDS_pept        491026..492666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0402"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   sat:SYN_02385 glutamate synthase [NADPH] small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67700"
FT                   /db_xref="GOA:C8X075"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X075"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ACV67700.1"
FT                   /translation="MHIPPKSNDVLGTVNRGTPCESGLCTLCRADCQGKCEMWMSSLAG
FT                   RKMLYPRDFGIVTAGSARTTHTGVSYSSLRIQGFCYGSDGLAEGLSNDPDDCVFPNVGL
FT                   ESEFGRHKTTKVRLPLMTGALGSTFIASKYWDSFATGCALTGIPIVIGENVVGVDRDAE
FT                   LSNGRITKAPELDRRIDTYLRYYDGYGAIIVQLNIEDARNGVAEYVAEKYGDQVVIELK
FT                   WGQGAKNIGGEIEVNSLDYALFLKERGYVVDPDPTKPGVQESFKAGGIRAFARHSRLGF
FT                   TDLSTADGVSEAFMDAVAELRKLGFSRISLKTGAYGMEALALAMRLATDAELDLLTIDG
FT                   AGGGTGMSPWNMMESWGVPSVLLHAKAVEYAKMLAAQGKRVVDLSFAGGFGTEDQIYKG
FT                   LALGAPYTKLICMGRGLMIPGFVGANVEGALNPERKANVHGHWNSLPKAVADRGQSAAE
FT                   IFAGYYDLQEKVGADEMANIPYGAIAMWTAMDKIGAGLQQLLAGARHFSLSEIERNDIA
FT                   SANRETEQETGVPFIADVEDEVAKRLLKA"
FT   gene            complement(493422..493877)
FT                   /locus_tag="Dret_0403"
FT   CDS_pept        complement(493422..493877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0403"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   dma:DMR_41750 putative nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67701"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C8X076"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ACV67701.1"
FT                   /translation="MTRHRIRILFLLLVLIGSTGSAWAWPGRVLEIASSQVLVIKTEQE
FT                   VKRVSLFGVDSVPKGHPHQAQVQRCIKNELAPLNRVEVVPVQGHQAHVYIEGDGQNLAE
FT                   ELIRAGYAWVDRADCGTRICRFWRSLEAQARQEHRGLWAEPSFPVGK"
FT   sig_peptide     complement(493803..493877)
FT                   /locus_tag="Dret_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(493864..495237)
FT                   /locus_tag="Dret_0404"
FT   CDS_pept        complement(493864..495237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0404"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: gbm:Gbem_3948
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67702"
FT                   /db_xref="GOA:C8X077"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C8X077"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV67702.1"
FT                   /translation="MPQNKGDLTTRPIPQLIRQIAIPASIGIFFHTMFNVVDTYFAGHF
FT                   STQALAALSLSFPAFFLIIAMGSGLQTGTTALIGNALGSYDHEEAGRLALQGLVFGLIT
FT                   GILLTGVGIAVSPWLFRSLGASGDYLAITLEYMDTIFIGAAAFLLVYMNNAILQAQGDT
FT                   RPFRNFLIAGFAANCVLDPWFIFGGYGVPAMGIQGVALATICIQAGGAAYLGWKARKTG
FT                   LVRMQQWRDLIPQWRPCREIARQGLPSSLNYMTIGLGIYVITYFVSDFGPQAVAAYGSA
FT                   MRVEQIALLPSIGLNIATLSLVAQNRGGQRHARIWETIGKALQYGAIVTGIGTVGVLLL
FT                   ARPLMGVFTDDPAVVDIGTTYLRIDALVFFAYVILFVHVAALQGVKRPMFGVWIGLARQ
FT                   IVGPALVFSLLIKVLGVGLLGIWWGIFGVTWAAALTAALVGRRYLARVLAEDAQRDKT"
FT   gene            496274..496783
FT                   /locus_tag="Dret_0405"
FT   CDS_pept        496274..496783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0405"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   HNH endonuclease domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67703"
FT                   /db_xref="GOA:C8X078"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:C8X078"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACV67703.1"
FT                   /translation="MRVLVLNANYTYLHSISWKRAINLYLKGKVEVLQYSTLKVASFGT
FT                   EFMVPAIVRLVKMVRRIYKGKVPLNKRNIFLRDGYRCQYCGGSCRDHPTIDHILPKSRG
FT                   GQTTWTNSVTSCRGCNQRKGNKTPSEARMPLLRQPSQPTIGEFLHIQNHHSGIQELVNS
FT                   LLQQET"
FT   gene            complement(497014..497163)
FT                   /locus_tag="Dret_0406"
FT   CDS_pept        complement(497014..497163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67704"
FT                   /db_xref="UniProtKB/TrEMBL:C8X079"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67704.1"
FT                   /translation="MGASSNCYRYQVAIAIRIGIEIGLWFYAPVGRLEAQRQPTKALVC
FT                   SRWL"
FT   gene            complement(497415..498266)
FT                   /locus_tag="Dret_0407"
FT   CDS_pept        complement(497415..498266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0407"
FT                   /product="transposase, putative"
FT                   /note="KEGG: dvm:DvMF_1219 transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67705"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="UniProtKB/TrEMBL:C8X080"
FT                   /inference="similar to AA sequence:KEGG:DvMF_1219"
FT                   /protein_id="ACV67705.1"
FT                   /translation="MLDTPCTLSEESAHARLSGFCWPDGTVFCPRCRETAIYHLASGRK
FT                   RCGGCGYTFHDFSGRWLNSAGLGSSHWLCFIRLFCQGRPLKEAAEALGRSYNVVYKAAT
FT                   VCRFAITAGSLDGAQIMGRQTGLSACLHKGKVQGLNHVQCQTPPVFGIIERRGMAFLDY
FT                   LPHFTTEDILHFHRSFHLPASCHGNILVTGAYRRYSSLILCGSPDFPWYLITPEHGSRP
FT                   AATPFCAFVLEQLKGYKGISPPRFPLYLKEIEFRYNHAPEKQEELLAKRLCGFVPDETD
FT                   ID"
FT   gene            498418..499515
FT                   /pseudo
FT                   /locus_tag="Dret_0408"
FT   gene            499819..501834
FT                   /locus_tag="Dret_0409"
FT   CDS_pept        499819..501834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0409"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dvl:Dvul_2370 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; MEKHLA domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; PAS domain containing protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67706"
FT                   /db_xref="GOA:C8X081"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X081"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67706.1"
FT                   /translation="MNVTLKNKIFLSMLTVILVISVAIAFLARWILVSGLTSELKMRGV
FT                   AIARSISERGGGYILDKEYPQLLSLIFDEAQLRERHHLIDYIYVLDREHTVLAHTFTRP
FT                   FPESLHMANPIPPGARESMQLVPVAEGEAFDIGVPIKEGIYRIGTVHVGLNKSHIDSLV
FT                   YKLRVTFLGFISAVVVIVFVISHLLAKYITRPIRSLTGAADELSRGNFDVSLEDLSGVE
FT                   LGDKLQQCPAYRDTNVPCWHLDGASPNDGCPEDIAQDEPQCRECVFYRPRSGDEVSQLA
FT                   TAFRNMVGSIRLYRKRLQESEEKYRSLFASGPDPVFVLAQEDMRILDANPRAQEIYEYG
FT                   ADELRGMPFAELAPDQAQKCVHDFVEDMPMQGCVYYPKEIHYKRDQHPFFVNAHACVIS
FT                   YTGCPALIVACTDITEMIEKDAQLIQAAKMKSLGEMSAGIAHELNQPLNAIKMGSDFLA
FT                   LTVERGTELPPERWQGVVHEISAQVDRAAGIIATLRAFGRKETLSKDVLDINEPIKAVL
FT                   SILRQQFQLHNVDFHLALGQNLPPVLAQDTRLQQVFFNLFTNAKEAIEELRRSSPQAEG
FT                   TIHVRTWAADGRVCAAVCDTGPGIPDSLRQTLFEPFVSSKSSGQGMGLGLAITQSLVRD
FT                   YQGTITIDSTPGEGACFTVSFPVAKTAPGVLQRSTP"
FT   sig_peptide     499819..499896
FT                   /locus_tag="Dret_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.811 at
FT                   residue 26"
FT   gene            501831..502547
FT                   /locus_tag="Dret_0410"
FT   CDS_pept        501831..502547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0410"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: response regulator receiver; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SMART:
FT                   response regulator receiver; KEGG: dde:Dde_0710 response
FT                   regulator receiver domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67707"
FT                   /db_xref="GOA:C8X082"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8X082"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV67707.1"
FT                   /translation="MTEAVLVIDDEQPTLDMFALFLEAFGYTPLTALTGEEGLRLFDAH
FT                   QPPLVMTDIKMPGMDGIEVLRAIKKRSPATEVIVITGHGDMELALRALECDAADFINKP
FT                   LGREALETSLERCKERRACSREQEQNIEVQSLESAVVVTAHGHVTSESEPFLRQALERA
FT                   AAKARGAMVLHFPASVSVNGGGLAALESLLREYPQLRVVCLSENFQEVFRRLGLHELAP
FT                   LYGSLEEAVGIDIEEN"
FT   gene            502890..504239
FT                   /locus_tag="Dret_0411"
FT   CDS_pept        502890..504239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0411"
FT                   /product="gid protein"
FT                   /EC_number="2.1.1.74"
FT                   /note="KEGG: dma:DMR_02130 Gid protein; TIGRFAM: gid
FT                   protein; PFAM: glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67708"
FT                   /db_xref="GOA:C8X083"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X083"
FT                   /inference="protein motif:TFAM:TIGR00137"
FT                   /protein_id="ACV67708.1"
FT                   /translation="MSEIHTPQRVAVIGGGLAGSEAAWALAHRDIEVTLFEMKPERFSP
FT                   AHTESGLAELVCSNSLRSDDTTTAVGQLKREMESAGSLIMDAARKTRVPAGKALAVDRH
FT                   AFSAAVTSALEAHPRIGLRRQEIRSLTDPALSGFDAVVVAAGPLASETLAADLVQRIGG
FT                   EDLYFYDAIAPIVNTDSVDMDVAFWASRYNPEEKDYLNCPMDEATYYRFRQALLDGDKV
FT                   PAREFEKSVHFEGCLPVETLAERGELALAYGPLKPVGLEDPRTGKQAFAVVQLRPENAA
FT                   KTMCNLVGFQTKLTYPEQKRVFRMIPGLEQAEFVRMGSIHRNTFVNAPRVLLPHLELRD
FT                   MPGVYLAGQITGVEGYVESAASGFWLGKFLGGRLHGEAVDLPPVETAMGALLGHLSTPN
FT                   KHFQPMNVNFGLMPPLGVRAKKARRKELYAERADRAWQHWLEGQTTEEQA"
FT   gene            504236..505015
FT                   /locus_tag="Dret_0412"
FT   CDS_pept        504236..505015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0412"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dvl:Dvul_2110 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67709"
FT                   /db_xref="GOA:C8X084"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C8X084"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACV67709.1"
FT                   /translation="MNRERVTGLVLTFNGERVLEQTLASLAFCDEILVVDSGSTDRTLA
FT                   IAEAAGARILTRAWEGPGPQFAFAFEQVRTNWVVSLDHDEYCTPELQEEIQGVLANPGE
FT                   MAGWYCPRRSFYFDRFLAHSGWYPDYLLRVFRLERMELKISMPHYSFHPQGPTGKLQGD
FT                   IVHYPYSGLAEHLEKINSYTQSAAEDKFARGERAGLGKALGHGLARFFKIYVLKRGFLD
FT                   GRAGLILALNGFFYVFHKYIRVAELGKEEKKKGSVKF"
FT   gene            complement(505277..505678)
FT                   /locus_tag="Dret_0413"
FT   CDS_pept        complement(505277..505678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0413"
FT                   /product="cytochrome c class III"
FT                   /note="PFAM: cytochrome c class III; KEGG: dma:DMR_02560
FT                   cytochrome c3"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67710"
FT                   /db_xref="GOA:C8X085"
FT                   /db_xref="InterPro:IPR002322"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C8X085"
FT                   /inference="protein motif:PFAM:PF02085"
FT                   /protein_id="ACV67710.1"
FT                   /translation="MKKQICFALACLVVVGFAVLPTLQAQMPPSNITYEAPEIMPRLGP
FT                   SHFSHDSHYAHDCMTCHHMWDGFSEIKSCSAEGCHDQRGTMKMEGSTIYYAFHKKSSQA
FT                   SCLGCHMQLKKAGEPTGPIGCTTCHEKQD"
FT   sig_peptide     complement(505601..505678)
FT                   /locus_tag="Dret_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.907 at
FT                   residue 26"
FT   gene            complement(505923..507278)
FT                   /locus_tag="Dret_0414"
FT   CDS_pept        complement(505923..507278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:506511..506513,aa:Sec)
FT                   /locus_tag="Dret_0414"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="Contains selenocysteine; PFAM: protein of unknown
FT                   function DUF224 cysteine- rich region domain protein; KEGG:
FT                   dvl:Dvul_0771 oxidoreductase, selenocysteine- containing"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67711"
FT                   /db_xref="GOA:C8X086"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8X086"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACV67711.1"
FT                   /translation="MLENANTTPPTPGHHPPHVLDGPPVSTFTAALRDLLPEAGGLDMC
FT                   LTCGLCASGCPASGLEGLDPRKFLRLIALGLEEEAINSPWVWMCTMCQRCIRVCPMQID
FT                   IPQLVYQARARWPREDRPKGIRGSCDQAINKETNSAMGAGAEDFEFVVADVLEEIQENQ
FT                   PDCAELQAPMNKKGAYFFLNQNSREPVTEPDEMVPLWKILNYVGADWTYSSVGWAAENY
FT                   CMFLADDEAWESIVRNKVQAVENLGAKVWLNTEUGHEFYAVRAGLHKFGITPNFELDSI
FT                   IRWYARWIREGLLPVNSDWNNDLGITFTVQDPCQLVRKSLGDPVAEDLRYVVRSVVGEA
FT                   NFREMYPNRSNNYCCGGGGGFLQSGYTEARHAYGQRKYEQIMATGAQYCIAPCHNCHSQ
FT                   IHDLSDHFQGGWHTVHLWTLICLSLGILGENEREYLGPELAEVALPSPSTEP"
FT   gene            complement(507481..508371)
FT                   /locus_tag="Dret_0415"
FT   CDS_pept        complement(507481..508371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0415"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dol:Dole_2256 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67712"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8X087"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV67712.1"
FT                   /translation="MFKDIVLAATSSQVTEAAADAAFAFARKHDARLIVTHVCGLPSPG
FT                   WGAIEHMIPSGEVERIKKQIQEYYGERTCDLENCCYEVIPGVPHSELLRLARKVNADLI
FT                   VMGTHTKEFAEKRAKMWGMAGSTLERVSQKARCPVMVVSRPVPETRMDFKNIVVATDFS
FT                   YQAECAMLYAGQMARQYKAALHVFHVLENGSAGKMATDQEIDRVKQRMADEFDEKLKGV
FT                   QEYHFETWEGTPAMEILKFARLKDADLIIMAHHSKETDPEKAYLGSTVAQVALNASCPT
FT                   MSVNRHFDLRCALYD"
FT   sig_peptide     complement(508318..508371)
FT                   /locus_tag="Dret_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.378 at
FT                   residue 18"
FT   gene            complement(508826..509734)
FT                   /locus_tag="Dret_0416"
FT   CDS_pept        complement(508826..509734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0416"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: dat:HRM2_22770 HdrD2'"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67713"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C8X088"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACV67713.1"
FT                   /translation="MRYAYYPGCSLTATAKEYDTSTRALCARLGITLEEIPDWTCCGAS
FT                   AVEPVSQLLTHVLPARNLALAEGLDENEGVLIPCSACYLNHLRVEMEDAPVPERKRRVN
FT                   TVLAEEDLVYDGDHPVVVHLLEVLGRPEILETLTTETTSPLNGLRIAPYYGCQILRPFA
FT                   RFDDPEIPTSMEPILRAVGAEIHPWRLGNACCGASLMTTHKEVALHNVGRILHSAQGAD
FT                   AVVTVCPMCQLNLEGFQKNALHRFPDDEPLPILYLPQLIGLALGLTPGEVQLNKNLHAG
FT                   EFVHGLAGLVPEKQPEADAVS"
FT   gene            complement(509701..510285)
FT                   /locus_tag="Dret_0417"
FT   CDS_pept        complement(509701..510285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0417"
FT                   /product="putative heterodisulfide reductase, C subunit"
FT                   /note="KEGG: sfu:Sfum_0820 putative heterodisulfide
FT                   reductase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67714"
FT                   /db_xref="GOA:C8X089"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8X089"
FT                   /inference="similar to AA sequence:KEGG:Sfum_0820"
FT                   /protein_id="ACV67714.1"
FT                   /translation="MTTTYSGSHEDAALQQLQDMVQACMQCGTCSASCPNSGAMDLTPR
FT                   QVWRLVLLGQFEDIWHSHTFWLCSNCYTCTLRCPRGLPLTEAVNTLKRLAPRETLHDRR
FT                   QAAFYEVFMDNVRRYGRVQEMDMMLHYFWAMRDPRVPMAFTPLGTKLLRRGKVHPGHPR
FT                   VKGLGKLDRLFAKAQLMEGAPCATPTTPDAP"
FT   gene            complement(510374..513802)
FT                   /locus_tag="Dret_0418"
FT   CDS_pept        complement(510374..513802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0418"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD dependent oxidoreductase; response regulator
FT                   receiver; KEGG: sfu:Sfum_0821 response regulator receiver
FT                   modulated FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67715"
FT                   /db_xref="GOA:C8X090"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X090"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67715.1"
FT                   /translation="MPTQEYAALVVGAGIGGIRAALDLAETEHKVLLIDNKPHLGGLLA
FT                   QLDYQFPSDHCGMCKMLPLTERDDSSQFCLRKGLFHRNLDILLSSRLTSLEGEPGKFQA
FT                   VVKQQSSLVDAHKCISCGQCSTVCPVRIPDTFNAGLGERAAIYLPVPHNIPNQYVVDLA
FT                   HCTRCWKCAEACPTGAVDFKFAERANFPILVAHQDSSLRQSIDQSLADENFPLHWATTG
FT                   EEALRMVEQETSLGLVLLDSTFADVTAQRVLQRGLEIHPDLQVVAMAPESVAEAAQALV
FT                   ANGARTTLATPLTDDFPGWLDKLYLRITSETSHQLEVGAVILAGGFECYDPAPVHDVLG
FT                   YKDHPQVVTSLEFERLLSSTGPCGGDLQRSDGKPVQSIAWLQCVGSRDRQKNADYCSSI
FT                   CCMFAIKEALLAKDHARDQIETTIFAMDVRTFGKGYQRYRDHAEQERGVRFVIARPHSI
FT                   IPDGHGGLLLQYIDENGQPQNAEYDMVVLATGAKPPQDMPGLIQATGIECNEFGFCRTD
FT                   ALAPTRTSQFGVFAAGAFGEPKDIADTVIQASAAALEASRLIYLYAAPKRWEKEPEPTY
FT                   RRVEQEAPRTLVVLCDACPTLEQSVDMPTLTEQLQQMSSVQEVVRIPQACTEAGWQRIE
FT                   DQVRQSAPNRIVLGACLPYAHVPRLRQLGRTVALDPAFMEVVDIYTPTFPDMPLTSEQR
FT                   LREIVSNLGMAVVKVQSASPTPLLKPVPVTPKALVVGAGLAGMTAAMAVADHGMDAYLV
FT                   EEGDSLGGTANRLRSTLEGSDPVKYIQDLCEQVQKHPKITLLTESRITLSMGRAGQFLS
FT                   AVQTEAGQSLTIEHGATILATGGKEAKSYAYGYGTRKTIFSQLQFEDKLATGAIDAGAL
FT                   SGVVMIQCVECREEPRNYCSRVCCATAVKNAITLKRRNPKLPVYILYRDMMTYGFSEHS
FT                   YTEARRLGVVFIRYTPAHKPQVECMDDDRYRVTLTEPILQRPLEIHADLLVLATGIVPN
FT                   EVEELSEIFRVPVDQDGFFQEAESKWRPVEFLRQGVFVCGLARAPGNMRETVASAKAAA
FT                   QRALRLLTHDRIAGGTVTAEVRHSLCSLCQACVNVCPYGARSLDWENEQIVVDEILCQG
FT                   CGACTAVCPNSAAVLRGFQDEQVLAEIDASLGVVP"
FT   gene            complement(513846..514994)
FT                   /locus_tag="Dret_0419"
FT   CDS_pept        complement(513846..514994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0419"
FT                   /product="Formate dehydrogenase"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_0822 formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67716"
FT                   /db_xref="GOA:C8X091"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8X091"
FT                   /inference="protein motif:PRIAM:1.2.1.2"
FT                   /protein_id="ACV67716.1"
FT                   /translation="MATTARIDVKDQGPLGAIRELGHHMLESGDIQALLVAKRLPRQGS
FT                   VMPALISDPAELEEADPLSPAFPLNAAKLVSRLTKGETRGRIGAILRPCEIRAFVELVK
FT                   LNQGSMEDVLLLSLDCFGALPNNEYSALVRQEGTAALTERYLKAVQEGHETVTATFPLA
FT                   PACAICEHPVAEAADLHIGLAGVDLSKHLLLQANTARGEGLLTRLGYQDCPEPPAHRQA
FT                   LEGLRSSKKTARDACFAATQEATTDLDKLSEYLAGCVNCYNCRVACPVCYCKECVFVTD
FT                   VFDHRPTQYLGWANRQGSLKLPTDTVFFHLTRLAHMSLSCVGCGQCSNACPNNIPVMEL
FT                   FRTVAQNTQNAFGYVPGRNPDEPIPLSVFSEEEFEEVVDHLA"
FT   gene            complement(515057..515476)
FT                   /locus_tag="Dret_0420"
FT   CDS_pept        complement(515057..515476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0420"
FT                   /product="methyl-viologen-reducing hydrogenase delta
FT                   subunit"
FT                   /note="PFAM: methyl-viologen-reducing hydrogenase delta
FT                   subunit; KEGG: sfu:Sfum_0823 methyl-viologen-reducing
FT                   hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67717"
FT                   /db_xref="GOA:C8X092"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:C8X092"
FT                   /inference="protein motif:PFAM:PF02662"
FT                   /protein_id="ACV67717.1"
FT                   /translation="MSDFEPTIVAFVCNWCTYTAADLAGTSRMTQRPNVRLIRMMCTGM
FT                   VDPKYIIKALLSGADAVLVSGCHPGDCHYINGNYKARRRVKLLKEMLSNFGIDPRRVRL
FT                   TWVGASEGNEFAATVNALVEEVRELGPCLAQPLAV"
FT   gene            complement(515501..517525)
FT                   /locus_tag="Dret_0421"
FT   CDS_pept        complement(515501..517525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0421"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD dependent oxidoreductase; KEGG: dde:Dde_1209
FT                   heterodisulfide reductase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67718"
FT                   /db_xref="GOA:C8X093"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C8X093"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV67718.1"
FT                   /translation="MAVKIGVYVCHCGTNIASKVDCPEVARFAAGLPGVVVGRDYKFMC
FT                   SDPGQDMIIKDIQELGLNRVVVSSCSPRLHEKTFQKACLRAGLNPFLFQMTCIREHCSW
FT                   VTADPAEATRKAKHLVAAAVNRVQRHAKLYARQEHVHPDVLVVGGGIAGIQAALDVAKS
FT                   GHRVHLVEKAPSIGGHMAQFDKTFPTLDCAACISTPKMVAVAQEPNINLMTYAEVQEVK
FT                   GFVGNYEITVRQHPRYIDATKCTGCGLCLEKCPTKVPSEFEEGLGMRKAIYRYSPQSVP
FT                   ATPVIDADHCRFLNGKKCQVCAKFCPSEAIDFSQKPQDVVLEVGSIVLATGYDAFDPAG
FT                   LEQYGYGRLDNVYTALQFERLNNAVGPTGGKIQLKDGSAPQSVGIVHCVGSRDTHYHEY
FT                   CSRVCCMYALKYAHLIKDKVGHDVAISNFYIDLRCFGKGYEEFSRRVQEEGVTFIRGRP
FT                   AEITDEAQSPAEDGKLVVVCEDTLLGRNLRVPVDMVILCTAMEAGRDAPELARLFGISQ
FT                   GQDGFFLEEHPKLGPVTTATDGVFLGGCCQGPKDIPDAVSHASGAAAQALALATRGEVA
FT                   ISPTTSWIDPDICIGCQVCIGLCAYSAITFDARRGVSVVNEALCKGCGSCAGYCPSGAA
FT                   QIKHFNQQQVFAELEGILEPAAPPPPAEEEALAAEKGAS"
FT   gene            complement(517549..518616)
FT                   /locus_tag="Dret_0422"
FT   CDS_pept        complement(517549..518616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0422"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: dol:Dole_1150 coenzyme F420
FT                   hydrogenase/dehydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67719"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8X094"
FT                   /inference="protein motif:PFAM:PF04432"
FT                   /protein_id="ACV67719.1"
FT                   /translation="MASFFDLLRDIIHPGYCRRCGGCVAFCQANNYGALETSPEGWPQF
FT                   RNAERCLECGVCYQICPATGQLTAETRRRVAWSAPIGRVMDSGVFRSTASSAATHPDGK
FT                   VGLGLIEHLFATDRIDGAVVLPTDHVFNKASQLARTPDQLRALDDKGLTTSQVRAAASS
FT                   LEVLGSVRKTGLRRVAFMGTPCQVETVRKMEILAVPPAERLYCTIGCFCDGDFLLGPAQ
FT                   QDRLEKLGFFRWNDVRHITLRDHLEFWLAEGKTRDIPMEDLDFMRRYACRLCTDYSAQF
FT                   ADLAVGGTGAPHGWSTVIARTPLGQAILSEARQTALEPFNGTAASQTRHNALYTVCRLA
FT                   ERKQHRALHSSRAAM"
FT   gene            519291..520787
FT                   /locus_tag="Dret_0423"
FT   CDS_pept        519291..520787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0423"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: sfu:Sfum_2401 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67720"
FT                   /db_xref="GOA:C8X095"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X095"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67720.1"
FT                   /translation="MAQHRLLETYGLDLLRAVLETTSDAIYVLDSEDLVVELNAPAAVQ
FT                   RGAPLETLRGRPWYDLFDNEVGQRRRQILAMARNQKEMLHYEDRIEPGLVFDVRIQPLF
FT                   DACASVVGRVICMRDISQARKQERERLRLGTAIEQAVEAVLIMDENLVIQYVNQSFEDL
FT                   TGYSQQQAKGLPLDVLYQDSEQRRWYAAISATLSQGEIWVGRTRNTGKDGRLFRVEKTV
FT                   APIRGQSGVILGYVSVWRDLGPVEQLERQLRTAQKMEAIGTLASGIAHDFNNILGPILL
FT                   NAQLLLERSPLCDEERDLLQEINDAAERARHLVRQILHLGRRREAEQPVPFRLSTIIKE
FT                   CCKLLRPTLPETLRIEHRLHTEQDTIVADPTQIHQAIMNLCTNAVHAMDRRPGVLRFVL
FT                   QTADPETIRTKPQLNVGRPYICLAIEDSGRGMSEEVLSQVFDPFFTTKNDGLGTGLGLP
FT                   VVQNIITQLGGTVTVQSAPGQGSVFALYLPLAPAEAFINE"
FT   gene            520956..522377
FT                   /locus_tag="Dret_0424"
FT   CDS_pept        520956..522377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0424"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; response regulator receiver; ATPase associated
FT                   with various cellular activities AAA_5; SMART: response
FT                   regulator receiver; AAA ATPase; KEGG: dal:Dalk_0736
FT                   putative two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67721"
FT                   /db_xref="GOA:C8X096"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X096"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV67721.1"
FT                   /translation="MAQILIVDDDRFLCRSLCLVLEGMGHTVMCASTLGEGRRLQQEYD
FT                   YAVVILDVWLPDGNGLEALQGFRTDRVPPEIIILTGAGDPDGAELAIRSGAWSYITKPP
FT                   TLNKFRLPVQRAVESFERRQKMPAFSLRREGIVGESSLLVQCLDVIAMSANTESPVLIA
FT                   GETGTGKELFARAIHVNSNRAEGPFVVVDCGALTENLVESTLFGHERGAFTGADKAQKG
FT                   LIQVAHGGTLFLDEVGELPLGIQKTFLRVLQEKRFRPVGGTREAQSDFRLVAATNRDLD
FT                   QLVTAGGFRQDLVYRLKSIQVDLPPLRRIKGDIEMLCCHYVAKYCNRMGISKKGYSAEF
FT                   LDALLQYEWPGNVRELVNCVAHCLSSAWQEPTLFPRHLPTAIRAHLAKESVRQETEALS
FT                   NPETGLDPADGLPPLSEYRQTEIARVEQTYLQALMAAHGADIATACEVAGLSRARLYAL
FT                   LKHYGISREGRSRNE"
FT   gene            complement(522702..523301)
FT                   /locus_tag="Dret_0425"
FT   CDS_pept        complement(522702..523301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0425"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dde:Dde_2002
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67722"
FT                   /db_xref="GOA:C8X097"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8X097"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV67722.1"
FT                   /translation="MTKKEAILKAAEELFGELGYTETTFKKIAARAGVALGLVAHHYEN
FT                   KEKLFIAAGLDVLSDLRQSLREEMAKANNGLEGVLHFARRYLEFSLEEGSHFMVLIRCS
FT                   PFSDMKDNVNKETIGAKFTELYTDLQNCIALGIEDGSIHPEVDPETTSYNVLANLSGSV
FT                   RTQLLHPYAPPKFYPWALRFIERSLANGNHAGNPPE"
FT   gene            523786..525432
FT                   /locus_tag="Dret_0426"
FT   CDS_pept        523786..525432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0426"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="KEGG: dde:Dde_2091 NH(3)-dependent NAD(+)
FT                   synthetase; TIGRFAM: NAD+ synthetase; PFAM: NAD synthase;
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67723"
FT                   /db_xref="GOA:C8X098"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C8X098"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ACV67723.1"
FT                   /translation="MRLALVQNNPIIGDIHGNMQALVRAGERAFAQGARLALAPELALT
FT                   GYPPRDLLLNEAVLQSAWRAVEELAARLPTGLAFVLGTPLRTDNAPELPEGGVYNGAVL
FT                   LEGGAVRQVFAKTLLPTYDVFDETRYFSPGPGPGVFELDGWRFGVTICEDAWNDKDFWK
FT                   KHRYPADPVEELATQGIDGLINLSASPFSLGKHRVREEMFASLAHKYAVPLYFANQVGG
FT                   NDDLVFPGRSLALDASGQVIGRGRGFVEDLVIVEQTPGSGPLPADDFERPAEAWAAVVL
FT                   GTRDYVRKSGFSKALLGLSGGVDSALCAAVAVEALGAENVLGVLMPSPYTSAASIEDAQ
FT                   ALADTLGIAQQVLPIEPVMNAFEETLRPAFTGYTPDVTEENIQSRIRGNLLMALSNKYG
FT                   SLLLTTGNKSELAVGYCTIYGDMAGALGVIADMPKTLVYEVCRWLNRERGEVVPQRILD
FT                   KAPSAELRPDQKDSDSLPDYATLDGLLGLLVDRHYSVEQCVEAGYDAGMAREVQRLVRR
FT                   AEFKRRQAPPGIKITDRAFGTGWRMPLAARW"
FT   gene            complement(525856..527238)
FT                   /locus_tag="Dret_0427"
FT   CDS_pept        complement(525856..527238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0427"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pca:Pcar_3111 trehalose phosphorylase/synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67724"
FT                   /db_xref="GOA:C8X099"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C8X099"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV67724.1"
FT                   /translation="MSASTVNNRTQLQAFTPERIYDPAEFAPYIGKDKVEGLKKLAAPL
FT                   EGAGWANVNSTLIGGGVAEILRSAIPLGLGLGLDARWHVIQGNDAFFQVTKKFHNMLQG
FT                   MDLDISLDEIFDAYLGTIDQNAQNTFIASDLVVIHDPQPAAMVMNGFIFGNVLWRCHID
FT                   TSEPNRTVWRFLLPYINHCAGAIFTTPQFVGPGLQIPLYQITPCINPLTDKNHQFSEEE
FT                   ALDVLRPLLNEHDVDPERPIVAAISRYDIHKNQETVLKAFQTYREQSAPDPAPYLIFLG
FT                   NTATDDPEGDAMLAHLQEVAGDDPDVRFWVNVPDNDRVVGALNRIAKTFVHVSTREGFG
FT                   LVVSEAMWQGTPVIGSRTGGIVNQIRHGETGFLVDPMDTATISKHLGTLLDDPDQAQQM
FT                   GERAREHVREHFLLPELVRRYLILISYYTGRCNEPPHFRLNDLSYSEVICIMRPRHPAL
FT                   SR"
FT   gene            528086..528316
FT                   /locus_tag="Dret_0428"
FT   CDS_pept        528086..528316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67725"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67725.1"
FT                   /translation="MLRWGIGIGPSGEEKLAHRLRSVPTRREGPRRRLVFAGVEEVEES
FT                   APVGTARILARSDSFLAVVPNTDTRMEKWVC"
FT   gene            528460..528759
FT                   /locus_tag="Dret_0429"
FT   CDS_pept        528460..528759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0429"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   dvl:Dvul_1840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67726"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A1"
FT                   /inference="protein motif:PFAM:PF01910"
FT                   /protein_id="ACV67726.1"
FT                   /translation="MSVLAELSLFPMDKGESVGRYVAAALEIIRSSGVPYELHPMGTCL
FT                   EGEWDEVMAVVKACHDRLRQDSDRVYMTVKIDSRAGDSGRLRRKVETVRSYLTG"
FT   gene            complement(528748..529905)
FT                   /locus_tag="Dret_0430"
FT   CDS_pept        complement(528748..529905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0430"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dat:HRM2_32890 putative permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67727"
FT                   /db_xref="GOA:C8X0A2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV67727.1"
FT                   /translation="MSFRRSPMYLFLLVLTVSVWAGFQGWRTLLNNFAVEVAHLGGHHM
FT                   GVIQSVREVPGFLALLVIYILLIVKEHRLAAVSVLILGLGVVLTGFFPSFWGVLLATLL
FT                   MSFGFHYFETVNQSLTLQYFSVGDAPLVFGRLRAIGAATSIGVGLSIFALANWLPYKLL
FT                   FALLGCISIAGAMWCLFQDPTDTNMPSQNKHMVLRRRYWLFYTLTLLAGARRQIFIAFA
FT                   VFLLVEKFGLSVQEITLLFVANQALNYFVSPLVGRAINHFGERSVLSVEYASLIVVFLV
FT                   YALSDSQWLVLAMYIVDHVVFNCAMAIRTFFQKIGDPGDIAPSMAVGFTINHIAAVLIP
FT                   AAAGLIWLVDPAWVFLGGVGLSLCSLLLVQAIPWQLKRSRTASSG"
FT   sig_peptide     complement(529840..529905)
FT                   /locus_tag="Dret_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.986 at
FT                   residue 22"
FT   gene            530205..530759
FT                   /locus_tag="Dret_0431"
FT   CDS_pept        530205..530759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67728"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A3"
FT                   /inference="similar to AA sequence:KEGG:Dvul_0805"
FT                   /protein_id="ACV67728.1"
FT                   /translation="MLNPNECILFSGGATGTEAAFGALAEQYGIQEVNYSFEGHRIERQ
FT                   RGIRMLTTEELELKDFSLTYVSKIMRRSYSRGPLFRRVLQSIGWQVSSGQEIFIVGIIQ
FT                   PDDTVKGGTGWGAEFAKICNKPTYVFDQEKDAWFQWDKDQWNQIAEPLITKRHFTGTGT
FT                   RFLQENGRQAIAALYERSIAP"
FT   sig_peptide     530205..530282
FT                   /locus_tag="Dret_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.400 at
FT                   residue 26"
FT   gene            complement(530903..535249)
FT                   /locus_tag="Dret_0432"
FT   CDS_pept        complement(530903..535249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0432"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   dma:DMR_35520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67729"
FT                   /db_xref="GOA:C8X0A4"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A4"
FT                   /inference="protein motif:PFAM:PF04357"
FT                   /protein_id="ACV67729.1"
FT                   /translation="MLQRLFRVFIFGLVAGLLLLGGIWAGLQTEYGRSTLLHAVEYITA
FT                   LTSPIELELEGLGSGFPGSVRLERLELADANGTWMAAEAIGLDWDWSALWHGRLHGERL
FT                   FAREIVWYRPPQTPPDPEQDTPPWWLLSRLSLESLSIPKLTVAGDHPAALAVKGQFDGR
FT                   PEALRANLAAKALQGKDTLRLNGRFTPEQAAYELTLETTAEAQGPLARLTRLPGPWHGR
FT                   LQANGTRRRGSGTARFKGEHLGQATVDYKTIPEASGVRTTLQGRMAPAASVVPSTLAPW
FT                   LAPGVDLRLTMVVPELVPSTLQLESFELRSPEFNLDASGSWQRKQRQWQSQVALRLGLG
FT                   PVAPPQGLMLPDTLHISGDLSGSFAGTPTSLRCTLDTDPTTLAYNQPGDLRKLTLHNST
FT                   VSLTAESTTLTDWRVRVSAAGTLEGDSKSGPMTPLSCLGELHTDDRLLWTIPTASLRLD
FT                   DTEALTLEGRFNTKETTAEGRLSLTPEVLRRLPLPSGVAPFLPQGMVTTSFSGRGFPLD
FT                   LQGQLKGDLSWPRLPARIRRLGGTHDVALLADWGWHSPQQLRLDNLDISTPSGRVWGGG
FT                   TLNTASQRFAARLNLSLKSTSWPAGNLAVSTAPLSATLDATGAVPRPVFDFRLDCPRMR
FT                   VGNLPALEAFHAETRLVADARGIAGPLALQARLGQDRAELRSAVAWRDRVLSLRNLNGQ
FT                   WGDSNITGRVRWPSANGLPSASLSLDAVLGELAQYATLPVKGRLQADLDIAERPENQKW
FT                   ARLDFTCQDAEWGPQWTAQRLEGQLALDAPEPPLRGSGSLNLTEVKRGSWRINSGRLAA
FT                   QGSLADLAFTSSLKGHSGVAPFALSSSGLLTKDDTATRVRLDSFNGTATPRLPFRLAET
FT                   ARLSKEPGKWTLTMPHLNLGPGKLTLEAKTERNRVEARLSGQKLPLAGLNPFVPWSLAG
FT                   SITTRADLTGTLQSPRLQGTLAIKDSKIRQGRWREVPTLEAEASWDWRPGTFQAEIGAR
FT                   QASNGTLNASVSLPLDLALAPFTIAPDPAGACRGSLSSSLSLNFLPRVFNADGVLLQGQ
FT                   LATTATLDGTWERPDIQAEAAMDQGHLEHVYHGIVLEEIAGRCELDTSGISELRLTATD
FT                   GAKGNLTLEGTIPIQPEPRADLRARFEQMALVRKDQLEAIASGTVDLSGPFSSPRLTGS
FT                   ATLERTEIRIPEQLPPSVTGVEIVEVNAPQEETSAGSSRSRPPAAIDLDLELDIPRRFF
FT                   VRGRGLEAEFKGGCQVTGTTRKPRLQGELEAVWGRFTFFSKTLTIETGQLFFEQRSPPA
FT                   PRINVAAVNRQDDFLARIWLTGKIDDPGIRMESEPALPQEEILGRVLFGRSITTLTPLQ
FT                   ALQLAQALRALSTGQTGGSLTTRFFEKTRRLLELDEFGVTGGDGGPSLGMGKYIQDNVY
FT                   IRAQKGLESEEDKIEVEVELSPHTSVESQVGGQGRSGVSLNWKLDY"
FT   sig_peptide     complement(535172..535249)
FT                   /locus_tag="Dret_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.974 at
FT                   residue 26"
FT   gene            complement(535472..537259)
FT                   /locus_tag="Dret_0433"
FT   CDS_pept        complement(535472..537259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0433"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); KEGG: dma:DMR_35510
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67730"
FT                   /db_xref="GOA:C8X0A5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A5"
FT                   /inference="protein motif:PFAM:PF01103"
FT                   /protein_id="ACV67730.1"
FT                   /translation="MQRKFSPGPLGLLILLFCLSFWPQTAGAEQLRYTISWHGLEDTEL
FT                   EQTLRAVSNTAQYIETPPASLGLLRQRIKEDIPRLQQVLQARGHFKAQISHQIDLQASP
FT                   IEIRFRVIPGPQFALEKIVFRSERPLPKQVGFPTPEQLRLSPGSGITTEALVRGRRLAE
FT                   SYFRDRGWPFAEVQKPEATADHATATVSVVYPVSPGPRLRFGPLRLEGLNRVNPVHVRR
FT                   QVAWENGAWYNATQVDATERALLQSGLFTTAAIRRGEAGEGDMALPLSLQLRERKPRTV
FT                   KAGVEYTSDFAFGAQLSWEHRNLFGRGERLQTQAKYNAAQKTLESSLRFPSFLDPAQEL
FT                   VLSSDLTEEDTDAYTSRHLRNSVRLERQLTTSLRGGLGIGHEYLEQEEDDATDIFNLIS
FT                   VPLFLDWDQRNDILNPTHGYRLQIHATPYQDIADETGNFFKYKATGSLYIPLMAGPRLV
FT                   WAGQAGFGQILGRTGAVPTSKRFFPGGGGSIRGFRYQSAGPLASDDTPLGGRSVLELSS
FT                   EFRIALSDKWGGTVFVDTGRAYSGIEPETREELFWGAGIGLRYYSGIGPLRLDVATPLN
FT                   PREGTDDPLQFYFSIGQAF"
FT   sig_peptide     complement(537173..537259)
FT                   /locus_tag="Dret_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.809 at
FT                   residue 29"
FT   gene            537388..537819
FT                   /locus_tag="Dret_0434"
FT   CDS_pept        537388..537819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0434"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   dvm:DvMF_1013 peptidylprolyl isomerase FKBP- type"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67731"
FT                   /db_xref="GOA:C8X0A6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A6"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACV67731.1"
FT                   /translation="MRTAQQGDKVRVHYKGTLNDGTVFDDSSEREPLEFTLGENQIIPG
FT                   FESAVTGMEIGENKAVAVDPDEAYGQTRDELFIEVPKEEITAQLEPELGMVLEVTLNDG
FT                   NKAHVTVSEIGEEKVVLDANHPLAGKTLNFDLTLQEIVE"
FT   gene            537831..538490
FT                   /locus_tag="Dret_0435"
FT   CDS_pept        537831..538490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0435"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: dma:DMR_43230 haloacid dehalogenase-like
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67732"
FT                   /db_xref="GOA:C8X0A7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A7"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACV67732.1"
FT                   /translation="MSSIPCIQGIIFAFGGTLAQIPLDTTQMHKKAAAIAAAFDIALPQ
FT                   APTIWAAVDRARDLLVQTDRQTALEFHTRCRFALLETEMAVAAQTRLLAPVSSLLQDLA
FT                   DQGLTVGVVTLASLPFVEAVVPQDAFRVAQWLTREAVTPPKPDPAPYLQFLDAHHLDPA
FT                   RTLAVGTRSLDFQGPHQLGCRIAQAGSPTAAGADFIVPAITDLPALVVPKGSCRDS"
FT   gene            complement(538548..538913)
FT                   /locus_tag="Dret_0436"
FT   CDS_pept        complement(538548..538913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_3059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67733"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A8"
FT                   /inference="similar to AA sequence:KEGG:DvMF_3059"
FT                   /protein_id="ACV67733.1"
FT                   /translation="MTEPHSLIGHLERTAQTIRDLEAKAQQALNSGDPDEYKSLLERKC
FT                   ETLEDLPQRLAPALNDLPQDQQSSVESQIAGFAQRAAQALELDSVFFMYALLYPETYQP
FT                   GAPNDLEAFILTLRSSL"
FT   gene            complement(538916..540895)
FT                   /locus_tag="Dret_0437"
FT   CDS_pept        complement(538916..540895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0437"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: ppd:Ppro_2997 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: diguanylate cyclase; PAS sensor protein; PFAM:
FT                   GGDEF domain containing protein; CHASE4 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; histidine
FT                   kinase HAMP region domain protein; SMART: GGDEF domain
FT                   containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67734"
FT                   /db_xref="GOA:C8X0A9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0A9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV67734.1"
FT                   /translation="MTLKARLLSTLFISFGLMAILLTLISHWVILSDFDQLEVKTMRAH
FT                   MERLDRAMDKSLQKIDQTAQAWSQWRAAANFVTDRNDKQVFASLLNKQTMQTLHLNLLM
FT                   LRDASGDILFERYYDYTERKWIEPISGTRGHLFHLAREGSPEVKKGIYALPKGPLLVSA
FT                   RTISSAGEPVGTLVMGRIFSQQEAKSMASLTNLDIAAYDLKHPPLPRDVSSALYHLSLK
FT                   SPRHIKATDNGQLHGYMLVKDLFDFPAILFKVSLERSIHAQGIRAVAMLMAFFVAVFAL
FT                   FAFANRFVFLRYLIRPFRLLRADLDKIEDLSDLSRRVSIPQEPEFQAASRAINRTLASL
FT                   EANRKELTEAHERYSAVVNQSSEAIYMYDARTKKVLFGNPAMANLLGYRSEELLQCTVY
FT                   DLVEASKTDIDATIQNILFGTPFVGERSYRTKSGHLVPMEITASLVHYQGRRVVSVVGR
FT                   DISERKKSEERIRYLAYHDQLTGLPNRTLFLDRLEQSLKEARRNRDKLGLFFLDLNDFK
FT                   HINDCHGHKVGDRLLLQVAERLQSSLREMDTVARLGGDEFVVIVKGGASRHNCRKVARK
FT                   LIQSIDTPFLVEEIDQEVRIGLSIGISIFLDDAATLEELIQHADTAMYAAKRNPSSSWE
FT                   FFAASSAPGTCQTSNAPVESGENQ"
FT   sig_peptide     complement(540836..540895)
FT                   /locus_tag="Dret_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.687 at
FT                   residue 20"
FT   gene            541070..541603
FT                   /locus_tag="Dret_0438"
FT   CDS_pept        541070..541603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0438"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: ank:AnaeK_1739
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67735"
FT                   /db_xref="GOA:C8X0B0"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B0"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ACV67735.1"
FT                   /translation="MAQHPEKPIRILITGGTIDKDYNKLAGQLVLGKTHLQDILEQARC
FT                   RVPVRVEQLMLVDSLEMTEENRQTVLQRCVDAPEERIIITHGTDTMVETARLLGGNALE
FT                   KTIALVGAMIPYTFGRSDALFNLGCAFSTVQVMGHGVYITMNGRIFYWDNVRKNTSIGD
FT                   FELLEDPGTHDKER"
FT   gene            541603..542763
FT                   /locus_tag="Dret_0439"
FT   CDS_pept        541603..542763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0439"
FT                   /product="Isocitrate dehydrogenase (NADP(+))"
FT                   /EC_number="1.1.1.42"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: dvu:DVU0477 isocitrate dehydrogenase, NADP-
FT                   dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67736"
FT                   /db_xref="GOA:C8X0B1"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B1"
FT                   /inference="protein motif:PRIAM:1.1.1.42"
FT                   /protein_id="ACV67736.1"
FT                   /translation="MDERQVYWIEGDGIGAEVWRAARPVLDGAIRAAYGESRRLVWEEL
FT                   LAGEKAYAETGNYLPEATLAALQGADLAMKGPLATPVGTGFRSLNVTLRQTLELYACIR
FT                   PVQYFQGIESPLKAPEKVDMVVFRENTEDVYAGIEWPAGSKEARKLAAFLREELGARID
FT                   DLAGIGIKPMTEKGSKRLVRKALQFALDQRRESVTLVHKGNIMKYTEGAFRGWGYELAE
FT                   EEFGTQTVTESQDAGGKLVVKDRIADAMFQEVLISPEKYDVIATTNLNGDYLSDALAAQ
FT                   VGGLGLAPGVNMSDQLGFFEPTHGTAPTIAGQDKANPGSLILSGALLLDHIGWHEAAGL
FT                   VRAGVEAALATKEVTVDLASQISGAKTVGCQGFGERILQGVEDAAQ"
FT   gene            complement(542933..544183)
FT                   /locus_tag="Dret_0440"
FT   CDS_pept        complement(542933..544183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0440"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; Dinitrogenase iron-
FT                   molybdenum cofactor biosynthesis protein; KEGG:
FT                   dde:Dde_3202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67737"
FT                   /db_xref="GOA:C8X0B2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B2"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ACV67737.1"
FT                   /translation="MAEHGCSSCSSGGSGCQGGKNEQEDQKLQNCLSRIKNKFVVLSGK
FT                   GGVGKSTVAVNLAASLAMAGQKVGLLDVDVHGPSVPRLLSLGQSKPHLDNQCIEPIQWD
FT                   KNLWVMSLGFMLPNANEAVIWRGPVKMGLIKQFLEDVAWGDLDYLIVDCPPGTGDEPLS
FT                   TLQLLGQDAEAVIVTTPQGVAVDDVRRSVTFCQQLGNPVFGIVENMSGFVCPSCKETVD
FT                   IFTSGGGEELASEMHARFLGRIPLDPEIVRAGDEGYVFVKTHHESPAAQAVGSIVKPML
FT                   AKQELLQEKPAGQTAPAPEADGEMLIAVPVAQGQLCMHFGHCEQFALVRVDTANKTVLG
FT                   TEMHTPPPHEPGVLPKWLADQQANLVIAGGMGSRAQSLFTQHGVKVITGAQPGAAEEVV
FT                   GSYLAGTLQTGQNICDH"
FT   gene            complement(544199..545056)
FT                   /locus_tag="Dret_0441"
FT   CDS_pept        complement(544199..545056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0441"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dde:Dde_3201 iron-sulfur cluster- binding/ATPase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67738"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B3"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACV67738.1"
FT                   /translation="MKELVIISGKGGTGKTSIVAGLAAVGPKMVLADCDVDAADLHLIL
FT                   DPAVEQTHDFYSGELPAIDPQKCTECGVCASSCRFGAISEDIEIRLEQCEGCALCSYVC
FT                   PETAISMHPRLCGQWFVSGTRFGPLVHASLGIGEENSGKLVTTVRQNAHTVAEERGYEW
FT                   VVADGSPGIGCPVIASLTNASAVLLVAEPTVSAIHDLKRVSELTRHFQLPTMAVINKTD
FT                   VNQELVQEIREFCRAHRIPVVGALPYDPRVTKAQIQGQSVSEYDPQGLGELMRGIWNQI
FT                   ETHI"
FT   gene            complement(545053..545925)
FT                   /locus_tag="Dret_0442"
FT   CDS_pept        complement(545053..545925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0442"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dvl:Dvul_1127 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67739"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B4"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACV67739.1"
FT                   /translation="MRIAIASGKGGTGKTTVTTNLAAYVSQNTHGVSLVDCDVEEPNAQ
FT                   FFLDAHWEYEEAQHVPVPAIDQETCLGSECRQCVEACRFKALIWMVDEVMVFPELCHSC
FT                   GLCETICPVGAVGQSHRTIGDVRQGSGHGVTLTGGLMRVGEAMAPPLIQRVKAKAPETA
FT                   EVTIYDCPPGTSCPVIEALDGADYTVLVTEPTPFGLYDLQLAVGLLRKLGKPFGVVLNR
FT                   DGMGDDRVLDYLEAEGIDLLARLPHSTEAAAAYSRGELLVEALPEMQQAYADLWSGIVE
FT                   HMAAEKETV"
FT   gene            546109..546612
FT                   /locus_tag="Dret_0443"
FT   CDS_pept        546109..546612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67740"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67740.1"
FT                   /translation="MLRILGAFLGNTSAFKGELRSRRYSVTAPGIAARTAGSLSQDLQL
FT                   VMGPPHTGQWESTQGVPLLRGKRSPQHGQKHAPPASGTDREKLSWWPWLAIVWGHERGC
FT                   AIGHPSCSKHPRLHPAVCGGKVGDCAGHTEMNAPLLIKGASFSRGRVSVGTYFVSPWSW
FT                   ARRS"
FT   gene            complement(546573..546890)
FT                   /locus_tag="Dret_0444"
FT   CDS_pept        complement(546573..546890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0444"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: dal:Dalk_2261 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67741"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B6"
FT                   /inference="similar to AA sequence:KEGG:Dalk_2261"
FT                   /protein_id="ACV67741.1"
FT                   /translation="MPGLNGTGPFGEGPMTGRGAGRCSGAVQNQGFGFGRGLGRGFGRG
FT                   FGRGFGRGFCRWGVNAAPGVPAQPMTAQDEEQALNTQLSWLQRQVQALQDRLAQLQGDT
FT                   K"
FT   gene            complement(546994..547353)
FT                   /locus_tag="Dret_0445"
FT   CDS_pept        complement(546994..547353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0445"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dde:Dde_3198 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67742"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B7"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACV67742.1"
FT                   /translation="MKIAITAQGQDLNAPLDPRFGRTGGFIIYNTDSGEFSYMDNQQNL
FT                   AATQGAGIQTAQNVADTGAQAVLTGHVGPKAYTALQRGGIDIYLLQSGTVQEAITAFEN
FT                   GELTAAAGADKPGHW"
FT   gene            complement(547374..547751)
FT                   /locus_tag="Dret_0446"
FT   CDS_pept        complement(547374..547751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67743"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B8"
FT                   /inference="similar to AA sequence:KEGG:Dde_3197"
FT                   /protein_id="ACV67743.1"
FT                   /translation="MKICLAIYQSRLAALFDNATGLQVYTCESDNTICPAGDISLPFGD
FT                   PTLRVSALSSCGANILLCGAISGCTTRMIQEHGINVFGWLRGDISTVLEAWREDRLETL
FT                   LMPGCRGFRCCRRFRGPHTTQ"
FT   gene            complement(547927..549243)
FT                   /locus_tag="Dret_0447"
FT   CDS_pept        complement(547927..549243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0447"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="KEGG: dde:Dde_3196 Fis family transcriptional
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: sigma-54
FT                   factor interaction domain-containing protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67744"
FT                   /db_xref="GOA:C8X0B9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0B9"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67744.1"
FT                   /translation="MAFPDNLPCEAILDSIADGVFTVDLEWTITSFNRAATQITGIARQ
FT                   DAVGQKCWEVLRSSLCDGSCALETCLRDATSISNKSIFIIRPDGSKVPISISAAPLHNH
FT                   QGECIGGVETFRDLSAIQVMRQEMEQRYTFEDIVGKSEALSKIFRILPQVAQSPSSVLL
FT                   TGESGTGKELFARALHNLSPRRQGPLVVVNCGALPEHLLESELFGYKAGAFTDAKKDKP
FT                   GRFQLADGGTLFLDEIGDLPLALQVKLLRVLQEKQVEPLGAVAPVPTDVRIIAATNRDL
FT                   EHLVREGRFREDLFYRLNVAQLRLPPLRERQEDIPLLANHFIRRFNLLQGKEVQGISED
FT                   ALATLIRHDFPGNIRELENILEYSFILCSSGFIQLEHLPEKFHPQEASSPNTNAPMTME
FT                   EVKVQAARQALARNQGKKMAACRELDISKDTLRRLLRQG"
FT   gene            complement(549478..550140)
FT                   /locus_tag="Dret_0448"
FT   CDS_pept        complement(549478..550140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0448"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: dvm:DvMF_3165
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67745"
FT                   /db_xref="GOA:C8X0C0"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C0"
FT                   /inference="protein motif:TFAM:TIGR00073"
FT                   /protein_id="ACV67745.1"
FT                   /translation="MQIPVVRDILEQNDQVAEELKSLFAEKNILVLNLMSSPGAGKTTL
FT                   LEHTLHALKEEFGIGVIEGDLQTSNDAERVAATGAQTIQINTDGGCHLSSNMVKKAVEQ
FT                   LDLDRLDILFIENVGNLVCPAEFNLGEDLKVTLLSVTEGDDKPEKYPYMFALSKVVLLN
FT                   KVDLLPYVDFSLERAEHFARAVNKETQVFSLSCREGDGLDEWYEWLRGAAKDKRTHS"
FT   gene            complement(550141..550494)
FT                   /locus_tag="Dret_0449"
FT   CDS_pept        complement(550141..550494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0449"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /note="PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   dde:Dde_1308 hydrogenase nickel insertion protein HypA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67746"
FT                   /db_xref="GOA:C8X0C1"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C1"
FT                   /inference="protein motif:PFAM:PF01155"
FT                   /protein_id="ACV67746.1"
FT                   /translation="MHEMSIAQSLVEILQDEMTKHGVSRLKRVKVKHGRLAAVVPEALD
FT                   MAFQALTVETDMAGATLELEEVPVQVRCSACGAEFAPEEASTLYLPCPQCEEPFGHEIL
FT                   SGKELYIDELEAE"
FT   gene            550808..550884
FT                   /locus_tag="Dret_R0004"
FT                   /note="tRNA-Val2"
FT   tRNA            550808..550884
FT                   /locus_tag="Dret_R0004"
FT                   /product="tRNA-Val"
FT   gene            551048..551506
FT                   /locus_tag="Dret_0450"
FT   CDS_pept        551048..551506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0450"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dvm:DvMF_0834 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67747"
FT                   /db_xref="GOA:C8X0C2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C2"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACV67747.1"
FT                   /translation="MQIVLFEPEIPPNTGNIGRLCAATTTPLHLIEPLGFRLEDRYLKR
FT                   AGLDYWPHLDLTVWPDWPSFCDSLPSGARLVASSARQGAAYHTVAFRTEDYIVLGPESS
FT                   GLPSAICEQAAELVRIPIWGQVRSLNLANATSVLLYEALRQTGGLEGR"
FT   gene            complement(551605..552903)
FT                   /locus_tag="Dret_0451"
FT   CDS_pept        complement(551605..552903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0451"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: dvm:DvMF_1810 phosphopyruvate hydratase;
FT                   TIGRFAM: enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67748"
FT                   /db_xref="GOA:C8X0C3"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C3"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACV67748.1"
FT                   /translation="MRSSTITSVWAREILDSRGNPTVEVEVGLESGDTGRAAVPSGAST
FT                   GAREALELRDKDAKRYNGKGVTKAVTNVIEEIGDEIAGLDAVRQNEVDERLLELDDTDN
FT                   KSRLGANAMLGVSLAVARAAAAFVGLPLYRYLGGVNAKILPAPMMNILNGGAHASNNLD
FT                   IQEFMIMPLGADSFSEALRMGAETFQALKGLLAQDGLVTAVGDEGGFAPNLKSNKQAFE
FT                   YIMRAIEKAGYVPGKQMALAIDAAASEFFKDGKYVLAGEGKTLSADELVKLYAEYCNEF
FT                   PIVSIEDGLAEGDWDGWQRLTHELGHAVQLVGDDVFVTNPSLLADGIAEGVANSILIKL
FT                   NQIGTLTETLDTIEMAREASYTTVISHRSGETEDHFIADLAVATNAGQIKTGSLSRSDR
FT                   LAKYNQLLRIEEELDEQALYLGPALAMTWFEAD"
FT   gene            complement(553040..553867)
FT                   /locus_tag="Dret_0452"
FT   CDS_pept        complement(553040..553867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0452"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: dvm:DvMF_1811
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67749"
FT                   /db_xref="GOA:C8X0C4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C4"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACV67749.1"
FT                   /translation="MSTMYLLLFDVGNTNTKIGLSQDGRLLGSYSFPSSTADTADTWGF
FT                   RVLEICRYWELAPEKLTAWIISSVVPPLNDALKVAGDRFCACPVHFVPKDIGVPLENHY
FT                   ARPQEVGADRLVTALAARRRFATPAIIVVDFGTATTFDCIQDKAYLGGLICPGVLSSAK
FT                   GLALQTAKLPQISLELDSDEVQIGMSTSTSLNHGFLFGFASMIEGLCARIQKHLFGEVT
FT                   VVATGGFGRRLQPVCPCLEHVEPDLLLQGLQYAADQLSCDILGGQPSSSQRRS"
FT   gene            554263..555336
FT                   /locus_tag="Dret_0453"
FT   CDS_pept        554263..555336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_1763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67750"
FT                   /db_xref="GOA:C8X0C5"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C5"
FT                   /inference="similar to AA sequence:KEGG:Glov_1763"
FT                   /protein_id="ACV67750.1"
FT                   /translation="MDPSSLVPVADAIPVPWGWHYVLLLVTFVLHLLFMNTMLGAGIIA
FT                   FVDELRGGAQGGEGTVAEALSHKLTYIIAFTVNLGVAPLLFLQVLYGQFIYVSSVLIAV
FT                   YWIAVVFLVILAYYLAYLYNFRYQRLAGARKWVIGSAVFLLLAVGFVFTNNMTLMLRPE
FT                   AWERYFASPGGMLLNLSDPTLIPRYLHFMVASVAVGGLFVALWAAKTAQPSTEQREQRI
FT                   NRGMQWFTYATLAQMVIGIWFLITLKREVMLQFMGGDSLATALLVLGIGGAVLLLLLGF
FT                   QRRPVPAAVALVATISIMAVMRDFVRAGYLEPYFTLSDLRLDPEYSPLVLFLLVFVAGM
FT                   AMVVYLLRLAAKTGKEV"
FT   gene            555340..558033
FT                   /locus_tag="Dret_0454"
FT   CDS_pept        555340..558033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0454"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: dma:DMR_35740 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67751"
FT                   /db_xref="GOA:C8X0C6"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C6"
FT                   /inference="similar to AA sequence:KEGG:DMR_35740"
FT                   /protein_id="ACV67751.1"
FT                   /translation="MNYPVWELFAAGGGLPIALMAIVHVFVAHFAVGGGLFLVLTERKA
FT                   YRENSKSILEYTRKHAKFFLLLTMVFGGLTGVGIWFTISVLSPGATSVLIHNFLYGWAT
FT                   EWVFFVVEIVALFVYFYTFGKMDQQRHLTVGWIYFGAAWASLFLINGIIAFMLTPGEWL
FT                   QTGNFWHGFFNPTFWSSLVFRTFMAIVLAGVFGFVTATFMKDQQARAQLIRYNARWLLV
FT                   PMVFLVASGWWYLQSVPEPARELILDRSPELVPYFKAFLWLSGAVFLGGLLLTARGGRR
FT                   WQRPLAFVLMALALGYMGSFEYIREAGRHPYLIYDYMYSNGILTSQEERINAQGFLASA
FT                   KWTSFDTVTPDNRQAAGREIFRLQCMNCHSVDGPQNDILPLTAKYDLFAMDAQLDGLGK
FT                   LNDYMPRFMGTRQERKALAAYIVSDLHGKKPAEPHEAGAIAQRQHAVPPFDPDSDDYVL
FT                   LAWNNLGMHCISDSSDWWVLLPPANDLFAQLIRRGPIPEVVTKGVEIEYAVEEGFENPA
FT                   GKVPFWDNVEALFGTELEDNVGLSGNGMRGKMHLSKELSAFEASLVPVVPYPEEGGYMP
FT                   YPLFHVTAKDAQSGEVLARTSMVAPTSTEMGCKNCHGGSWRVDGKAGFTDATSMDILAT
FT                   HDKNNRTDLLAAARNGEPKLCQSCHPDPVLGTEENPDYPNIMNFPAAIHGWHANYLTDR
FT                   GAEVCSSCHPSSAAGPTGCLRGVHAGVGLDCTSCHGSLEDHALSLLKKELRAGKKGAAR
FT                   MMTHLEPNTVDKVQHIRPRTPWINEPDCLNCHVDYGKPESKDVSGFNKWTSGADELFRL
FT                   RHEETGTIMCEACHGSTHANYPATNMYGKNRDNIQPQQYQGNSLPISSNKNCAVCHTMD
FT                   MGFDMHHPNIYRDFRNTQLLEDGDGS"
FT   gene            complement(558216..559391)
FT                   /locus_tag="Dret_0455"
FT   CDS_pept        complement(558216..559391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0455"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: dma:DMR_18120 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67752"
FT                   /db_xref="GOA:C8X0C7"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C7"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACV67752.1"
FT                   /translation="MLQACRRPFMLLYIHFPFCRSKCAYCAFASGPGSREDIAAWTRLV
FT                   CAEARLWGRRLAKPELQTVYLGGGTPSLLPPESLHRLVHTLQSAFVWPQGIEWTLEANP
FT                   DSFQDPAYAKSLYDLGVNRISFGVQSMADRELDLLGRAHTAAQAVRAVTLAREAGVSNI
FT                   SLDLLWGLPGHTLTQWEHTLEQALALKPRHLSCYGLTPEPDTPLAGDLEARAIPPLPDE
FT                   DMLTAMYDHTVDALGQFGLEQYEIANFAQPGWESQHNSGYWQGWPYLGLGPAAVSTLEG
FT                   SRWTNPTHLAAYARAVTQQTLGQSAHQLTCRERCLETLMLQLRTRAGLDCSTFAREFGT
FT                   DPLTACPELCAQLQNQRLADIAAGTLRLTSAGMLMANSITERLSSVLLPSH"
FT   gene            complement(559401..559958)
FT                   /locus_tag="Dret_0456"
FT   CDS_pept        complement(559401..559958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0456"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   dvm:DvMF_2375 protein of unknown function DUF208"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67753"
FT                   /db_xref="GOA:C8X0C8"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C8"
FT                   /inference="protein motif:PFAM:PF02677"
FT                   /protein_id="ACV67753.1"
FT                   /translation="MPLPRRLLLHICCGPCAIVPLRRLTEQGIEVTGLFSNPNIHPLQE
FT                   YLRRRDGALEVAERFSVKLICKDADYDPAEFLRRVVFREAHRCFLCYQTRLERTASIAR
FT                   KGSFDAFSSTLLYSKRQNHAALAELGHQIAGNGACRFWYEDFRTGWREGIQTSQEWGIY
FT                   RQSYCGCLYSEFERFQNELQSG"
FT   gene            complement(559945..561414)
FT                   /locus_tag="Dret_0457"
FT   CDS_pept        complement(559945..561414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0457"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: dma:DMR_17030 ribonuclease E and G family
FT                   protein; TIGRFAM: ribonuclease, Rne/Rng family; PFAM:
FT                   RNA-binding protein AU-1/Ribonuclease E/G; RNA binding S1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67754"
FT                   /db_xref="GOA:C8X0C9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0C9"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACV67754.1"
FT                   /translation="MAQKRKRKMFISVLPGEQIEVVIAQDAKVQEYYVEMLNQAKTKGN
FT                   IYKGTINNIDPALQAAFIQYGAKKNGFLQVDEVHQEYYQNDIKPKKGYKYPPLHKVLKP
FT                   GQEVLVQVVKEPTGSKGAFLTTYLSLPGRYFVLTPGREQTGISRKIDDEKERERLRKII
FT                   EDFKLDPGIGLILRTVSSNQTKTNLSRDLQFLKRLWKEVRKRGVSEKAPSLIYEEKDLA
FT                   FRAVRDYLTDDVSEVWVDHQETAKQIKEYASLAFPRRNRLVKQHTDADRSLFERFNLID
FT                   QLQSVYSRQVTLPSGGSLVFDQTEALMAIDINSGKIGGESNFAEMALKTNLEAAEEIPH
FT                   QLRLRDIGGQVVIDFIEMKDNKHSRDVEKTLRAAVKDDKARTSVGRISRFGLLEMVRQR
FT                   MGSSALSTTMEPCPCCQGAGIRRNLEWQAMQALRDIRYQLNKKNGASTLDFPIGKELAL
FT                   YLLNTKRDRLTELEQEFQTTITISATDNALT"
FT   gene            complement(561429..562427)
FT                   /locus_tag="Dret_0458"
FT   CDS_pept        complement(561429..562427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0458"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: dde:Dde_0538
FT                   radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67755"
FT                   /db_xref="GOA:C8X0D0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV67755.1"
FT                   /translation="MPKTSQAQPAPPSYRYLFGPVASSRLGRSLGLDLLGGPICSFDCV
FT                   YCEVGRTKLHTCQRRAHVPASRLVQELRQWFKEGHQPPDYITLGGQGEPTLNSELGTLV
FT                   HQVRQQWPTIPIAVLTNSSLLHREDVQEELAEVDTVLPSLDTLVDTEFHHLNRPCTGVD
FT                   LSRISQGLLEFRRRYSGKIFLEILLVHGINDTAENKNRLREFIAEFSPQRVDVVTMTRP
FT                   GAFSEARPIPNSILRSWREALGACQDPVARSSAPETHTTSPVHLDGQAIAATITNSLAR
FT                   RPQTVDQLAFALNFARSDVAATLDALQNQGTVVVLTGTDVPYYGLASSERN"
FT   gene            562457..563290
FT                   /locus_tag="Dret_0459"
FT   CDS_pept        562457..563290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0459"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="PFAM: tRNA methyltransferase complex GCD14 subunit;
FT                   KEGG: dma:DMR_17010 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67756"
FT                   /db_xref="GOA:C8X0D1"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D1"
FT                   /inference="protein motif:PRIAM:2.1.1.36"
FT                   /protein_id="ACV67756.1"
FT                   /translation="MIEPGQLVQLVSPKGKRYLRLLQDGEVLQTHDGLLSMDEVRQADF
FT                   GATIKTHLGRPYRVVKPTIYDLIKGIKRKTQIIYPKEIGYILMKLGVGPGSRVVECGTG
FT                   SGSLTMALAWYVGDTGKVYTYERRAEFSELCAKNLDQVALGHRVQRYIRDIEEGFEQTD
FT                   ADALFLDVRTPDMYVPQAAAVVKPGAPVGFLLPTTNQISNLLAEIETTGLLTDLEVVEI
FT                   LLRRYKPVSDRLRPEDRMVAHTGYLVFARNRGAASSEELAAPAIAAAEPEDTVLE"
FT   gene            564090..565355
FT                   /locus_tag="Dret_0460"
FT   CDS_pept        564090..565355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0460"
FT                   /product="phenylacetate-coenzyme A ligase, putative"
FT                   /note="KEGG: dde:Dde_0540 phenylacetate-coenzyme A ligase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67757"
FT                   /db_xref="GOA:C8X0D2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D2"
FT                   /inference="similar to AA sequence:KEGG:Dde_0540"
FT                   /protein_id="ACV67757.1"
FT                   /translation="MTRKDRTEGIFSRREVLDESERKQYYLIQLKELLRYAYRYSEDVK
FT                   KRFDRAQFDVNKFRELSDLKHIPILKKKELIFLQSMGPRLGGLLTKDLGELRRIFMSPG
FT                   PIFDPEDRSDDYWGWTEAFYASGFRSGDIAQITFNYHMAPAGLMFEEPLRNLGCSVVPA
FT                   GPGSTNTQLEIMQKLRVSGYVGTPSYLMHLAQKAEEAGHNLRKDLFLEVAFVTGEKLSE
FT                   KMRSTLEKKFDMIMRQGYGTADVGCIGYECFHREGLHVANRAFVEICHPDTGIPLKDGE
FT                   VGEIVVTAFNKTYPLIRLATGDLAYIDRTPCPCGRTSPRLGGIVGRVDTTARIKGMFVY
FT                   PHQVEQVISKFDEIKRWQIEVTNPGGIDEMTLYVEATDFQRGDELQHMFRERIKLRPTL
FT                   KVLAPGALPPNVKPIEDKRKWD"
FT   gene            565346..566524
FT                   /locus_tag="Dret_0461"
FT   CDS_pept        565346..566524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0461"
FT                   /product="protein of unknown function DUF399"
FT                   /note="PFAM: protein of unknown function DUF399;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein; KEGG: dde:Dde_0541 PDZ/DHR/GLGF"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67758"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D3"
FT                   /inference="protein motif:PFAM:PF04187"
FT                   /protein_id="ACV67758.1"
FT                   /translation="MGLMPIISVVVGALLLAACGGPPALQSDPAAGLRKGTLVTHAGEP
FT                   MSLFAFAQQARHVDYLLMGEAHTNACDHAVQADVLQVLASQDLQPVLGLEMVPAAKQPV
FT                   LDRFNQGRLSVEELPEALDWQTSWGHPYSLYKPVFQVASDAGVDLYALNIEQAVLDEVR
FT                   EKGLEGMAPEKRARLPVTILDPPEPQRQALEEEFSGHQKLFQQMGNATSGSLERFMLIQ
FT                   SIWDTQMASRARRVHAQTGRPVVILTGTGHVEYDWGIVSRLHRWDPQAKIVSVIGWRGG
FT                   TLPEAEAADWFFYCPLQHTSRLGFTMEMRPEGARVMTVEPGSRAARGGLQSGDLLVKVG
FT                   GEPFTGLWDLHQAAMDAVQAEEPMQITVKREGASVELSLDLQRSGTTDGPTD"
FT   sig_peptide     565346..565426
FT                   /locus_tag="Dret_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.541 at
FT                   residue 27"
FT   gene            566840..567379
FT                   /locus_tag="Dret_0462"
FT   CDS_pept        566840..567379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0462"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: dma:DMR_28890
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67759"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D4"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ACV67759.1"
FT                   /translation="MQLALNEQERRALKDLAERSIRSRFDPQQHLPEAPSEQMQENLGA
FT                   FVTLKQAGHLRGCIGHVIGDRPLWQTIADMAQAAAFDDPRFPSLQEGEIKDLEIEISVL
FT                   GPLEPVTDPEGVEPGRHGLLVQRSVHSGLLLPQVATEQGWDRETFLGQTCVKAGLPPTA
FT                   WKSKKTQVYRFEAEVF"
FT   gene            complement(567533..568303)
FT                   /locus_tag="Dret_0463"
FT   CDS_pept        complement(567533..568303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0463"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dma:DMR_35690 putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67760"
FT                   /db_xref="GOA:C8X0D5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D5"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACV67760.1"
FT                   /translation="MLSQPNLLDNLTVVLFQPKFAENVGSTARACANLGCPNLKLVQPP
FT                   AWDLERAAPLATGRGKEVLHSLTLHPDLPSALSPHHTVYGTTARTGGWRKAIRTPEQVA
FT                   EDVAGKLAAGHQVAVVFGPEDRGLSNEEIDICGQLLTIPTASEATSLNLSQAVLLVLYE
FT                   WFKASSGKRFLRTTPPQSRLCTHEERETLLTSVQEALLRLDFFKDDNAAYWMLPVRRFF
FT                   QRFELRRHEFNLLMGICRQVKWLATRTDTDRHDP"
FT   gene            568618..569631
FT                   /locus_tag="Dret_0464"
FT   CDS_pept        568618..569631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0464"
FT                   /product="periplasmic phosphate binding protein"
FT                   /note="KEGG: csa:Csal_1476 periplasmic phosphate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67761"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D6"
FT                   /inference="similar to AA sequence:KEGG:Csal_1476"
FT                   /protein_id="ACV67761.1"
FT                   /translation="MKRVLYCALALAMVLTIGLGTASARDQIRIVGSSTVFPFASYVAE
FT                   EFGATTDYPTPVIESTGSGGGMKLFSQGVGLDTPDISNASRQIKVSEFKRCQENGVEDI
FT                   VQVVIGYDGIAIAHNIDNPELALTREELTLAVAAEVPQDGKLVKNPYTHWDQINGDLPN
FT                   REILVYGPPTSSGTRDAFEELVMEAASEDIDGYGGEYTKIRQDGVYVPAGENDNLIVQK
FT                   LDKNTEALGIFGYSFLEENSDRIQGALIDGVAPKPAAISSGEYPVSRSLFFYVKKAHLG
FT                   EVDGMEEYVDLFLSEKMIGDMGYLKGIGLIPLPKEEREAQRANWENRNNLQLSDIQ"
FT   sig_peptide     568618..568692
FT                   /locus_tag="Dret_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            569908..571140
FT                   /locus_tag="Dret_0465"
FT   CDS_pept        569908..571140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0465"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dvm:DvMF_2566
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67762"
FT                   /db_xref="GOA:C8X0D7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D7"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACV67762.1"
FT                   /translation="MIIVCFLGVLPLGAMAYYIGRNKASAKESQEGRRLHSRPGAYGWY
FT                   AVIWMAAPAVALNGIAALLHWFGLVTLPSELLVPASGVLFIAGLGLGLRTISPGLQARN
FT                   IVERWIRGLLLAASLISILTTVGIVVSILFEAIKFFQLVSFWDFLTGTQWSPDTAFLGG
FT                   AGRGGEAVAKPDFGSVPIFAGTFMITAIAMVVAVPIGLFAAIFMSEYATHSMRGAMKPM
FT                   LEILAGIPTVVYGFFAAITVSPLVVQLAESLGLEADYTNALTPGLVMGIMIIPFVSSLS
FT                   DDVISAVPQSLREGSYALGTTRSETIKQVLLPAALPGIVSAVLLAVSRALGETMIVVMA
FT                   AGLRPNLTWNPLEGMTTVTVRIVDALTGDQAFDSPETLSAFGLGLVLLMVTLTLNIVST
FT                   IVIRKFKQKYE"
FT   sig_peptide     569908..569988
FT                   /locus_tag="Dret_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.481 at
FT                   residue 27"
FT   gene            571165..572337
FT                   /locus_tag="Dret_0466"
FT   CDS_pept        571165..572337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0466"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: csa:Csal_1478
FT                   phosphate transport system permease protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67763"
FT                   /db_xref="GOA:C8X0D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D8"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACV67763.1"
FT                   /translation="MRQALSADTAKTMNKRRYRAEKRFRFYALSAVVLACAFLVFFFFD
FT                   IISQGYTAFVQARIKAEIHYTEQSAELPLAAVDEDIRYFVSRGRLRTIPLEIEKHPELM
FT                   GTTQTEWVIADAEVDQYLKGKSNRLKPKQKRFIDSLKANDRVKLAFNTGFFTRGDSKLP
FT                   EIAGIFAAVVGSIYVLSLTLLFSVPIGVMTAIYLEEFAPDNRFTQAIEVNINNLAAIPS
FT                   ILFGLLGLAIFINFFGVPRSSAMAGGLTLGLMTLPIIIISTRAALRAVPDSIREGAYGV
FT                   GASPWQVVWHHVLPLSLPGILTGTIIGLAQAMGETAPLLIVGMMAYIPEAPSGVTDAAT
FT                   VLPAQIYTWSAASLRAYAERTAAAIIVLLAVLLTLNAAAVFLRKRYERRW"
FT   sig_peptide     571165..571326
FT                   /locus_tag="Dret_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.274 at
FT                   residue 54"
FT   gene            572368..573060
FT                   /locus_tag="Dret_0467"
FT   CDS_pept        572368..573060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0467"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: sfu:Sfum_0707 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67764"
FT                   /db_xref="GOA:C8X0D9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0D9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV67764.1"
FT                   /translation="MTTYTVLLVEDEVDILNLLRINFENGGFRVLTAENGFQALDVLSS
FT                   APVDLVVLDLMLPGKDGLEVCRELRSRESTKHLPVIMLTAKGDEVDRIVGLELGADDYV
FT                   VKPFSPRELLLRAKAVMRRGKPQPEEETLWESGGLRVDFGTYKVTVDGEDRELTATEFR
FT                   LLVHLIRSRGKVQTRDQLLNKVWGYEFEGYARTVDTHVRRLRHKIEPYAAIVETVRGVG
FT                   YRLHGQEE"
FT   gene            573064..574854
FT                   /locus_tag="Dret_0468"
FT   CDS_pept        573064..574854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0468"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: sfu:Sfum_2891 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-4 domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67765"
FT                   /db_xref="GOA:C8X0E0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031967"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67765.1"
FT                   /translation="MSLRTKLLSVLLGLLFLASFVPLFLSKQVLHEELLAAAKREAVLK
FT                   LGHMQWLMRKGLAQEGPAGLNEQFRQIGKQLDVRITYIRQDGTVLADSSLPLRKVRQLE
FT                   NHKQRPEVQEAMQRRFGSSLRYSETLKTDLLYVARTMEATSEIPEGFIRMAVHLSAVDK
FT                   RLDGLFQQYLILFVIGLAVCAVVSFWLASRVSRAMLRMGQTADAIGNGEYDKRIAFTPA
FT                   REFLPLAQAINRMARRIQSHITTISDQNRQFESILNGMHEGVMVLDRQGKVSMVNTELK
FT                   NILEVTSPVGRAPIELIRSPELQGACEAMVAATVGKQSMEPAQLQVETMQERIYDVNLL
FT                   PLPAESQDISAIVVFHDITELKRLERVRRDFVANVSHELRTPLTSIKGYAETLLDMGQV
FT                   ETEAVHAYMQVVVKNANAMSRLLEDLLQLSKLESNAGDRELGPVLLTNAIQAAWKYCQP
FT                   MAEEHHVSLNQSQIPAGVCVWSEYDPLVQVLRNLFENAIKFSPENTEVRIEAEQDGPIW
FT                   QISVVDSGPGVGQREQERIFERFYRVQHGSKQVAGTGLGLAIARHIVRNHVGRIWVESP
FT                   VPGQIEGSAFRFTLRECSSA"
FT   sig_peptide     573064..573147
FT                   /locus_tag="Dret_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.524 at
FT                   residue 28"
FT   gene            574984..575748
FT                   /locus_tag="Dret_0469"
FT   CDS_pept        574984..575748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0469"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: dvl:Dvul_1910 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67766"
FT                   /db_xref="GOA:C8X0E1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E1"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACV67766.1"
FT                   /translation="MTTQAKMAAENVDFFYGDFKALKDINIIFPENRVTALIGPSGCGK
FT                   STFIRCLNRMNELIPEARLEGKVALDGADINDNKVDVVDLRRRIGMVFQKPNPFPKAIY
FT                   ENIAYAPRIHGVAKKGPEMDELVETSLRKAGLWDEVADRLQAPATSLSGGQQQRLCIAR
FT                   ALAVQPEVLLMDEPASALDPIATQKIEELIHELKEKLTIIIVTHNMQQAARVSDYTAFF
FT                   YMGELVEVDETETMFTKPSKKQTEEYITGRFG"
FT   gene            575796..576464
FT                   /locus_tag="Dret_0470"
FT   CDS_pept        575796..576464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0470"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   sfu:Sfum_0700 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67767"
FT                   /db_xref="GOA:C8X0E2"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E2"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACV67767.1"
FT                   /translation="MQTHLQRELDKLKNEIMNMFALSERALEKALQSVFDRDDQLAETV
FT                   IDGDKEINRLQVAVDERCVRLLALEQPVAHDLRFIVGCSRIAVDLERIGDQATNLAERA
FT                   LLLNQRPALPFHNILKALSDVVFRMFKQSIQAFTNLDTNQAVEVCKMDREADEQNIKII
FT                   KKLIDYMCCEQIVIERSVHTILASNSLERVGDLATNISETVVFIDEGEDIRHDCQLDPR
FT                   "
FT   gene            576721..578169
FT                   /locus_tag="Dret_0471"
FT   CDS_pept        576721..578169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0471"
FT                   /product="magnesium transporter"
FT                   /note="KEGG: sat:SYN_01534 Mg/Co/Ni transporter; TIGRFAM:
FT                   magnesium transporter; PFAM: CBS domain containing protein;
FT                   MgtE intracellular region; MgtE integral membrane region;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67768"
FT                   /db_xref="GOA:C8X0E3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E3"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ACV67768.1"
FT                   /translation="MKYTAIGMSGTGDHAASSVPEMPVKREVAMTESTTVVEHLLECIA
FT                   SGDAEQAVTLYDTYSPHPADWAEYVEPMGVDALAQYIELVGASHALPFFEFVSFELQKE
FT                   VLLRLSRETLADLVSQMSPDDRADLLDDMEDALQERILSLLIRAERQNIIKLINYDEDS
FT                   AGGYMTTDYALIRFDDTVSAALEQLRLQAPKKETIYYIYVVDKALRLIGFVSLRELIMA
FT                   PRYKLVRDVMSKSVISVRVNEDIEEVAKKMQHYDFLAIPVVSEDERLVGIITFDDIYDV
FT                   IQEETAEDMYLLANLDADESLNSPVGRSVKMRAPWLLVNLCTALFVAYTVDLFSDSISQ
FT                   FVALAALMPIVAMLGGNAGNQSLTVVVRALALGEVPLRDNWRVLLKEAGVGFVNGMLIG
FT                   GVMGAIAWAWYDNVWLGLIILVAMSVNLVVAGFFGSLIPVTLRKLKLDPALGSSILVTT
FT                   ATDVGGFLIFLGLATIFLQQLLGG"
FT   gene            578307..578408
FT                   /locus_tag="Dret_0472"
FT   CDS_pept        578307..578408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67769"
FT                   /db_xref="GOA:C8X0E4"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67769.1"
FT                   /translation="MFEGLMVVLGLGLIGIFLFYLNYEHGPKADHDS"
FT   gene            complement(578608..579138)
FT                   /locus_tag="Dret_0473"
FT   CDS_pept        complement(578608..579138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_33410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67770"
FT                   /db_xref="InterPro:IPR027588"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E5"
FT                   /inference="similar to AA sequence:KEGG:DMR_33410"
FT                   /protein_id="ACV67770.1"
FT                   /translation="MDEGKKKWKAHLDGAEAAKMLRSLADDIESGHFSIFASQLDIAPE
FT                   ADFKISLKQNEGKQSLECKFEYHGRRKEGGSGDSTGGEEYDDLKDRMKSDFKTIKEAVA
FT                   ATTLPGSKTAERFIRDSRIMCTYPGMGDPYYPEYLSVVDQFAQALAQEDAAAVSTAVTE
FT                   LERLKRECHDRYK"
FT   gene            579280..579939
FT                   /locus_tag="Dret_0474"
FT   CDS_pept        579280..579939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0474"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: ppd:Ppro_2838 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67771"
FT                   /db_xref="GOA:C8X0E6"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E6"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ACV67771.1"
FT                   /translation="MVSLDTNLQRRPEREIMVQEQIVARGIRDSRVLAALRDVPRHRFV
FT                   PAQYQDAAYDDAPLPIGDGQTISQPYIVAYMTELLELQPADRVLEVGTGSGYQAAVASR
FT                   LAQEVYTIERVESFDARVREVFHELGYTNIVCRIGDGTRGWPEAAPFEAILVTAAGRRV
FT                   PQPLVEQLAVGGRLIMPVENDRGRQVIVRMTRTSEEDYAQEHFLAVAFVPLLGAFA"
FT   gene            580265..581074
FT                   /locus_tag="Dret_0475"
FT   CDS_pept        580265..581074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0475"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dde:Dde_3071 amino
FT                   acid ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67772"
FT                   /db_xref="GOA:C8X0E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV67772.1"
FT                   /translation="MNRHQIHQRLQAWEPWWSILRYVLVMAALLWLGGRGAGNLGYNWQ
FT                   WYRISEYIGTVQQGELSLGPLLQGLLVTLKITGVSLLLSLVFGLGAALLRLLPSVMGRL
FT                   VARIYLELVRNTPLLILIFFIYFVIGPLFGIGRFFSAVLALSLFEGAYASEIFRAGIVS
FT                   IHRGQWEAAYCLGLSNWDMYRKIILPQALRRIIPPLTSQAVSLVKDSALVSTIAVYDLT
FT                   MRGQALVAETFLAFEVWFTVAGLYLVLTITLSALAWGLERKMAADSA"
FT   gene            581172..581951
FT                   /locus_tag="Dret_0476"
FT   CDS_pept        581172..581951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0476"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dps:DP0989 amino acid permease, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67773"
FT                   /db_xref="GOA:C8X0E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV67773.1"
FT                   /translation="MDSPAHHAPCGASSTGAPIIEAHGLSKRFPNGVVALEGVDLTIER
FT                   CEVVVVIGPSGSGKSTLLRCLNGLEDIDSGSVVIDRIPLDENPQHRLQIRTEVGMVFQS
FT                   FNLFPHLRVSENIMLAPKRVRKMSQAQARELMEELLQKVGMSDKMEAFPGQLSGGQQQR
FT                   VAIARALAMRPAVMLFDEATSALDPEMIGEVLEVMKDLAREGMTMVVVTHEMGFAREVG
FT                   DRFVFMEDGQVVEEGRNREFFTQPAKERTRLFLSKIL"
FT   gene            582092..582928
FT                   /locus_tag="Dret_0477"
FT   CDS_pept        582092..582928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0477"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: dde:Dde_3070
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67774"
FT                   /db_xref="GOA:C8X0E9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0E9"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACV67774.1"
FT                   /translation="MRVRKLLAVMIGCVMAVALLGTAAQSADVREALSQASALEQIQKR
FT                   GNLRVGFSTFKPWAMKNKKGEFIGFEIDVAKALAADMGVEPEFVPTKWSGIIPALLTGK
FT                   FDIIIGGMGIRPQRNLKVNFSVPYDHSGMSIVAHKSVAPGYESLEDFNKPSVTIAARIG
FT                   TTAAQAAKTHMPEATIRLFDDEAQALQELLTQRAHAMVASQPLPEQQAILHKERLYLPL
FT                   DGETFTTEPIGFAIRKGDIDFLNFLNNWVRVKKAEGWLQERHAYWFTTMDWEDQIQ"
FT   sig_peptide     582092..582172
FT                   /locus_tag="Dret_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.893 at
FT                   residue 27"
FT   gene            583182..584063
FT                   /locus_tag="Dret_0478"
FT   CDS_pept        583182..584063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0478"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dvm:DvMF_2684
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67775"
FT                   /db_xref="GOA:C8X0F0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F0"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACV67775.1"
FT                   /translation="MWQRPAKWTWFDTLFLAVVVGGGSWLLHNAATELAYKWQWEVIPQ
FT                   YLVRYDEQAGHWVPNLLLQGLLTTIRLSFWSTLLATCIGVVMGLFRVSPSLFKRLIAQS
FT                   YVVLSRNLPPLVLVFLLYYFFSDQLLPSLGLQEMVGRFPPLAQKIIALVFAEPAQLMTT
FT                   ISAVVTLALYEGAYITEIVRSGIQSIERGQWEAAYALGLSKFEQLRYVILPQAVRRVIP
FT                   PLTGQFISTIKDSAIVSVISVPELTFQGMELMAATYLTFEVWITVTVLYFLLTFSCSLL
FT                   ARRIEVFLQKRD"
FT   gene            584261..584812
FT                   /locus_tag="Dret_0479"
FT   CDS_pept        584261..584812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0479"
FT                   /product="ACT domain-containing protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   sfu:Sfum_2949 amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67776"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F1"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ACV67776.1"
FT                   /translation="MHKSIISVVGQDRPGIVADVAAILAELECNIEDVSQTILQGQFAA
FT                   LFIASIPGAQSVNEVRTSLEDRLAPQGLNCVVREFEESAAPSPREAASFVIITIGPDAP
FT                   GLIAAMAGVLKTHAVNICNLQAVNRSQAYPDQMVMIYEVTVPEDTSLPALRTALQQRAA
FT                   RDGLEVSVQHKAIFEEIHRL"
FT   gene            584901..586274
FT                   /locus_tag="Dret_0480"
FT   CDS_pept        584901..586274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0480"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711; KEGG:
FT                   dde:Dde_3704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67777"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F2"
FT                   /inference="protein motif:PFAM:PF05167"
FT                   /protein_id="ACV67777.1"
FT                   /translation="MLTESEVLSTLQMVQNEHLDVRTVTLGVSLYDCQSDDVQRLTQNI
FT                   YNKIYRLGRSFVALCDQVGEKYGIEVVNKRIAVSPAALVAAACRPEEFVEVARCLDRAA
FT                   HDVGVDFIGGFTALVEKGMAPGDTHLLEAMPEALASTERVCASVNVASSRSGLNMDAIA
FT                   RMGEVLKETAAATADRDGLGCAKLCVFANLPEDVPFMAGAYLGAGEPDAVINVGVSGPG
FT                   VVKKAIDRAVAANPELSLGELSETIKRTAYKVTRVGEIVGREVAKGLGVGFGIVDLSLA
FT                   PTPNVGDSVGEIFQSLGLSHIGVPGSTALLAMLNDAVKKGGAFASSSVGGLSGAFIPVS
FT                   EDLNIAEAAHQGHLGLEKLEAMTAVCSVGLDMVALPGAIPAVTLAGIIADEMAIGVINH
FT                   KTTAARLIPVPGKQAGDKAVFGGLLGEAHIMPVRDMDGSAGFIRHGGRIPAPLHSLKN"
FT   gene            complement(586388..586840)
FT                   /locus_tag="Dret_0481"
FT   CDS_pept        complement(586388..586840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0481"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: dma:DMR_15920
FT                   heat shock protein HSP20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67778"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F3"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACV67778.1"
FT                   /translation="MFRNLLPSLRREQSGLAYREDPFTEMMERFFRSPFEGFPREFGDF
FT                   PSIDLSETDKDIVVKAEMPGMEPEDIDLSVEGGSLIIKGEKKRETEDHNENYHRIERSY
FT                   GSFYRTIALPSQVDEANVKANFKRGVLQITLPKKENTQGKKIAIET"
FT   gene            complement(586982..588232)
FT                   /locus_tag="Dret_0482"
FT   CDS_pept        complement(586982..588232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0482"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: sfu:Sfum_2961
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67779"
FT                   /db_xref="GOA:C8X0F4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F4"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACV67779.1"
FT                   /translation="MSLLLRNAVLGETPTDLFIDRGVFQRIGPDLDISADKTIDAAGKA
FT                   IVPPLVNGHTHAAMTLLRGYADDMELHTWLTEHIWPLEARLSEEDVYVGSLLACLEMIK
FT                   SGTLFFNDMYWHFEGTARAVTEMGLRAALSSVFIDFGDARTAEDKQRRCLDLLATYKEV
FT                   DPRLQCALGPHAVYTVSRKSLEWIRDIAEEHDLLIHMHVAETRKEVEDCMAEHGKRPVA
FT                   YLDELGLLSPRLVACHAVWLTPEEMELLAKRGVNIVHNPVSNMKLCSGTSPVESMRQHG
FT                   LRIGLGTDGCSSNNALDMFSEMKSAALAAKVATGSPKALPADAVWEMATAQGAAIFNLN
FT                   HGITEGAWADCLLVDLDQPAMVPCYNLTSNLVYAASGGCVDTAICNGEVLMQKRHIPGE
FT                   EEIIARARACARRLVAG"
FT   gene            complement(588318..589343)
FT                   /locus_tag="Dret_0483"
FT   CDS_pept        complement(588318..589343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0483"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   dat:HRM2_10910 dihydrouridine synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67780"
FT                   /db_xref="GOA:C8X0F5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F5"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ACV67780.1"
FT                   /translation="MSATPLAPLDQPLAIGDKSLTNRFLLSPMVGVTHVALRRLLHDFG
FT                   GFGLHWTEMCSASAVLQEDPRISPVFRFHRDELATLVCQIMGSEPETMAAAARRIQDEG
FT                   FFGVDINMGCCVAAVRQQGAGAALLRDISRAAAIVDAVRQAVDIPLFVKLRSGWTDQGP
FT                   VVVHAARACAKAGADALIVHPRLAPDRRTRPPQWRDIRAVCEAVDLPVFGNGNVFTADD
FT                   ATAMLRQTGCQGIALGRMAAARPWIAAEWLGHFHPAPETYPKVAQRMVELLWTSFPEGQ
FT                   ALRLYRKFMNYFAANFAFGHRLRSDLTRSATPEDLYKEIAHHLTPLPQLTLRPNSLLFA
FT                   A"
FT   gene            complement(589349..589822)
FT                   /locus_tag="Dret_0484"
FT   CDS_pept        complement(589349..589822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0484"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: dvl:Dvul_2274
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67781"
FT                   /db_xref="GOA:C8X0F6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F6"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ACV67781.1"
FT                   /translation="MSETSVVRLYTDGACLGNPGPGGWAAVLLYGGEARKELSGGYAKT
FT                   TNNRMEMLALIEGLKVLKRPCRVKVWTDSRYLHDGLTKGWLQKWQKNGWKTAAKKPVKN
FT                   KDLWQELAALTSRHQLELHWVRGHSGDPENERCDVLAKAAANQPGLAKDPGHE"
FT   gene            complement(589822..591222)
FT                   /locus_tag="Dret_0485"
FT   CDS_pept        complement(589822..591222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0485"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: dma:DMR_27100 phosphohexose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67782"
FT                   /db_xref="GOA:C8X0F7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F7"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ACV67782.1"
FT                   /translation="MLPIRPDVFRAYDIRGRVDTDFDPEWVLTLGRACGTFFRTHGLRQ
FT                   CVVGHDCRHSSPLYNDRLIEGLMAAGMDVTALGMVPTPVLYYSIKTLHRQAGVIVTASH
FT                   NPPEFNGFKIWHGQTTMHTDQIQDLYAIMREGVFENEPGTYSELDIVPAYLEELSSDIA
FT                   LSRPVKVVVDGGNGSSGDICARLLEKAGATVVPLYCTPDGSFPNHHPDPTVAANIVDLQ
FT                   EAVVREQADFGVGLDGDGDRIGVVDAQGAPLYGDQLLAVFARDVLTRQPGATIIGEVKC
FT                   SHLLYEDIARHGGTPIMGKTGHSLIKARMLETDAALAGEMSGHMFFADRYYGFDDALYA
FT                   ALRLAEIVAKTPETPLGHMLDDWPETQNTPEIRIFCPEQHKFRIVDTARESFREQGLSI
FT                   NEEDGVRIEFGDGWGLLRASNTQPVLVLRFEAQSANRLQEIRDIVEIPLQRWIEALPET
FT                   PASDKESC"
FT   gene            591569..592654
FT                   /locus_tag="Dret_0486"
FT   CDS_pept        591569..592654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0486"
FT                   /product="HflK protein"
FT                   /note="KEGG: dde:Dde_2946 HflK protein; TIGRFAM: HflK
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67783"
FT                   /db_xref="GOA:C8X0F8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F8"
FT                   /inference="protein motif:TFAM:TIGR01933"
FT                   /protein_id="ACV67783.1"
FT                   /translation="MNWDWEKLQERRQRQQGGSGGGPQMPQFDWEEKLRKFKNFKGSGI
FT                   KVGILLALLLWATTGIYIVEPAEVGVVQRFGAFSRMTQPGPHYHLPFPIETVQTPAVSQ
FT                   VNRIEIGFRGAGEPGSYSQTQFRQIPEEALMLTGDENIISVQFIVQYQIKNARNYLFNI
FT                   VEQHKSVKDAAEAAMREVIGRNRIDTALTEGKTEIQNDTRGLLQEILDSYNSGISVVAV
FT                   QMQDVHPPDQVVDAFKDVASAREDKTRFINEAQAYRNDIIPRTRGDVAEITREAEAFKE
FT                   SKIRQAKGDSARFLKLLAEYKKAEAITSERLYLETMEKVLANPSTEKTIISKDAMESVV
FT                   PYLPLERLPRSGRNTQAGGGK"
FT   gene            592657..593508
FT                   /locus_tag="Dret_0487"
FT   CDS_pept        592657..593508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0487"
FT                   /product="HflC protein"
FT                   /note="KEGG: dde:Dde_2947 HflC protein; TIGRFAM: HflC
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67784"
FT                   /db_xref="GOA:C8X0F9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0F9"
FT                   /inference="protein motif:TFAM:TIGR01932"
FT                   /protein_id="ACV67784.1"
FT                   /translation="MPKRTGIAVAVVLVLLLVGIGQSFYTVDETQRGVILQLGKPVGET
FT                   VGPGLHFKLPFVQNVLLFDHRIQDYDANPAEILTEDKKNLVVDNYSRWRIEDPLKFYRT
FT                   VRTVSQGVSRIDDIVYSELRVELGQYTLNEVVSSKRGDIMTAVRDKADALLDEYGIKIF
FT                   DVRIKRTDLPEENQMAIFGRMRSEREREAKRYRSEGHEEASKIRAVADKDRTIMLAEAE
FT                   RKAQILRGEGDAEAARIFAEALGQDKEFFSFVRSLEAYEKGLSNSTRLIMDNQNEFLRY
FT                   LQ"
FT   sig_peptide     592657..592728
FT                   /locus_tag="Dret_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.323 at
FT                   residue 24"
FT   gene            complement(593622..594767)
FT                   /locus_tag="Dret_0488"
FT   CDS_pept        complement(593622..594767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0488"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: dvm:DvMF_0138 lipid-A-disaccharide synthase;
FT                   TIGRFAM: lipid-A-disaccharide synthase; PFAM: glycosyl
FT                   transferase family 19"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67785"
FT                   /db_xref="GOA:C8X0G0"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G0"
FT                   /inference="protein motif:TFAM:TIGR00215"
FT                   /protein_id="ACV67785.1"
FT                   /translation="MTATPTVWISAVETSADMHGARVMRSLQARYPGLRFRGVGGPAMR
FT                   RAGLDAVARAEDLSVMGLTEVLEFLPRILKILRRVKRELAATAPVAVVCIDAPDFHFPV
FT                   AKRAARLKLPVVYYVAPQAWAWRKNRVTFLRRYVDRLMCLLPFEESFFRDYGVNARFAG
FT                   HPLLEDMAEHNAAPGHPESAVLAILPGSRHKEIHSLLPPFLDTVRRLHHAHPDLSCRLI
FT                   QAPGIAAETLLEHWPESVPVELVTAEARWAALSTATVALAASGTATLECALLGLPTVVA
FT                   YKVSQVSYAIGKRLVDVPYISLPNLIMDKPLFPEFLQDDVCADQLSQALEQWLVSPEDR
FT                   MQTRSELQGLRHRLGGRTASEEVAEAVLEVAGLATPGTRHP"
FT   gene            complement(594863..597091)
FT                   /locus_tag="Dret_0489"
FT   CDS_pept        complement(594863..597091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0489"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: dde:Dde_3167 polynucleotide
FT                   phosphorylase/polyadenylase; TIGRFAM: polyribonucleotide
FT                   nucleotidyltransferase; PFAM: 3' exoribonuclease; RNA
FT                   binding S1 domain protein; Polynucleotide phosphorylase,
FT                   phosphorolytic RNA- binding, bacterial/organelle-type; KH
FT                   type 2 domain protein; Exoribonuclease, phosphorolytic
FT                   domain 2; K Homology, type 1, subgroup; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67786"
FT                   /db_xref="GOA:C8X0G1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G1"
FT                   /inference="protein motif:TFAM:TIGR03591"
FT                   /protein_id="ACV67786.1"
FT                   /translation="MTMSNIFGSTSVSTTLQGQDILIETGRLANQANGAVWVQSGGTVV
FT                   LVTAVTQPVTRDIDFMPLVVDYQEMSYASGRIPGNYFRREIGRPSERETLVSRLIDRPI
FT                   RPLFPAGFRDEVQIIATVLSAAPEVNPDVLALTGASAAMHISDIPFDGPIGGIRVGQVD
FT                   GEFVLNPSQNELENSDLNLVLAGSRDAVTMVEGGGNFVPEDRMAEAITWGHEQVQALLQ
FT                   LQDELREKIGAPKIAVQAPEADTELESRVHDLAGSELAEALQVPNKLERKTAKKTVKDK
FT                   VMATLEQEFAEEPERLKGAGKIFEALEKDIVRKRVKETKTRIDGRDLTTVRDLNIETSS
FT                   LPRTHGSAIFARGETKVLSVATLGSSRDEQRIEMLDGELNKRFMLHYNFPPYCVGEVKM
FT                   MRGPARREIGHGALAERALTPVLPTEDEFPFTMRVVSEVMESNGSSSMATVCGTSLSLM
FT                   DAGVPVSAPVAGIAMGLIKEEDEFLVLTDILGDEDHLGDMDFKVAGTAEGITAIQMDSK
FT                   IAGIPPEVLKRALNQAMDARLHILDNMNTVLPAARAELSEHAPQLEIVEVDTERIKDVI
FT                   GPGGKNIKAITQATGASIDIEDSGRISIFAPNQQALQEAVDMVLFYDQKAEVGKDYEGT
FT                   VKRIMNFGAFVEILPGLEGLLHISQLDQQRVEQVEDVVKVGDSVKVKVIEQSGDGKIRL
FT                   SRKAVLMEEQGLTFDLAAEARPSGPKKGPGGGGRGGRDNGPRGGGDRR"
FT   gene            complement(597187..597456)
FT                   /locus_tag="Dret_0490"
FT   CDS_pept        complement(597187..597456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0490"
FT                   /product="ribosomal protein S15"
FT                   /note="TIGRFAM: ribosomal protein S15; PFAM: ribosomal
FT                   protein S15; KEGG: dal:Dalk_4742 ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67787"
FT                   /db_xref="GOA:C8X0G2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G2"
FT                   /inference="protein motif:TFAM:TIGR00952"
FT                   /protein_id="ACV67787.1"
FT                   /translation="MALTQEKKTEIIEQFKQHEGDTGSPEVQVALLTHRITYLTEHFKE
FT                   HKQDNHSRTGLLKLVGKRRKLLDYLRRKDVHRYRDLIKRLNLRK"
FT   gene            complement(597468..598439)
FT                   /locus_tag="Dret_0491"
FT   CDS_pept        complement(597468..598439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0491"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; KEGG:
FT                   dma:DMR_31630 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67788"
FT                   /db_xref="GOA:C8X0G3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G3"
FT                   /inference="protein motif:TFAM:TIGR00431"
FT                   /protein_id="ACV67788.1"
FT                   /translation="MAKKKPAFPQQHGLLILNKPQGPTSYGCLDQIKRHLGQRKIGHAG
FT                   TLDPMASGVLVVLLGQATKLASYISGGDKIYRGHLRIGLATDTYDIEGAVEHQFPWEHI
FT                   TPEDVGKTVAEWRDLLEQEVPAYSAAKHKGKPLYELKRTGQEVPVKTKPVEIFDAQVLD
FT                   IALPDVQFRVSCSQGTYVRSLAHSLGKRLGCGATLTALVREFSHPFALEQAYSLEEVLG
FT                   EPDSLAEKILPLDKCLPHWPSLPLDGSQAREVQNGTRLLVRDVTADFAVHPGDRAQFVD
FT                   ATGRLLALVEAKWEGPVLVWTILRGFQPPKKHDVAPERTNHE"
FT   gene            complement(598432..599424)
FT                   /locus_tag="Dret_0492"
FT   CDS_pept        complement(598432..599424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0492"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: dde:Dde_3164 DHH family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67789"
FT                   /db_xref="GOA:C8X0G4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G4"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ACV67789.1"
FT                   /translation="MSTPLRLVTQTLTQADTFLIVSHAHPDGDAIGASAALGWLLQRLG
FT                   KEVILYNESGLPEQFDWLTLPDRVATELPPKPPQVVVVLDCGDSSRVHTDGSFPFAEST
FT                   VVNIDHHLGNPEFGDINWVEPHRSSVGEMIGLLAQACGVSLSGALGECVYLAMITDTGS
FT                   FGFSNTGSDTLRLAADIVEAGIDPSRIQARLQTQLTLARVHLHGLALQQARTYAGGRLA
FT                   VVSTSQEMFAATNTTAADCEGLVTAMRNIKGVLAGISLRETPEGQIKFSLRSWGETDVR
FT                   SIAAAFSGGGHRNAAGGHLDGPLDTAEAQLITHIKNAWGLDEGRNTVYG"
FT   gene            complement(599378..599740)
FT                   /locus_tag="Dret_0493"
FT   CDS_pept        complement(599378..599740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0493"
FT                   /product="ribosome-binding factor A"
FT                   /note="TIGRFAM: ribosome-binding factor A; PFAM:
FT                   ribosome-binding factor A; KEGG: tbd:Tbd_0696
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67790"
FT                   /db_xref="GOA:C8X0G5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G5"
FT                   /inference="protein motif:TFAM:TIGR00082"
FT                   /protein_id="ACV67790.1"
FT                   /translation="MHRGTTRRAQRMGDTIMREIGHLLVEEAKDPRLQLVTISGVRMNR
FT                   NLQVAEVLFTHPEGRDKEQEIITALESASGFLRTALGKRLRLRFVPQLRFTWDTFLEDM
FT                   VYEHPTPVGDPDTDPS"
FT   gene            complement(599744..600031)
FT                   /locus_tag="Dret_0494"
FT   CDS_pept        complement(599744..600031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0494"
FT                   /product="protein of unknown function DUF503"
FT                   /note="PFAM: protein of unknown function DUF503; KEGG:
FT                   dvl:Dvul_2434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67791"
FT                   /db_xref="InterPro:IPR007546"
FT                   /db_xref="InterPro:IPR036746"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G6"
FT                   /inference="protein motif:PFAM:PF04456"
FT                   /protein_id="ACV67791.1"
FT                   /translation="MHIGLLSIEFYLHGIGSLKDKRRIANSLKQKLRNKFNVAVAEIDT
FT                   QHSHTWLKLEILTLANERARVESVLNKALAMVEAISDEEITDVHTDIFGV"
FT   gene            complement(600104..602782)
FT                   /locus_tag="Dret_0495"
FT   CDS_pept        complement(600104..602782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0495"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2 domain
FT                   protein; Miro domain protein; GTP-binding protein
FT                   HSR1-related; elongation factor Tu domain 2 protein; KEGG:
FT                   dma:DMR_31600 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67792"
FT                   /db_xref="GOA:C8X0G7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G7"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ACV67792.1"
FT                   /translation="MTTKMRVRELSNELGLSNKELLHLLRELGIQVKSHMSGLSDDEVD
FT                   QVRQRFHAGSQSQDSVQKRTTRSGVIVRRRRRAAKSESEPEPQPAEEPEAEPEAAAEAA
FT                   AAEPQPEPAPTARIVEPPHADEEPEEGEPEAEEPEAEEPQHPEETTQAEPAQDTGVAQE
FT                   PQETEETIQEQPAEDSEEPSETEAGKKKKKKRKKKPESPAVKVISKPEVTAEEPAPSPA
FT                   PAEAADTEAASKKKKKKDKRVVDFSSTPAEAEPQDKRKASTQWKKKKSAGVKDKTGGKE
FT                   RRPGRKRQQQGGKAEPVRPTTQPTKASKRKIKIDEAIRLGDLARQLGVKVQELIKSLMQ
FT                   LGIMATINQSLDIETATVLAEEFGYEVEKVGFSEDEFILPKEEDNPEALEPRWPVVTIM
FT                   GHVDHGKTSLLDAIRESKITTKEAGGITQHIGAYYVGTDRGELVFLDTPGHEAFTAMRA
FT                   RGAQVTDIVILVVAADDGVMDQTREAINHSKAAGVPLIVAVNKMDKENADPERVKRELA
FT                   EFDLVPEEWGGDTIYAYVSAKSHSGLDDLLEMVLLQAEVQELKANPAKRARGHIVEAKL
FT                   DKGRGAVGTVLVQEGTLHHGDAFVCGLYHGKVRALFNDRGKNIKSAGPSMPVEVQGFDG
FT                   VPEAGDEFVAVQDDKVARRIAEERQTKQREKDLAKETKVTLESFMAAKADEEVKSLNLV
FT                   IKADVQGSLEACIEAVRKLSTDEVKVEIIHGGTGSISESDIMLASASSAVLIGFNVRPT
FT                   ARIKDIAEQEKVDIRFYDVIYQMVNEVKDAMAGMLAPVVKEVYLGQAEVRDTFSVPKVG
FT                   TVAGCMVVDGKLQRNAHTRLLRDGVVIYTGKIDSLKRFKDDAKEVQKGFECGVGLENFN
FT                   DIKSGDIIEAFEEVQEKATLD"
FT   gene            complement(602772..603032)
FT                   /locus_tag="Dret_0496"
FT   CDS_pept        complement(602772..603032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0496"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   dvu:DVU0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67793"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G8"
FT                   /inference="protein motif:PFAM:PF04296"
FT                   /protein_id="ACV67793.1"
FT                   /translation="MQNQPVNHSRQHGHQPERMCVICRRRFAKHQLHRLVASADCDRLL
FT                   DDPKQTRPGRGYYICPDPACQKRISKFRGWRKKCKGGRHDN"
FT   gene            complement(603188..604510)
FT                   /locus_tag="Dret_0497"
FT   CDS_pept        complement(603188..604510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0497"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: dvm:DvMF_2515 transcription elongation factor
FT                   NusA; TIGRFAM: transcription termination factor NusA; PFAM:
FT                   NusA domain protein; RNA binding S1 domain protein; K
FT                   Homology, type 1, subgroup; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67794"
FT                   /db_xref="GOA:C8X0G9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0G9"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ACV67794.1"
FT                   /translation="MSMELKKAIDQISKDRGIDRDLLIDTLEEAVRSSVNKKFKNKLDI
FT                   EVSFDEEAGDIEVYQFKVVVEEVDDPNTEISLDEARIEDPNVQLEDELGFRMEISDLGR
FT                   IAAQSAKQVIIQRMRDAEQEIIYEEYKDRRGEIISGIIQRRDRAGWIINLGRTEAILPK
FT                   QEQIPRERFRRGDRVQGYIIDVRKEGRGPQIVVSRSHPDYMAALFKREVPEVGDGTVTI
FT                   MGVARDPGKRAKVAVLSQDSDVDPVGACVGVRGSRIQNIVQEFKGERIDIVVWNHDVAT
FT                   YAMNALSPAKISRMTVDDVEKTLEVVVPDDQLTLAIGRKGQNVKLASKLLGWKIDIITE
FT                   SRYGADPSDQADLEQAEHVTGIPTDHFVQAGLGSLDALREASDEQLAAVDGMDTSKMAD
FT                   LRAALNLLAPNRDTREDDGIQASTADAPSHDTVVAPDDSTE"
FT   gene            complement(604606..605079)
FT                   /locus_tag="Dret_0498"
FT   CDS_pept        complement(604606..605079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0498"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   dde:Dde_3160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67795"
FT                   /db_xref="GOA:C8X0H0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H0"
FT                   /inference="protein motif:PFAM:PF02576"
FT                   /protein_id="ACV67795.1"
FT                   /translation="MHEKLYERLSELIKPLAASCGLDVWGMEIPASRGGVLRVYVDSPN
FT                   GVSIDQCATLSRHISVTLDVEDPLPGPYTLEVSSPGLERPFFTVSQLPPYIGQPVALKL
FT                   QAPMQGRKKWRGVLIEAEGDHLTLDVDGVEHVFAWEDVEKARLVFQEPPASGK"
FT   gene            complement(605194..605269)
FT                   /locus_tag="Dret_R0005"
FT                   /note="tRNA-Gly4"
FT   tRNA            complement(605194..605269)
FT                   /locus_tag="Dret_R0005"
FT                   /product="tRNA-Gly"
FT   gene            605491..606330
FT                   /locus_tag="Dret_0499"
FT   CDS_pept        605491..606330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0499"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: dvm:DvMF_0581
FT                   ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67796"
FT                   /db_xref="GOA:C8X0H1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H1"
FT                   /inference="protein motif:PRIAM:2.7.1.23"
FT                   /protein_id="ACV67796.1"
FT                   /translation="MQHPVHALLLVTKPGQDDAQQTAREVQLWLREREVRTLLVENSLD
FT                   QDNLDLNGFVPDAALVLGGDGTLLAVARKLRRHQIPLLGINLGHVGFLTEVEEEDWHPS
FT                   LEQLLAQQGRISQRMALEFEVKRGDRTIHSGWALNDVVVNRGRIARLIGLDISIDSQPV
FT                   GPIRADGIVVATPTGTTAYAVSAGGPLVHPELEAICMTPICPFMSHIRPMVLDAGHRIR
FT                   IDITSHSAEACLTLDGQVGFDLLPGDAIHLQRSAFDARFINLHPKAYLDKLRSKGYF"
FT   gene            606447..608207
FT                   /locus_tag="Dret_0500"
FT   CDS_pept        606447..608207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_2617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67797"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H2"
FT                   /inference="similar to AA sequence:KEGG:Dde_2617"
FT                   /protein_id="ACV67797.1"
FT                   /translation="MPELPSFSSVLELRYGRDPYLDAWLLHFMIENHLEYFTKPEENAS
FT                   LEQLRFMVVLDEGQVFAPCSDEMLRELLQNDLSERLLSEYRSVWRALVRLIHDHVPDPY
FT                   LRKRVAALCRHKFRQSLHASFTIPSRLLKQLLTIFLAQTAVEDPLREHKQLWNRRAQDF
FT                   IDSPDLNETLNACPSALMGCAHISELRWQLDRLELRRLLCLATWETIWRTPDCSEAPLQ
FT                   QDNLQAVCPEADDLLAEVFGPARREPMKILYLPHDSGGIIFDLLIIRTLLQQRHRVILA
FT                   LKEGFDFYSPTFWDIEHDQVLAQALEGAHFLNNSQVTKNELLKVQRENQFVVISDGTRE
FT                   RLNLYRTSVTFARAWKESDLVMARGIPNYRRLVGNGHALSRDVLCFYRQNGEPLQLVHK
FT                   PKSDSAFKFTESQLLELSEGIIRSMRQAKSRGKSVMFYSAIIGSLPGQTRKALEILNTF
FT                   VAYLRQRLENTLIINPAEYFEHGMDADDLMYMWERVQRSGLIDVWRFQTVEDIETSFEL
FT                   MGEKVPAAWSGKDATYSTGCTKEMHIALDVQQQHPELQIIGPNPEKFFRRREYGVGKFF
FT                   DARINASIGR"
FT   gene            608218..609456
FT                   /locus_tag="Dret_0501"
FT   CDS_pept        608218..609456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0501"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   dde:Dde_2733 transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67798"
FT                   /db_xref="GOA:C8X0H3"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H3"
FT                   /inference="protein motif:PFAM:PF03562"
FT                   /protein_id="ACV67798.1"
FT                   /translation="MRPAKWYEHRVLRWMAVGIWCCALSLVLSGCRGPVPEPPLQKGYV
FT                   AVSRDEAAALSRQAVQYLLAATTEEELATATRRSLAYVRTRPPRAMALETSNLRVTWHR
FT                   LQRSLELFLELLPRIARQPELLARHFEWYALRPGPLFTGYYEPELQAALDKRPGYETPL
FT                   YRRPEDLQQVDLGRFHPRWDGQTLRYRVVNGSIAPYFDRQAIESQDALSGRGLELAWAK
FT                   DPVDVFFLQIQGSGRLRLPDGRIQHVRYAGANGRPYVSLGRVLIEKGLLDSGNVSMQSI
FT                   RRFLNAHPERRQSLLNTNPSYVFFEKAADGPYGAMGRRLTPFVSLATDRSVLPLGGLTV
FT                   WNADLPAAQSNSTVPFTSLGLTQDVGGAITGHHFDLYCGSGDQAGALAGRLKDRGRIFF
FT                   LLATNATQPDVKE"
FT   gene            609460..610893
FT                   /locus_tag="Dret_0502"
FT   CDS_pept        609460..610893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0502"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; Asn/Gln amidotransferase; GatB
FT                   central domain protein; KEGG: dma:DMR_31400
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67799"
FT                   /db_xref="GOA:C8X0H4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H4"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ACV67799.1"
FT                   /translation="MSAYEPVIGLEVHAQLKTASKIFCSCSTAFGREPNSNTCPVCTGM
FT                   PGVLPVLNKRAVEFGAKMALAVECRVNPRSIFARKNYFYPDLPKGYQISQYEEPLAEFG
FT                   RLSISMGEAIKEVGITRIHMEEDAGKSLHGTGDRTSYVDLNRTGVPLLEIVSEPDMRSP
FT                   EEAVAYLKALRAILVYLDICDGNMEEGSFRCDANISLRPQGQEAFGTRTELKNLNSFRH
FT                   VQRALEYEIARQEDILDDGDAVVQETRLFDVDKGVTRSMRGKEEAHDYRYFPDPDLVPL
FT                   CLDESWLTTWGAELPELPEAKRRRFLDDYELSLDDAQTLTGERELAEYFEAVVAAGASA
FT                   KAAANWMLTEMLREIREAGLAPGEVCFRPEQLAALLDLIEKQTISRKIAKDIYPEIFRE
FT                   GLDPEQYVQDKGLVQISDTSALEAVVQEVIDENPAEVEAYQGGKKKLVGFFVGQVMRKT
FT                   QGQANPKLVNELLAKRLDS"
FT   gene            611017..612069
FT                   /locus_tag="Dret_0503"
FT   CDS_pept        611017..612069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0503"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: dvl:Dvul_2877 eIF-2B alpha/beta/delta-related
FT                   uncharacterized proteins; TIGRFAM: translation initiation
FT                   factor, aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67800"
FT                   /db_xref="GOA:C8X0H5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H5"
FT                   /inference="protein motif:TFAM:TIGR00512"
FT                   /protein_id="ACV67800.1"
FT                   /translation="MKRHIRFSDDENALLLLDQRFLPLQEKWFVCRTVEDVITALKEMV
FT                   VRGAPAIGVCAAYGCFLGARQVAELTSNGDWRVELDRLLERLEDARPTAVNLRWAIRRM
FT                   RAAQEADPEMANEELQWVWLKMAKDIHAEDIRINKLIGGHGAAVLPETATVMTHCNAGA
FT                   LATGGYGTALGVVRAGVGQGKTIRVIANETRPFLQGARLTAFELAWDDIPVQVACDNAA
FT                   ALLLAQGKIDAVVVGADRIAANGDIANKIGTYGVALAAREHGVPFYVAAPLSTIDRECP
FT                   SGAQIPIEERPQQEVARYGGQQIVPEGVSTLNFAFDITPASFVTGIVTERGILNPPFAQ
FT                   SIADAFSSTV"
FT   gene            612092..613417
FT                   /locus_tag="Dret_0504"
FT   CDS_pept        612092..613417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0504"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /note="TIGRFAM: ribosome-associated GTPase EngA; small GTP-
FT                   binding protein; PFAM: GTP-binding protein HSR1-related;
FT                   Miro domain protein; KEGG: dde:Dde_0062 GTP-binding protein
FT                   EngA"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67801"
FT                   /db_xref="GOA:C8X0H6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H6"
FT                   /inference="protein motif:TFAM:TIGR03594"
FT                   /protein_id="ACV67801.1"
FT                   /translation="MLPTVALIGRRNVGKSTLFNRLIRKQKALTHDRPGVTRDRLYAEV
FT                   PHGEPPFALVDTGGLVLDESDGVEADVFEQAREAMEGAQLILFVVDGRQGVSTIDEQLA
FT                   AFLRQTDKPVRLVINKVDGAELEDTLSAEFYALGFPLSAVSAAHGYGTLTLQEEIEETL
FT                   QGLGAVPVEEGEQEDDITLRLALLGRPNVGKSSLINALVGEKRLVVSPEAGTTTDIVDV
FT                   LFEKKGKRYIFLDSAGVRRRSKIDDSLERFSVLRALRNSKRAQVTVLCLDALQGVVGQD
FT                   KKLLSFLDREKIPFIVAVNKVDLVPSDRLGQLKKYFENELRFLSHVPRIYTSAVSKAGL
FT                   GGLLPLTEKLWSECTTRIGTGQLNRGLEDMIGRHQPPVVKHRRAKFYYLTQTGTTPPTF
FT                   VFFVNDKNLVKPSYARYLEKQLRKRFQLRMTPIQLYFRTSRG"
FT   gene            613473..614396
FT                   /locus_tag="Dret_0505"
FT   CDS_pept        613473..614396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0505"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: dvl:Dvul_0190
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67802"
FT                   /db_xref="GOA:C8X0H7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H7"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACV67802.1"
FT                   /translation="MVQKAEKIWFDGELVDWDAAQVHVLTHTLHYGVGVFEGIRCYKGS
FT                   DGRPGIVRLREHVERLFDSARAVEMEIPFSQDEITKAIEQTVQVNNLAEGYIRPLAFIG
FT                   DGVMGVHPGSNPVRVIIATWPWGAYLGDDALQKGIRVRTSSFSRHHVNVMMTKAKVCGN
FT                   YVNSVLAKREAVADGYDEALMLDVDGYVAEATGENIFIVKHGVLKTPPLGPILGGITRD
FT                   CLITLARDMGYSVIEQRFTRDELYNAEEAFFCGTAAEVTPIREVDRRQIGAGQAGPVTQ
FT                   LLQQEYFRVVRGENLKYAGWLHHFDS"
FT   gene            614415..616031
FT                   /locus_tag="Dret_0506"
FT   CDS_pept        614415..616031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0506"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dde:Dde_0066 DNA polymerase III, tau subunit;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   AAA ATPase central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67803"
FT                   /db_xref="GOA:C8X0H8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H8"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACV67803.1"
FT                   /translation="MSPGPLTHTYRPQTFSTVVGQKQVRTILSRAAAENQVAPAYLFSG
FT                   TRGVGKTTVARILAKAINCEQGPASEPCNQCRHCREITQGTGVDVVEIDGASHTGVDHV
FT                   RKLKEDVGYAPLSCRYKVIIIDEAHMLSKAAFNALLKTLEEPPPQAIFIMATTEPHRFP
FT                   ATIISRCQHHIFQRLRQEELTDHLRRVLENEAIEMDAEAVRLIARKGAGSVRDAMSLLA
FT                   QVLALGQRRLESAHVREVLGLAGQETLLSLFEALRDQDCIAINTVLRSVLDQGLDLAFF
FT                   LRELTATWRNLFLLKQSGEGALSLLDLPQEEAREWLQWAEAFSASHIHACWQMTLEGQR
FT                   RVLTSVEPALALELLLLNLAFMQDLVPLGQPGSGSSGPAPGSAGGTSGRRASGAAPAGS
FT                   QTAAPQKPQSPVQSAAESSEEKTWEGFVRYCQQAVEGEAAKLPGLNHVQGEIDGGCLRI
FT                   QCQSRVQAERFAVTEKKNLLHDLACQYFETDMELEVHQPKESAPPDRNTLKKEVLEHPA
FT                   IQEALSAFQAQLVEVRPKSGR"
FT   gene            616113..616415
FT                   /locus_tag="Dret_0507"
FT   CDS_pept        616113..616415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dde:Dde_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67804"
FT                   /db_xref="GOA:C8X0H9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0H9"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV67804.1"
FT                   /translation="MNDLIRQAQQMQRKMAQIQEEVGNQTVEASAGGGMVTVTVTGNQE
FT                   VTGIAIDPSVVDPNDVDMLQDLVLSAVNEAMKKAKKLMEDSMSEVTGGMNIPGLF"
FT   gene            616417..617028
FT                   /locus_tag="Dret_0508"
FT   CDS_pept        616417..617028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0508"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: Zinc
FT                   finger C4-type, RecR; KEGG: dde:Dde_0068 DNA replication
FT                   and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67805"
FT                   /db_xref="GOA:C8X0I0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I0"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACV67805.1"
FT                   /translation="MQSNKLPAPLRKVVDELAQLPGVGPKSALRMGLTLLKWPQEKAEG
FT                   LGESIKQLRRTLCLCEQCASLTDQNPCAICADVARDGSVLCLIPDWDSLLVMEEAGFFR
FT                   GKYFVLGGLLSPLDGVNPDQLELDRLEKRLDQGEIREVVLALGTTTEAEATESHLKNLL
FT                   HRKYPDLRVARLAQGIPLGAHLKFMDRETLKQSMQYRQSL"
FT   gene            617036..619222
FT                   /locus_tag="Dret_0509"
FT   CDS_pept        617036..619222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0509"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: dma:DMR_25280 helicase RecD/TraA family
FT                   protein; TIGRFAM: helicase, RecD/TraA family; SMART: AAA
FT                   ATPase; Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67806"
FT                   /db_xref="GOA:C8X0I1"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I1"
FT                   /inference="protein motif:TFAM:TIGR01448"
FT                   /protein_id="ACV67806.1"
FT                   /translation="MSATTLQAEIVSIVFHNPENDYVVARARAEGEPGQSTVVGIMPQV
FT                   MPGEQVRLEGEWREHPKFGRQFHAVSHTRELPATINGIRRYLASGRIKGVGPVMAERLV
FT                   QFFGKDVLDILDNAPERLLEVEGLGKKTLEGIKASWDQQREVRNVMLFLQSHDVPPTYA
FT                   GRIFARYGNQAVEKLQQNPYELAYEIRGIGFKTADTMALKLGFQEDSPERLEAGLVYTL
FT                   FQFAEQGHMFYPGDELVHKVTETLGVGDTGKVDGALARLEERKRVVVEDLPEQAVLRAV
FT                   FLRHFHNWEAEIASRLTALVSHPAPVNEGKLDSILPGLEQKIGVALSSEQKEAVFEACA
FT                   NKTFILTGGPGTGKTTITQAVVRGLGKLGYKIKLAAPTGRAAKRLSEATGASASTLHRL
FT                   LGFSPDGAFAYNEEKKLKVDALVVDEASMLDCQLCVHLLRALPLTCRLILVGDVHQLPS
FT                   VGAGNILEDLLESRAVPSRHLTHIFRQAQESLIVVNAHRFNEGLFPTTSAKEPPEADFF
FT                   WVEQDDPARVQEIIRQLVCERIPAIYGLDPLRDVQVLSPMHKGEVGTQQLNTLLQQELN
FT                   PSGPTLTRGNRMFRQGDRVLQTRNNYEKDVFNGDLGWITAINADSQTMQIDFEGRDLTY
FT                   EQGELDELTLAYAVSVHKSQGSEYPAVVLPVVTQHFMLLQRNLIYTALTRAKSLAVLVG
FT                   SSKALGIALNHKRGAERYTHLRYRLQDAANDIPY"
FT   gene            619264..619347
FT                   /locus_tag="Dret_R0006"
FT                   /note="tRNA-Leu1"
FT   tRNA            619264..619347
FT                   /locus_tag="Dret_R0006"
FT                   /product="tRNA-Leu"
FT   gene            619487..620833
FT                   /locus_tag="Dret_0510"
FT   CDS_pept        619487..620833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0510"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: trigger factor domain
FT                   protein; trigger factor domain; peptidylprolyl isomerase
FT                   FKBP-type; KEGG: dde:Dde_2222 trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67807"
FT                   /db_xref="GOA:C8X0I2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I2"
FT                   /inference="protein motif:TFAM:TIGR00115"
FT                   /protein_id="ACV67807.1"
FT                   /translation="MEYQVENISPVEKKITVTVPAEEVNAALGAAIAMYRKDVQIDGFR
FT                   KGKVPSSIVESKFKSQIYQEATNDLLNVHINQIMGELNLQPLSGLDVDAKEMVRDQDYI
FT                   YTFSFENVPDIDLPEYKGLSGTKEKVEAKEEDIQEVLDRVRQNMASMEEVDEDRTPKDG
FT                   EVAVVDFTAEYDGKPVEGGEAQNFDLPLGEGQSLPEFEELVKTLTPGEQAEEDITFPSD
FT                   FLNKDLADVTVNMKVTLKAIKQRVLPEVDDDFAEKAGGFGSAEEMRKAISESYENSRNQ
FT                   VAKSEAQKAILDKILEQVDFPLPPSMVENQIQAQIKQQRERLERQGKSLESTGTSEEQL
FT                   REEYRPEAESLVKSHLVLLAIANKEELSVSPQEVEQHLYQMAVQSGQDFQTLKEYHEKN
FT                   NLMYALRDQLLADKAMELIYDNAEVTEVPAGGSDQESSDEDDSAATENE"
FT   gene            621055..621648
FT                   /locus_tag="Dret_0511"
FT   CDS_pept        621055..621648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0511"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: dvl:Dvul_1734 ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; TIGRFAM: ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67808"
FT                   /db_xref="GOA:C8X0I3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I3"
FT                   /inference="protein motif:TFAM:TIGR00493"
FT                   /protein_id="ACV67808.1"
FT                   /translation="MNVPIVIESTGRGERAYDIYSRLLKDRIILLGTPIDDNVANLICA
FT                   QLLFLESENPDKEINFYINSPGGSVTSGLAIYDTMQYISAPVATLCLGQAASMGAVLLA
FT                   AGEPGMRYALPHGRIMLHQPMGGFQGQATDIDIQAREILRLKSSLNSILSRHTGVELEK
FT                   MERDTDRDYFMGATEAADYGVIDQVLASRREMTG"
FT   gene            621721..622965
FT                   /locus_tag="Dret_0512"
FT   CDS_pept        621721..622965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0512"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="KEGG: dma:DMR_28160 ATP-dependent Clp protease ATP-
FT                   binding subunit ClpX; TIGRFAM: ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; PFAM: ATPase AAA-2 domain
FT                   protein; zinc finger C4 domain protein; AAA ATPase central
FT                   domain protein; Clp ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67809"
FT                   /db_xref="GOA:C8X0I4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I4"
FT                   /inference="protein motif:TFAM:TIGR00382"
FT                   /protein_id="ACV67809.1"
FT                   /translation="MSDDTKHSQDVQCSFCGKSQDNVQRLIAGPDVYICDECIGLCNEI
FT                   IAQDNVSESVEEGQLLPPAEIKEALNDYVVGQDMAKKVLAVAVHNHYKRVYYAGGSDDV
FT                   ELDKSNILFVGPTGSGKTLMAQTLARILNVPFAIADATNLTEAGYVGEDVENILVQLLQ
FT                   NADYDLEKASKGIIYIDEIDKVARKSDSPSITRDVSGEGVQQALLKIIEGTEANIPPKG
FT                   GRKHPQQEFIRMDTSNILFILGGAFVGLEDIIQQRLQGSSMGFGARLVGKKEMSIGDVL
FT                   RQVHPEDLLKFGLIPEFVGRIPVVATLDELSEDDLVHILTAPRNALVKQYQKLFELDEV
FT                   HLRFTNNALKAIATRALAQKTGARGLRNVMETIMLDLMYKLPSMTDVKECVVNKAVVEE
FT                   GKDPMVFYRQAVKTA"
FT   gene            623103..625550
FT                   /locus_tag="Dret_0513"
FT   CDS_pept        623103..625550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0513"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: dvm:DvMF_0112 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67810"
FT                   /db_xref="GOA:C8X0I5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I5"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACV67810.1"
FT                   /translation="MPDTYTTGTGGMQLPVMTLREVVMFPRAIVPLFVGRKASIAAVEH
FT                   ALEQYNKRILLVAQKEPEVETPGQDDLFAMGAICKILQLLRLPDGTVKVLFEGQNRAYW
FT                   RPVEDRFSFEGESVALAEVQMLQENDPDNPEARALIRTTQEAVQKYSKINKQLAQETLM
FT                   AISSIDRPGRLADVIMPHLKVEYTQKQAVLEVQDPLERLEQTYALLEGEIEVSSLERQI
FT                   KSRVKDQMQSNQRDYYLNEQLKAIKKEMGQEDDPQAELDELLERLQAKDMPDHAREKAE
FT                   KEIKKLRQMPPSSAEYTVVRNYIDWILDLPWNHLKQTELDLQQAEQILDEDHYGLEKPK
FT                   QRILEYLAVQTLVEKMQGSILCFVGPPGVGKTSLSKSIARSTGREFVRLSLGGVRDEAE
FT                   IRGHRRTYVGALPGKIIQSLKRAQSNNPVFCLDEVDKMSMDFRGDPSAALLEVLDPEQN
FT                   VAFNDHYLDLDYDLSHIFFITTANYLEAIPAPLRDRMEIIKLSGYLETEKLQIARKFLL
FT                   PKQLHKNGLDPEQVSVSDGALLEVIRRYTREAGVRNLERQIASICRKLAKEKVEGKGEI
FT                   RSSKVTKTSVGSLLGVPDYRYGQREKEPQVGVATGLAWTEMGGELLLVEVALMPGKGKV
FT                   EITGKIGDVMQESARAALSYIRSRSDLFGLRSDFYEGIDVHVHVPEGATPKDGPSAGIT
FT                   LATSLISALLHIPVRNDVAMTGEITLRGRVLPIGGLREKLLAAHRGLIRTVLIPKDNEK
FT                   DLKEVPEAIRRDLEILPVEHMDDVLPLALLDSPAENLFCGRDDENIPLARRLRKEESLP
FT                   PTH"
FT   gene            625767..626282
FT                   /locus_tag="Dret_0514"
FT   CDS_pept        625767..626282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0514"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   sfu:Sfum_1965 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67811"
FT                   /db_xref="GOA:C8X0I6"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I6"
FT                   /inference="protein motif:PRIAM:1.16.3.1"
FT                   /protein_id="ACV67811.1"
FT                   /translation="MLTERMEKALNEQINAEMYSSYLYLAMAAYFEDKSLPGCAAWMKA
FT                   QAQEELFHSMKFFDYVNERGGRVELQAIETPPREWGSVLEVFEASLAHEQKVTSLINGL
FT                   VDLALEVKDHATNNFLQWFVAEQVEEEDSVGAVVDKLKLMGEATGGLFMIDRELGQRTF
FT                   TMPSATEE"
FT   gene            626390..628111
FT                   /locus_tag="Dret_0515"
FT   CDS_pept        626390..628111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0515"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Pyruvate/ketoisovalerate oxidoreductase;
FT                   KEGG: dvm:DvMF_0184 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67812"
FT                   /db_xref="GOA:C8X0I7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I7"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACV67812.1"
FT                   /translation="MHDHDPSVQICIGGEAGQGLVTIGHLLSKALVRDGYWILVSQSYM
FT                   SRIRGGHNTFSIRVGTEPVLSPREDCDVLVALNQDTIEQDGPALTTGGCLVGDTDLDFG
FT                   ELPHLAVPTSDLASKPLYANTAALGVVGGLLGVRPQTLEALLREQFAKKKEEVITSNLG
FT                   VLEAALSWVEENRGDFPPLPAAQPPESSLMLNGSEAVALGALAGGVRFCSFYPMTPATG
FT                   VALNLIAQAEAMGVVTEQAEDEIAAVNMALGASYAGSRVLVPTSGGGYALMTEGVSLAG
FT                   MHELPLVLVVAQRPGPATGLPTQTEQGDLEFVLFGGHGEFPRAVFAPGDIPECFHLTRK
FT                   SMGLAERWQSPVFVLSDQYLADAWQTVSAPELEYEADPPSDSACAQVAADSYERYAVTE
FT                   SGVSPRCLPGQSEALVVNDSDEHTPDGHITEDHAVRVAMVDKRLRKREGLKQEVTPPTY
FT                   TGDPLESGMLLICWGSSKGPVLEAATLLRQAGQRVGVLHFSQVWPLVPETFPVDPAKAQ
FT                   SVVVVEGNATGQFAALLRREMGIEVSGKVLRYDGLPLTAAFIWNQLAEAGMIESGA"
FT   gene            628180..629034
FT                   /locus_tag="Dret_0516"
FT   CDS_pept        628180..629034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0516"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; KEGG: dvm:DvMF_0185
FT                   pyruvate ferredoxin/flavodoxin oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67813"
FT                   /db_xref="GOA:C8X0I8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I8"
FT                   /inference="protein motif:TFAM:TIGR02177"
FT                   /protein_id="ACV67813.1"
FT                   /translation="MGSIEAYGEFDTAWCPGCGNHSILQAVKMALAQSDIAPHEVVFAS
FT                   GIGQAAKAPHYLRANVFNGLHGRALPAATGIKLANPELTVIAESGDGCNYGEGGNHFLA
FT                   AIRRNVNITLLAHDNQIYGLTKGQASPTTETGHTTKAQPGGAPSAPFNPLAVAVSMEAG
FT                   FVARGFSGEQEHLADLIQQAIAHPGFALVDILQPCVSFNTANTYGWYKKRCTKLTADHD
FT                   PTDWAQAMQIARQWGETIPIGLVYHATDRPTFEDHFPVLSKGPLSHPNPGQTTVRDLLA
FT                   TFA"
FT   gene            629063..629623
FT                   /locus_tag="Dret_0517"
FT   CDS_pept        629063..629623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0517"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: sat:SYN_00592
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67814"
FT                   /db_xref="GOA:C8X0I9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0I9"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACV67814.1"
FT                   /translation="MRTARLLCLVAVLLLTSTWVWAASPPQAGDAFPEQALQAPQSEKE
FT                   RAYLGLGPEVEQFRLQDLKAPVIVVEIFSMYCPYCQREAPEVNALFQRIQEEGLGDSIK
FT                   MLGIGPGNSAYEVGIFRDKFSVPFPLFPDRDYTWHKVVGEVGTPYFFVLERDGDQLRVR
FT                   ISHLGPFESPEAFWNRILKATHL"
FT   sig_peptide     629063..629131
FT                   /locus_tag="Dret_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 23"
FT   gene            629707..630300
FT                   /locus_tag="Dret_0518"
FT   CDS_pept        629707..630300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0518"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   sfu:Sfum_2548 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67815"
FT                   /db_xref="GOA:C8X0J0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J0"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACV67815.1"
FT                   /translation="MRKMMVAIGVFVCACLVAGSVPAQVETVYSVGQLKPVDSELKVAV
FT                   GDAAPDFALPDLQGETVRLSSFEGEKNVILSFVPAAFTPVCSDQWPGYDLMQDIFTAHN
FT                   AIILGISADNTPSQYAWVQEMGGVWFPVLSDFWPHGQAASRFGVLRSDGTTERALFLID
FT                   TQGIIRYIDVHDINSRPRLEPLIEALENLSTEAP"
FT   sig_peptide     629707..629784
FT                   /locus_tag="Dret_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            630297..630644
FT                   /locus_tag="Dret_0519"
FT   CDS_pept        630297..630644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67816"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J1"
FT                   /inference="similar to AA sequence:KEGG:Dde_1794"
FT                   /protein_id="ACV67816.1"
FT                   /translation="MSKTALFAFNGEPMCFMHVLLNAWDLHERGETVRVVVEGKATALL
FT                   PELVNETHFMHALYAKVVDAGLLAGACRACSGKMGVLGAVRANNIPLLDEMQGHPAVGM
FT                   YQDAGYRVLMM"
FT   gene            complement(630822..631328)
FT                   /locus_tag="Dret_0520"
FT   CDS_pept        complement(630822..631328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67817"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J2"
FT                   /inference="similar to AA sequence:KEGG:Ppro_0185"
FT                   /protein_id="ACV67817.1"
FT                   /translation="MNRQSVPAAPELLAVDLGLRMGWAQYGANGRLLHYGAHNFGARKR
FT                   LRSGCKWLLNRFPGTQWLVLEGGDASSRVWKAEAERRKIQTLHVGAETWREVLLPSGSP
FT                   QTGAVAKGRADTLARSIIGWSEAKRPTTLRHDAAEAICLGLWGVLEIGWLDEHPFSFPG
FT                   PSQIL"
FT   gene            complement(631422..632537)
FT                   /locus_tag="Dret_0521"
FT   CDS_pept        complement(631422..632537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0521"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: dvl:Dvul_2243 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: queuine tRNA-ribosyltransferase; tRNA- guanine
FT                   transglycosylase, various specificities; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67818"
FT                   /db_xref="GOA:C8X0J3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J3"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ACV67818.1"
FT                   /translation="MTHIGSFQIHHTDGPARSGELVTAHGVVPTPIFMPVGTQGTVKSL
FT                   SPDDLENLGARIILGNTYHLYLRPGDELVARRGGLHRFANWPHPILTDSGGFQVFSLAG
FT                   LRELSEEGVTFRSHIDGSKHFFSPEKVIDIQRNLGSDIMMVLDECVPYGADHAYTEKSL
FT                   QLTTRWAKRCREAYPRGAGDQLVFGIVQGGFFEDLRRQSAEQICALDCEGFAIGGLSVG
FT                   ESKQEMHDILQCTAPLLPSAKPRYLMGVGTPLDILNGIAAGVDMFDCVLPTRNARNGTL
FT                   FTSQGKVNIKRAEYQEDDSRLDPACGCYTCRTFSKAYLRHLYTSRELLSYRLNTIHNLT
FT                   FFLDLVCGAREAIAAGTFASYKKGFEAVYET"
FT   gene            complement(632544..632954)
FT                   /locus_tag="Dret_0522"
FT   CDS_pept        complement(632544..632954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67819"
FT                   /db_xref="GOA:C8X0J4"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J4"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1165"
FT                   /protein_id="ACV67819.1"
FT                   /translation="MTITLTTPALLFPAISLLLLAYTNRFLALGARVRELHSQYRDTPD
FT                   IQLQGQIANLRHRVVLIRNMQILGVSSLFSCVFCMLMLFAGWEILGKLVFALSLVLMMS
FT                   SLTVSLRELQISVRALHLHLSDFDELTPTSNK"
FT   sig_peptide     complement(632889..632954)
FT                   /locus_tag="Dret_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.917 at
FT                   residue 22"
FT   gene            complement(632974..633843)
FT                   /locus_tag="Dret_0523"
FT   CDS_pept        complement(632974..633843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0523"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid- binding ACT
FT                   domain protein; KEGG: dma:DMR_12050 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67820"
FT                   /db_xref="GOA:C8X0J5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J5"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ACV67820.1"
FT                   /translation="MTEALATTARLLITCPDRPGIVAAVTGFLYAHGANINTLDQHTTD
FT                   PEGGTFFMRLEFQTPHLDLSRPALEHAFAEVVAERFAMDWRIAYAADRKKTAVLVSRHE
FT                   HGLMDLLWRWVRGELYTDISMVISNHPDWREAVESFGVPFHHIPVDSASKEEAEQQMLE
FT                   LLDGQADLVILARYMQILSPDFVAAFPQRIINIHHSFLPAFAGADPYRQAAERGVKLIG
FT                   ATAHYVTAELDAGPIIEQDVIRVSHRHTTADLKALGRDIERQVLSRAVKWHLEDKIIPF
FT                   ANQTVVFT"
FT   gene            634002..635711
FT                   /locus_tag="Dret_0524"
FT   CDS_pept        634002..635711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0524"
FT                   /product="ABC transporter, ATPase, predicted"
FT                   /note="PFAM: ABC transporter, ATPase, predicted; KEGG:
FT                   hha:Hhal_1066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67821"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X0J6"
FT                   /inference="protein motif:PFAM:PF09818"
FT                   /protein_id="ACV67821.1"
FT                   /translation="MTTQNHLKNECERLDGKGYGAYKDLRGEYDLGECRVVVDHVQSDP
FT                   YAPPSKVCVVMDRHRAGLPEELLANRVRHIALEDYLSRSVARVIQAEAGDKDRIEVDVG
FT                   RQEILERTAVRIDAQTIELRLAVGLPARGRRILGRQAAYLLSALLPRIALRGLVFSGLD
FT                   EETAFEHVWRAEDQEVLRQRIGELGCVGFVGNGARLARSSGVNDAPMQGEEVVPFSSPP
FT                   ELELAVDLPHAGRVYGMGIPAGVTVIVGGGYHGKSTLLRALERGVYNHVPGDGRDLVVT
FT                   EPTAVKIRAEDGRAVRGVDISPFINALPNKQSTRSFATSNASGSTSQAANIMEALEAQS
FT                   RLLLVDEDTSATNFMIRDSRMQALVAKEQEPITPFLDRIQELYTAFGVSTILVMGGSGD
FT                   YLSEADTVLKLQTYEASVVTEEARAVMDRFPRQRRREISAPLTRRSSRLVASACLALGP
FT                   RDKVRSKGTSQVTFGKSSIDLACVEQLLDPSQTRSVAAILRMLPAFLEPNGGQIREAVE
FT                   EILAQVVKQGVDSLGAKRGRHPGDLAMVRSQEVLAAISRYRRLQLAAEGEGR"
FT   gene            635840..636820
FT                   /locus_tag="Dret_0525"
FT   CDS_pept        635840..636820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0525"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: dat:HRM2_32560 putative sulfate transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67822"
FT                   /db_xref="GOA:C8WYQ6"
FT                   /db_xref="InterPro:IPR022498"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYQ6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV67822.1"
FT                   /translation="MRKCLSLSLGLMAALCLCLAAGPVAAEPSGDVIIFHAGSLTVPFA
FT                   KMEKEFEAAHPEVDILREGGGSTKMARMISDVGKTADIMASADYQVIDKSLIPDFASWN
FT                   VRFASNQLVLCYTDKSQYADEITADNWYEILQRDGVVWGHSDPNLDPCGYRSLMVLQLA
FT                   EKFHDKPGLYDRLIANRPEENVRPKSVELVSLLKTGNMDYAWEYRSVAVQHDLQFVTLD
FT                   DHINLGNYKFDPFYKQAKVEVSGEEPGETMFRTGKSITYGITMTDDAPNPEAATAFLEY
FT                   LFSKEGGLKVLKELGQPPFVPARVPSQKMYDILPTSLQDKVVVKQ"
FT   sig_peptide     635840..635920
FT                   /locus_tag="Dret_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 27"
FT   gene            636877..637695
FT                   /locus_tag="Dret_0526"
FT   CDS_pept        636877..637695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0526"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dal:Dalk_4086
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67823"
FT                   /db_xref="GOA:C8WYQ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYQ7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV67823.1"
FT                   /translation="MLKRDPFSLAVGFSGSTILLFILLPLLQMVVQPSLPDMAETIRDP
FT                   AVRKAIGLSLFTSGMAAVIALVLGTPLAYILARKDFWGKRVVESVIDLPIMIPHPVIGI
FT                   AILSLAGRGHWLGDVLQALGVKLMGTTTGIVVVLTFVGVPFYVNAAKAGFEVVPARLEH
FT                   VARTLGASRSSAFYRVTLPLAFRSLLAGTIMCMARAISEFGAVVIVAYHPMVAPVLIYE
FT                   RFTAYGLKYSQPVAVWLILVSLFLFLLLRIVTARGGGMAGRSGPNLGGRA"
FT   gene            637692..638738
FT                   /locus_tag="Dret_0527"
FT   CDS_pept        637692..638738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0527"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: dat:HRM2_32540
FT                   CysA"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67824"
FT                   /db_xref="GOA:C8WYQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYQ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV67824.1"
FT                   /translation="MIEVQNLDVRLPGFALENISLCVPQGAFGALIGPTGSGKSILLEA
FT                   LAGLQPVKRGQIFNHRGEITRLPPERRGFGLVYQDAALFPHLNVRENLLFARRYTDLAK
FT                   AEVVREMNELSERLGITHLLQRDVRTLSGGETQRVALVRALLVRPSVLLLDEPLSALDP
FT                   VFREEIQYLLQRLHQEMGLTMLMVTHNFEEVVMLAEQVAVIHQGRFLQKGAVQEVFTTP
FT                   RSPFVARFVGMKNLLAATPTQDGVLVAGHVVRTIGPGRETNNQVLGIRPEDVLLAPPHP
FT                   GAPSSNAYPGSISAVTYHGVHCAVRVECALGEVTAHLSPREYRELGCSPGDAVTVILPA
FT                   EKLCSIPA"
FT   gene            638939..640222
FT                   /locus_tag="Dret_0528"
FT   CDS_pept        638939..640222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0528"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: Respiratory-chain NADH dehydrogenase
FT                   domain 51 kDa subunit; Soluble ligand binding domain; KEGG:
FT                   dol:Dole_0306 electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67825"
FT                   /db_xref="GOA:C8WYQ9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYQ9"
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /protein_id="ACV67825.1"
FT                   /translation="MKGETFAGGLRWPASDAGVTESFLTVPLAEKLVVPMGQHDGTPLK
FT                   AGVKKKAELQGGDLLGESETLCLYSPAAGSVTDVIKQFPKLDGTVVPAVAIARGEAESS
FT                   PVVPLEGDAPSELAAKAGIVDSGRSPEPLSTKLMRAKEKGCSTLLINGVEWEAVLSSKR
FT                   SLMRAFPEEIAQGIGVLKDAIGAETVMLAVSTGAEAAAKGVAEAGEGIEVTPLPQKHPQ
FT                   SLDELLVKGLWGKEIPAGRKADDLGILVLDLETALHTKRAVVDKQACQYRYITVTGTAV
FT                   PETTNVAVPLGTPVREVLRFCKIDPTRVAKIAVGGPLMGPPLPDLDMPVTWETNGLYVL
FT                   DRDHVGGGALPEDCFKCGACVRVCPMNLMPFLIAGFSQADSFDLAENNSILSCVECGCC
FT                   AYVCPAQIPMVQWIQLGKSEIRAERSSE"
FT   gene            640219..641166
FT                   /locus_tag="Dret_0529"
FT   CDS_pept        640219..641166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0529"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   pca:Pcar_0262 NADH:ubiquinone oxidoreductase, RnfD
FT                   subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67826"
FT                   /db_xref="GOA:C8WYR0"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR0"
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /protein_id="ACV67826.1"
FT                   /translation="MNTPELVVSAVPHAHSGNTLQKMMRQILLALIPALLIGVAYYGFG
FT                   VVQVAAIAVVSALVWQVLLQKAMHKPVCLANMTTVVSALLLAMIMPPGLPWWAVCVGTL
FT                   TMVLLGMEIYGGYGNNPFNGVLIAWVVLQISFPAAMSSWAYPPGELMTINTPLQVLQED
FT                   GPFFVNEFFSFSDLLMGRTVGFAGQTSALFLLLGGLFLLYRRVITWHIPVSFLAGVVAF
FT                   AGLFWAINAEAHASPLFHLVAGGTMISAFFLATDFPSSPVTKTGMLLYGFSAGVLTVVI
FT                   RIWGQWPDGAFFAVFLMSMLTPLLDKIAPRVYGR"
FT   gene            641171..641761
FT                   /locus_tag="Dret_0530"
FT   CDS_pept        641171..641761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0530"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   dde:Dde_0583 electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67827"
FT                   /db_xref="GOA:C8WYR1"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR1"
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /protein_id="ACV67827.1"
FT                   /translation="MSVREILRMMLVLTVVTAVCGGGLSLVKMATEGQIQYQKLKNVKE
FT                   PALKQVLSGYTNDPLTDRKEIVVGEDERGTPIKRPVFYAKKDGTLISVALEAYGGGYDG
FT                   DIGVMVAFDPDEDTLEGVAVTTHTETPGIGSKVKEDPGFAKQFEGKSIDQSFAPGSGTV
FT                   DAISGATFSSHGVMKAVDKAIEIYKANKSKILG"
FT   gene            641781..642392
FT                   /locus_tag="Dret_0531"
FT   CDS_pept        641781..642392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0531"
FT                   /product="RnfA-Nqr electron transport subunit"
FT                   /note="PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   dde:Dde_0584 electron transport complex RsxE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67828"
FT                   /db_xref="GOA:C8WYR2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR2"
FT                   /inference="protein motif:PFAM:PF02508"
FT                   /protein_id="ACV67828.1"
FT                   /translation="MASVVQEFKKGLWAELPPFRVVLGLCPVLAVTSGVASALGFGCGL
FT                   LFVITMSSVLVSLLRNVIPDKVRVPVFISIIASGVIIVERVMHAYFYGIYEILGIWIPL
FT                   IVVNCLILGRSEAFARKNPVHLAAADALGMGTGFTLSLVVLSSFREIVGAGTWFGAQVM
FT                   PGWYLGFEFLVRPPGAFVCLGIMLGLINVISARLDARKTA"
FT   gene            642419..642994
FT                   /locus_tag="Dret_0532"
FT   CDS_pept        642419..642994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0532"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   pha:PSHAa1105 electron transport complex protein RnfA,
FT                   inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67829"
FT                   /db_xref="GOA:C8WYR3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR3"
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /protein_id="ACV67829.1"
FT                   /translation="MQEYLLMIVSAVFINNIILLQFLGLCPFVGVSNKMDSAIGMSAAA
FT                   MFVNVLASSICWIIQKYVLVPLDLVYLQTLAFIVVIATLVQLVEIVLQKIAPPLYRSLG
FT                   IYLPLITTNCMIFGVAVLNIREEHTFMQAVVYAFSTALGFSLVLIFMAGLRERFTISRI
FT                   PQAMQGFPIALVTACMMGLAFFGLIGLA"
FT   gene            643005..643865
FT                   /locus_tag="Dret_0533"
FT   CDS_pept        643005..643865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0533"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: Fe-S cluster domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dvl:Dvul_0517 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67830"
FT                   /db_xref="GOA:C8WYR4"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR4"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ACV67830.1"
FT                   /translation="MGTITAILAMAGLGLGLSAVLGVAAKVFYVYVDPRIEQVADCLPG
FT                   ANCGGCGYAGCSDYAAAVVRGEVEANKCTAGGEATCTAICECLGLEAAMGERQIAKIFC
FT                   VGTRDAAKSKFVYDGIEDCRAAARLAGGDKACSWGCLGLGTCVKNCPFDAMYMQDNGLP
FT                   GVDPVKCTGCGKCVEICPRDIPKLTPESQSTACLCCSHDMGKVVKSVCSAGCIGCSKCK
FT                   KECPEEAITMDNFLAVVDPAKCTGCGACIEVCPTGVMRSLLPEGQHPMHAVQSETASET
FT                   QEEQV"
FT   sig_peptide     643005..643082
FT                   /locus_tag="Dret_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.634 at
FT                   residue 26"
FT   gene            643862..644317
FT                   /locus_tag="Dret_0534"
FT   CDS_pept        643862..644317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0534"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dal:Dalk_0122 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67831"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR5"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV67831.1"
FT                   /translation="MKLLVAVDPSDYALKIARYVAAVARPDVAVTLFSVLPSVSSKMER
FT                   ELYHPLFAEKMGVLKGLDAQQEQILTKTMEECTKILQQSGIQNVESVTEKKRQGVARDI
FT                   MAKAESENYDTVVVGKRGLSAASAFVLGSVSQKVVNNLKNVTVWVIE"
FT   gene            644412..644789
FT                   /locus_tag="Dret_0535"
FT   CDS_pept        644412..644789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0535"
FT                   /product="positive regulator of sigma E, RseC/MucC"
FT                   /note="KEGG: tgr:Tgr7_1086 positive regulator of sigma E,
FT                   RseC/MucC"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67832"
FT                   /db_xref="GOA:C8WYR6"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR6"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1086"
FT                   /protein_id="ACV67832.1"
FT                   /translation="MRCTCNPVGTQKMAFSAHDAFQAQVGDEVDVAFEATGRKLAMAVL
FT                   YGVPLLAFLLGAIIGNELALFGSADLSGVVLSLTATLAAFIGIRWYSRNRLESDAEYRP
FT                   VVIERYPSPPKTTEDEAPIAS"
FT   gene            complement(644879..645916)
FT                   /locus_tag="Dret_0536"
FT   CDS_pept        complement(644879..645916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0536"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: dps:DP0776
FT                   thiamine biosynthesis lipoprotein (ApbE) [precursor]"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67833"
FT                   /db_xref="GOA:C8WYR7"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR7"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACV67833.1"
FT                   /translation="MSKTASNDVQSTRRSCLKFLGLGALGIATPMLAARPGQAAQDLPQ
FT                   AQSTRPLMGTMVTVTVLDSSRDKAHEAAQSALDTMQALTPVLDRHAPGTPLSELNAQGR
FT                   LKDVPPQLAAVLYQAGYFYTVSQRAFDASILPLLTLTKETFANHGEAPSETAVRRVRDR
FT                   IGFDKVHIGPDGVQLQDGMQLTLDGIAKGHIIDQAANTLQQMGIRYALINAGGDIRALA
FT                   GKGPGAAWRVGIKDPRGRKPFIQTMALNNGALATSGNYEHYFDRNKAHHHIIDANSGHS
FT                   PRAVSSVSVVAPTVAEADALSTTLFVKPRPEAVAFANSLPNTEALLLDDELRETHTQGW
FT                   LGEWA"
FT   sig_peptide     complement(645797..645916)
FT                   /locus_tag="Dret_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.923 at
FT                   residue 40"
FT   gene            complement(646139..647596)
FT                   /locus_tag="Dret_0537"
FT   CDS_pept        complement(646139..647596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0537"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: dde:Dde_2121 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia ; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67834"
FT                   /db_xref="GOA:C8WYR8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR8"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACV67834.1"
FT                   /translation="MQLYNSMTRQKEEFIPQTSGEISLYVCGITAYDYCHIGHARAAVV
FT                   FDVLVRYFRDQNFAVHFVRNFTDVDDKIIKRAAEEHLEADEVAQKYIAAYYEDMERLGV
FT                   QPANFEPKATEHIQDMIGLAENLIAKGHAYATASGDVYFRVRSLPSYGSLSGRELDTMR
FT                   AGARIAPGEEKEDPLDFALWKRAKPEEPSWPSPWGNGRPGWHLECSAMSERFLGLPLDI
FT                   HGGGQDLAFPHHENERAQSLAASGKELARFWVHNGFVQVEAEKMSKSLGNFITIRDILS
FT                   YYLPEVLRYFLVTKHYRSPLDFNWEVMDEAEKGLRRLYQTRQHIAEALSRSNWSKTELP
FT                   SELSAEIDDLDAKWRQNMEDDLNTAGALGHVFTLNRLANRILEDKTWRKAEAGGKLLER
FT                   IQSIFEHIGNVLGLFQQTPDAFLDDLRTQKAKRKGIDTSAVAQLITKRQEARRAKDFTT
FT                   ADSVRQQLEEMGIEVQDTPQGPVWDIL"
FT   gene            complement(647671..648882)
FT                   /locus_tag="Dret_0538"
FT   CDS_pept        complement(647671..648882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0538"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; PFAM: MECDP-synthase;
FT                   4-diphosphocytidyl-2C-methyl- D-erythritol synthase; KEGG:
FT                   dvl:Dvul_1625 2-C-methyl-D-erythritol 4- phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67835"
FT                   /db_xref="GOA:C8WYR9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYR9"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACV67835.1"
FT                   /translation="MSTWTIILAGGSGSRLAEATSGVKKQFLHYLGRPLLWHSAATFAA
FT                   MPSIEGIVMVAPAEELETARALFNECAAQSPLGVPVRWTVGGRRRQDSSAQGLASLPAE
FT                   CRRVLIHDAARPFVSAPLTQRVLDALECFDGVVPGIPVTDTIKQAQQDLVSTTLPRHEL
FT                   FAIQTPQGFRTAALDQAHKTVADHGIDVTDDASMLEYSGGRVGVVAGERSNCKITTAED
FT                   LRMLTASPSTRIPCTGWGYDVHRYGAGRPMKLGGIPITNGPEIIAHSDGDVLLHALMDA
FT                   LLGCLGAGDIGEHFPDTDPRWDNANSSALLTDVLDWCRFNGLILRHVDMTVVCQTPKLQ
FT                   PWKHQIRKTVAALLGLAEHHCNLKATTEEGLGFTGHKEGIKAIVLVTGERETPTHESTF
FT                   PESR"
FT   sig_peptide     complement(648829..648882)
FT                   /locus_tag="Dret_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.466 at
FT                   residue 18"
FT   gene            complement(648921..649293)
FT                   /gene="rnpB"
FT                   /locus_tag="Dret_R0007"
FT   ncRNA           complement(648921..649293)
FT                   /gene="rnpB"
FT                   /locus_tag="Dret_R0007"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam(RF000
FT                   10), score 299.56"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(649371..649508)
FT                   /locus_tag="Dret_0539"
FT   CDS_pept        complement(649371..649508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67836"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67836.1"
FT                   /translation="MGISSTAASGEPVQTAFGILNSIRSFFPVAEESDSVFRDPLCNHG
FT                   "
FT   gene            complement(649495..650232)
FT                   /locus_tag="Dret_0540"
FT   CDS_pept        complement(649495..650232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0540"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; KEGG:
FT                   dvm:DvMF_0258 protein of unknown function DUF164"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67837"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS1"
FT                   /inference="protein motif:PFAM:PF02591"
FT                   /protein_id="ACV67837.1"
FT                   /translation="MSLYMKQIEQLVTLQRVDDEIVKLEQTLEATPKELARLEEKLQTL
FT                   LDQEQKIKDHIDILEKQKSKLETDIEADNSKIKKSKNKLMMVENTKEYHAMLREMDNLE
FT                   KTNRMREEELASLAEDLQTQNNLLQGVNEQVEKMRAQVEDKREHMQSELKEADQQLSGL
FT                   HDQRENAKEVVPTPILKRYEFIRSRLNNPVIVPVAEGICCGCNISIPPQKFNELQRGEQ
FT                   IFNCPNCQRLIYWEEHFPKNGDQ"
FT   gene            complement(650400..651374)
FT                   /locus_tag="Dret_0541"
FT   CDS_pept        complement(650400..651374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0541"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   dma:DMR_17790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67838"
FT                   /db_xref="GOA:C8WYS2"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS2"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ACV67838.1"
FT                   /translation="MRVQDLLAHIETVARPDLAASWDQSGIQIAGTAQHITKMAVTLDA
FT                   VPATVTAALDWGADFILTHHPLSLKPTLPSACDAYHRILRSTLEAGVWMYAAHTSLDAQ
FT                   PNGPVAWLADALGLQQRSVVSPSCTERARVYQIHGLSNGSGLEELPGVFDIRQTGTSEW
FT                   EVTAWPQAEAAISALPARRVHVQEALHPCKVYGFGCAGRLATPVSAERFTEQVAALLNI
FT                   RGWNEIGLRPETLSTVAYCPGSGADFASAAFGAGADVFLTGDVKYHQAQQVESLGWTLD
FT                   VGHFSLEEHMMSSWAERLSEELLDEHIAVAFFPGNNPLTLSTG"
FT   gene            complement(651526..651601)
FT                   /locus_tag="Dret_R0008"
FT                   /note="tRNA-Met4"
FT   tRNA            complement(651526..651601)
FT                   /locus_tag="Dret_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(651687..652595)
FT                   /locus_tag="Dret_0542"
FT   CDS_pept        complement(651687..652595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0542"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dvm:DvMF_0260 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67839"
FT                   /db_xref="GOA:C8WYS3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS3"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACV67839.1"
FT                   /translation="MKKYEVAVVGQGPAGLSAAIYTARAGMSTLVLGCEPKVSGDYDID
FT                   NYFGFPETITGRELLERGKRQAKRFDVQMRCDRVLGIHPTENEEFEIKTETGKVRACSV
FT                   ILATGVSRIRPGIEDLSEYEGKGVSYCVSCDGFFFRNKQVMVVGEGIFAANQALELTQY
FT                   TPHVSVCSQGKPLTMTESFQEKLQEAGIPVKQRKIERVEGNDVLERVIYDDGSEEAVDG
FT                   LFIALGEASSLDFAYSLGVMRNGVFLQVDEEQKTSFPGVFAAGDCVGRFLQISVAVGEG
FT                   AIAGRSAINFVKKQCREKGKS"
FT   gene            complement(652592..653299)
FT                   /locus_tag="Dret_0543"
FT   CDS_pept        complement(652592..653299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: dde:Dde_1833
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67840"
FT                   /db_xref="GOA:C8WYS4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS4"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACV67840.1"
FT                   /translation="MPNELLWIGFALLDLSLVLLVFRLFGRVGLYGLIVFNLVICNIQV
FT                   LKTIHLFGLTTTLGNILYASIFLSTDLLSEFYGKKEAQRGVLLGFCCLILATLYMQIAL
FT                   QFAPGPNDFAQPHLAAIFDFMPRVALGSMAAYLLSQWHDVWAFHAIRAKTGERWLWLRN
FT                   NASTLVSQLIDSSVFCVIAFWGVFPFSVWLEILLTTYLIKALTAGLDTPFIYLAKRLQL
FT                   APQTQTATQGEAR"
FT   gene            complement(653495..653962)
FT                   /locus_tag="Dret_0544"
FT   CDS_pept        complement(653495..653962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0544"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   lip:LI0891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67841"
FT                   /db_xref="GOA:C8WYS5"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS5"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACV67841.1"
FT                   /translation="MNRLKCIWTGAMKKGIWRDAAELYWKRLSGLYTSDSVCVKDGPSH
FT                   LAPGPRKEAEAKAILAKTTPRDRVIVLDERGKSRTSAQLAQDLTGWLEDPARQPCFILG
FT                   GAYGLADQVRDRADDLLAFGPMTLPHELARVVLFEQLYRAATILKNIPYHH"
FT   gene            complement(653959..656049)
FT                   /locus_tag="Dret_0545"
FT   CDS_pept        complement(653959..656049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0545"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; ATP-grasp domain protein; KEGG:
FT                   dde:Dde_2334 succinyl-CoA synthetase (ADP- forming) alpha
FT                   subunit / succinyl-CoA synthetase (ADP- forming) beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67842"
FT                   /db_xref="GOA:C8WYS6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS6"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ACV67842.1"
FT                   /translation="MKCNEHQSKSLFKSCGIPVPQGDLVTPEMAAVYRPDFAPPFMLKA
FT                   QVLRGGRGKAGGIRKVTALQDLPGTLKEIFDMRIGDEAVPLVRVEPAAGIAREFYLSIS
FT                   IQRALAAPVLTVGREGGVDIEASGADNLLIQPLDPCLGLRAHHVRSAFFHLGVDNDHWK
FT                   DFEALVHRLYEAVSHRGVTLAEINPLILTDHDHWLALDGKVELDDNAVELQPELASLYQ
FT                   PEHATDQENTARNAGLSYHTLNGRVGLMVNGAGLAMATMDMLNFAGLPAANFLDVGGGA
FT                   DEERVGAALDLLFGDQRVQTVLINIFGGILSCSKVASALIAALEHREVVKPLVVRFDGH
FT                   GAEEGRQRLRHAGHATVTVVETLQDAMDALTRQTGQSDAAERLLPPQAYPARPPAKGSA
FT                   ALVPPSDPGLAALSPNAPVLVQGLTGREGRLHARLMREYGTNIVAGVTPFKGGGTVDGL
FT                   PVYNSVAEATRHHSIAASIIFVPARFATEAMLEARQAGIPWAVCVTEGIPQAQILPALP
FT                   QLNQGPTRFIGPNTPGFIRPGHMKVGIMPVTAFTPGPVAVLSRSGTLTYECVARLTQAG
FT                   LGQSFCFGIGGDPFVGSSFVDLCALLENDPQTEAVLILGEIGGQAEQDLAAWVQKTGFP
FT                   KPIVSFIAGQTAPPGKKLGHAGAILEGAQSNAEKLESMRAAGFGICPDLASIPEALRQA
FT                   LS"
FT   gene            656324..656917
FT                   /locus_tag="Dret_0546"
FT   CDS_pept        656324..656917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_23250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67843"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS7"
FT                   /inference="similar to AA sequence:KEGG:DMR_23250"
FT                   /protein_id="ACV67843.1"
FT                   /translation="MKVGVQTIRTTVQCWLFVAILTACVAGGVTAAFGQQWQLDNLVLD
FT                   SSQGGHVRVRFGVQCPVEPLKQLLTDEGATVRVGFEAALRRERLLLWEKQEAVARRLYY
FT                   LKSRALSQEYELKGEGLNKPLVGTELAPLLDKAWSTLEMDLGAWHQLQPGSEYVVDLRI
FT                   ECDRADVPVWLRRALFFWSWDVLPPRTYRLRFRY"
FT   sig_peptide     656324..656428
FT                   /locus_tag="Dret_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.610 at
FT                   residue 35"
FT   gene            656921..659116
FT                   /locus_tag="Dret_0547"
FT   CDS_pept        656921..659116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0547"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dde:Dde_3000 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; histidine kinase A
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67844"
FT                   /db_xref="GOA:C8WYS8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV67844.1"
FT                   /translation="MAQDPIRISGPDTRERRRRQRELLLAAGAVGLIVLLTWIELQFFG
FT                   VNSYLFLAFFNLNLILLLLILFLVLRNGVKLLLERRRRVLGARLRTRLVLAFMSLSLIP
FT                   TILMFLVAVRFVQTSVDFWFKSQIESSLDQAVKVGQGYYRQMQNQLETQGVFILESIRR
FT                   REFAWGGEGMDDFLKFKRHEYGLSLVGVLQDDLQQQNWHGSENWEQSWSAFEDSVDWET
FT                   LRQNPRFWSGMRPGPEADLVVGIVPVDEAKTGFLVVGRSMEKGLLRQLDNIIQGMDEYK
FT                   QLKTLKFPLKVALYLILAVMTLLILLGAMWFGFRLAKEISAPVQALAVGTQRIARGDLS
FT                   VRLEDQSSDEIGLLVQSFNKMAGDLEQSQDRLRLANDRLARQNRELEERGRYMEAVLNN
FT                   ITAGVISLDSHGQINTVNAAAETILGTAAEQLVGQNPLELLQGEQAELVQEMLSQLTQA
FT                   PHSQWQRQLDLELGGQVRKLLVNAVVLQTGEGERAGLVAVFEDVTELDKMQRMAAWREV
FT                   ARRIAHEIKNPLTPIKLSAQRLQRKFGDQVQDGVFTQSTELIIRQVEHLQQMVSEFSAF
FT                   AKLPEVHPKRDEITPLVQEVVALFRQSHNTIQWTVEEQDETPPFRFDREAIKRVLMNLL
FT                   TNAAEALQGGNGSTVDISVDCDVSSGWVRLQIADNGPGLSPEERSRLFEPYFSRKKGGT
FT                   GLGLTIVKSLVNDHHGYVRIKPNSPHGSVFVVELPLV"
FT   gene            659170..660528
FT                   /locus_tag="Dret_0548"
FT   CDS_pept        659170..660528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0548"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; SMART: response regulator receiver; AAA ATPase;
FT                   KEGG: dde:Dde_3003 two component Fis family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67845"
FT                   /db_xref="GOA:C8WYS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYS9"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACV67845.1"
FT                   /translation="MQARILVVDDELDIRVSLSGILEDEGHTVMEADSGEAGLTAMAGK
FT                   EIDLVFLDIWLPGMDGLAVLERLRQEWPDIPVIMISGHGTIETAVSAIKNGAHDFIEKP
FT                   LSLEKVVITANKALEFSKLKRENRDLRSRVKTDVVQEISGSSGAIASLRAQIDRVAPTD
FT                   AWVLISGENGTGKEIVARSLHVKSRRAKRPMIAVNCAAIPEELIESELFGHEKGAFTGA
FT                   EQAQRGKFELAHKGTLFLDEIGDMSLKTQAKVLRILQEQSFERVGGRKTLNVDVRVIAA
FT                   TNKDLPQEIQAGRFREDLYYRLKVFPLEVPPLRLRMQDVPDLLQEFVALLSREHGFKPL
FT                   SFTPEALRRLQSYSWPGNVRELKNFVERMLIMYAGDEVGPEHLPGDVEAPMAGGHERGV
FT                   GWDDDFKNARARFEKDFLTQKLEQCGGNVAQTAEQVGLERSYLYRKLKGYGLI"
FT   gene            complement(660714..660790)
FT                   /locus_tag="Dret_R0009"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(660714..660790)
FT                   /locus_tag="Dret_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(660842..661429)
FT                   /locus_tag="Dret_0549"
FT   CDS_pept        complement(660842..661429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0549"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: dvm:DvMF_3031 intracellular
FT                   protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67846"
FT                   /db_xref="GOA:C8WYT0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYT0"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACV67846.1"
FT                   /translation="MATQKILMLVGDYVEDYEVMVPFQILNMIGHTVHAVCPDKKAGET
FT                   VATAVHDFDGAQTYSEKPGHNFTLTASFDSVQESDYDALVIPGGRAPEYIRLNPRVLEI
FT                   VRHFAANDKPIASICHGQQVLAAADVLRNKSCTAYPAVRPDVEQAGGTWVEVNATASNA
FT                   VVDGNLVTAPAWPAHPEWMRRFLEVLGSTIAP"
FT   gene            complement(661521..662399)
FT                   /locus_tag="Dret_0550"
FT   CDS_pept        complement(661521..662399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0550"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: dma:DMR_38390 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67847"
FT                   /db_xref="GOA:C8WYT1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYT1"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACV67847.1"
FT                   /translation="MEQEIAKAKILLESLPYIREFYGQTIVIKYGGHAMKDETLKHAFA
FT                   LNVVLLKYIGLNPVIVHGGGPQIGHMLEQLQIDSQFREGLRITDQATMDVVEMVLVGKV
FT                   NKEIVNQLNLSGGKAVGLSGKDGGLIQARQLEMVISRKDAPPEIIDLGKVGEVVHINTT
FT                   LIDSLQRDGFIPIIAPVGVDAHGETYNINADSVAGAIAAAINAKRLVLLTDVQGILDPA
FT                   GTLISSLTRRQAAEAIDNHVVRGGMIPKVKCCLEAVEAGIEKAHIIDGRVENSLILELF
FT                   TKAGSGSEIVA"
FT   gene            662559..663785
FT                   /locus_tag="Dret_0551"
FT   CDS_pept        662559..663785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0551"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: glo:Glov_2843 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67848"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYT2"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACV67848.1"
FT                   /translation="MLVSQLTKLTLDIQGFRVGRVQGDTSGITVDIAPDRRHLLFCSRC
FT                   GSAAKYRDTLTSRYFRHVPLWGIPVWLRYSPRRVRCGHCGVKVEYFPWSTGKHRFTTAF
FT                   AHFLASWARLLPWKHVAQLFGCSWGTVAAAVDQIVEYGLAHQDLSNLTHIGIDEISREK
FT                   GQVYLTNVYDLNTSRLVWSGEKRTKATITNFFTSLGPSKIDKLEGVCCDMWEPYTQVIQ
FT                   DKAPKATMVFDKFHIVRHLNEAVDQVRRDEIREKGQKHKDLVKDTRYIWLKNPWNLTDK
FT                   QASRLSALEKLNLKINRAYLLKESFRQFWSYECRTSAKDFLDKWFWWATHSRLKPMRNF
FT                   AWMLRRKEENILSYFDMPISNGSVEGLNNKAKVISHRAYGFRSAKNYIRNLYHCMGGLP
FT                   EPQIMHRFV"
FT   gene            complement(663823..664239)
FT                   /locus_tag="Dret_0552"
FT   CDS_pept        complement(663823..664239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dde:Dde_1643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67849"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:C8WYT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV67849.1"
FT                   /translation="MGLILCLVLVLAAGGSSSFRAQASDEPIRLQRIAYDRNATAQTEQ
FT                   LGFVFSRHIIPTLHKLAGDKPRLFFDIAPVTSYTGPEEKKLQGPWLRSVRVFLHEPENR
FT                   LRVVLDVNPETSCSVEQTFVEDKNLFLLTISGVQ"
FT   sig_peptide     complement(664168..664239)
FT                   /locus_tag="Dret_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            664521..664910
FT                   /locus_tag="Dret_0553"
FT   CDS_pept        664521..664910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dret_0553"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dma:DMR_06370 thioesterase superfamily domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dret_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV67850"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtK