(data stored in ACNUC1104 zone)

EMBL: CP001736

ID   CP001736; SV 1; circular; genomic DNA; STD; PRO; 7579488 BP.
XX
AC   CP001736; ABUC01000000-ABUC01000033;
XX
PR   Project:PRJNA21089;
XX
DT   16-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Kribbella flavida DSM 17836, complete genome.
XX
KW   .
XX
OS   Kribbella flavida DSM 17836
OC   Bacteria; Actinobacteria; Propionibacteriales; Nocardioidaceae; Kribbella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-7579488
RX   PUBMED; 21304701.
RA   Pukall R., Lapidus A., Glavina Del Rio T., Copeland A., Tice H.,
RA   Cheng J.-F., Lucas S., Chen F., Nolan M., LaButti K., Pati A., Ivanova N.,
RA   Mavrommatis K., Mikhailova N., Pitluck S., Bruce D., Goodwin L., Land M.,
RA   Hauser L., Chang Y.-J., Jeffries C.D., Chen A., Palaniappan K., Chain P.,
RA   Rohde M., Goeker M., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.-P., Brettin T.;
RT   "Complete genome sequence of Kribbella flavida type strain (IFO 14399)";
RL   Stand Genomic Sci 2(2):186-193(2010).
XX
RN   [2]
RP   1-7579488
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Saunders E., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Pukall R., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Kribbella flavida DSM 17836";
RL   Unpublished.
XX
RN   [3]
RP   1-7579488
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Saunders E., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Pukall R., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (08-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 699171e524ebaf4e280f700bac50d3e4.
DR   BioSample; SAMN02598447.
DR   CABRI; DSM 17836.
DR   EnsemblGenomes-Gn; EBG00001204773.
DR   EnsemblGenomes-Gn; EBG00001204774.
DR   EnsemblGenomes-Gn; EBG00001204775.
DR   EnsemblGenomes-Gn; EBG00001204776.
DR   EnsemblGenomes-Gn; EBG00001204777.
DR   EnsemblGenomes-Gn; EBG00001204778.
DR   EnsemblGenomes-Gn; EBG00001204779.
DR   EnsemblGenomes-Gn; EBG00001204780.
DR   EnsemblGenomes-Gn; EBG00001204781.
DR   EnsemblGenomes-Gn; EBG00001204782.
DR   EnsemblGenomes-Gn; EBG00001204783.
DR   EnsemblGenomes-Gn; EBG00001204784.
DR   EnsemblGenomes-Gn; EBG00001204785.
DR   EnsemblGenomes-Gn; EBG00001204786.
DR   EnsemblGenomes-Gn; EBG00001204787.
DR   EnsemblGenomes-Gn; EBG00001204788.
DR   EnsemblGenomes-Gn; EBG00001204789.
DR   EnsemblGenomes-Gn; EBG00001204790.
DR   EnsemblGenomes-Gn; EBG00001204791.
DR   EnsemblGenomes-Gn; EBG00001204792.
DR   EnsemblGenomes-Gn; EBG00001204793.
DR   EnsemblGenomes-Gn; EBG00001204794.
DR   EnsemblGenomes-Gn; EBG00001204795.
DR   EnsemblGenomes-Gn; EBG00001204796.
DR   EnsemblGenomes-Gn; EBG00001204797.
DR   EnsemblGenomes-Gn; EBG00001204798.
DR   EnsemblGenomes-Gn; EBG00001204799.
DR   EnsemblGenomes-Gn; EBG00001204800.
DR   EnsemblGenomes-Gn; EBG00001204801.
DR   EnsemblGenomes-Gn; EBG00001204802.
DR   EnsemblGenomes-Gn; EBG00001204803.
DR   EnsemblGenomes-Gn; EBG00001204804.
DR   EnsemblGenomes-Gn; EBG00001204805.
DR   EnsemblGenomes-Gn; EBG00001204806.
DR   EnsemblGenomes-Gn; EBG00001204807.
DR   EnsemblGenomes-Gn; EBG00001204808.
DR   EnsemblGenomes-Gn; EBG00001204809.
DR   EnsemblGenomes-Gn; EBG00001204810.
DR   EnsemblGenomes-Gn; EBG00001204811.
DR   EnsemblGenomes-Gn; EBG00001204812.
DR   EnsemblGenomes-Gn; EBG00001204813.
DR   EnsemblGenomes-Gn; EBG00001204814.
DR   EnsemblGenomes-Gn; EBG00001204815.
DR   EnsemblGenomes-Gn; EBG00001204816.
DR   EnsemblGenomes-Gn; EBG00001204817.
DR   EnsemblGenomes-Gn; EBG00001204818.
DR   EnsemblGenomes-Gn; EBG00001204819.
DR   EnsemblGenomes-Gn; EBG00001204820.
DR   EnsemblGenomes-Gn; EBG00001204821.
DR   EnsemblGenomes-Gn; EBG00001204822.
DR   EnsemblGenomes-Gn; EBG00001204823.
DR   EnsemblGenomes-Gn; EBG00001204824.
DR   EnsemblGenomes-Gn; EBG00001204825.
DR   EnsemblGenomes-Gn; EBG00001204826.
DR   EnsemblGenomes-Gn; EBG00001204827.
DR   EnsemblGenomes-Gn; EBG00001204828.
DR   EnsemblGenomes-Gn; EBG00001204829.
DR   EnsemblGenomes-Gn; EBG00001204830.
DR   EnsemblGenomes-Gn; EBG00001204831.
DR   EnsemblGenomes-Gn; EBG00001204832.
DR   EnsemblGenomes-Gn; EBG00001204833.
DR   EnsemblGenomes-Gn; EBG00001204834.
DR   EnsemblGenomes-Gn; EBG00001204835.
DR   EnsemblGenomes-Gn; EBG00001204836.
DR   EnsemblGenomes-Gn; EBG00001204837.
DR   EnsemblGenomes-Gn; EBG00001204838.
DR   EnsemblGenomes-Gn; EBG00001204839.
DR   EnsemblGenomes-Gn; Kfla_R0001.
DR   EnsemblGenomes-Gn; Kfla_R0002.
DR   EnsemblGenomes-Gn; Kfla_R0003.
DR   EnsemblGenomes-Gn; Kfla_R0004.
DR   EnsemblGenomes-Gn; Kfla_R0005.
DR   EnsemblGenomes-Gn; Kfla_R0006.
DR   EnsemblGenomes-Gn; Kfla_R0007.
DR   EnsemblGenomes-Gn; Kfla_R0008.
DR   EnsemblGenomes-Gn; Kfla_R0009.
DR   EnsemblGenomes-Gn; Kfla_R0010.
DR   EnsemblGenomes-Gn; Kfla_R0011.
DR   EnsemblGenomes-Gn; Kfla_R0012.
DR   EnsemblGenomes-Gn; Kfla_R0013.
DR   EnsemblGenomes-Gn; Kfla_R0014.
DR   EnsemblGenomes-Gn; Kfla_R0015.
DR   EnsemblGenomes-Gn; Kfla_R0016.
DR   EnsemblGenomes-Gn; Kfla_R0017.
DR   EnsemblGenomes-Gn; Kfla_R0018.
DR   EnsemblGenomes-Gn; Kfla_R0019.
DR   EnsemblGenomes-Gn; Kfla_R0020.
DR   EnsemblGenomes-Gn; Kfla_R0021.
DR   EnsemblGenomes-Gn; Kfla_R0022.
DR   EnsemblGenomes-Gn; Kfla_R0023.
DR   EnsemblGenomes-Gn; Kfla_R0024.
DR   EnsemblGenomes-Gn; Kfla_R0025.
DR   EnsemblGenomes-Gn; Kfla_R0026.
DR   EnsemblGenomes-Gn; Kfla_R0027.
DR   EnsemblGenomes-Gn; Kfla_R0028.
DR   EnsemblGenomes-Gn; Kfla_R0029.
DR   EnsemblGenomes-Gn; Kfla_R0030.
DR   EnsemblGenomes-Gn; Kfla_R0031.
DR   EnsemblGenomes-Gn; Kfla_R0032.
DR   EnsemblGenomes-Gn; Kfla_R0033.
DR   EnsemblGenomes-Gn; Kfla_R0034.
DR   EnsemblGenomes-Gn; Kfla_R0035.
DR   EnsemblGenomes-Gn; Kfla_R0036.
DR   EnsemblGenomes-Gn; Kfla_R0037.
DR   EnsemblGenomes-Gn; Kfla_R0038.
DR   EnsemblGenomes-Gn; Kfla_R0039.
DR   EnsemblGenomes-Gn; Kfla_R0040.
DR   EnsemblGenomes-Gn; Kfla_R0041.
DR   EnsemblGenomes-Gn; Kfla_R0042.
DR   EnsemblGenomes-Gn; Kfla_R0043.
DR   EnsemblGenomes-Gn; Kfla_R0044.
DR   EnsemblGenomes-Gn; Kfla_R0045.
DR   EnsemblGenomes-Gn; Kfla_R0046.
DR   EnsemblGenomes-Gn; Kfla_R0047.
DR   EnsemblGenomes-Gn; Kfla_R0048.
DR   EnsemblGenomes-Gn; Kfla_R0049.
DR   EnsemblGenomes-Gn; Kfla_R0050.
DR   EnsemblGenomes-Gn; Kfla_R0051.
DR   EnsemblGenomes-Gn; Kfla_R0052.
DR   EnsemblGenomes-Gn; Kfla_R0053.
DR   EnsemblGenomes-Gn; Kfla_R0054.
DR   EnsemblGenomes-Gn; Kfla_R0055.
DR   EnsemblGenomes-Gn; Kfla_R0056.
DR   EnsemblGenomes-Gn; Kfla_R0057.
DR   EnsemblGenomes-Gn; Kfla_R0058.
DR   EnsemblGenomes-Gn; Kfla_R0059.
DR   EnsemblGenomes-Gn; Kfla_R0060.
DR   EnsemblGenomes-Gn; Kfla_R0061.
DR   EnsemblGenomes-Gn; Kfla_R0062.
DR   EnsemblGenomes-Gn; Kfla_R0063.
DR   EnsemblGenomes-Tr; EBT00001575569.
DR   EnsemblGenomes-Tr; EBT00001575570.
DR   EnsemblGenomes-Tr; EBT00001575571.
DR   EnsemblGenomes-Tr; EBT00001575572.
DR   EnsemblGenomes-Tr; EBT00001575573.
DR   EnsemblGenomes-Tr; EBT00001575574.
DR   EnsemblGenomes-Tr; EBT00001575575.
DR   EnsemblGenomes-Tr; EBT00001575576.
DR   EnsemblGenomes-Tr; EBT00001575577.
DR   EnsemblGenomes-Tr; EBT00001575578.
DR   EnsemblGenomes-Tr; EBT00001575579.
DR   EnsemblGenomes-Tr; EBT00001575580.
DR   EnsemblGenomes-Tr; EBT00001575581.
DR   EnsemblGenomes-Tr; EBT00001575582.
DR   EnsemblGenomes-Tr; EBT00001575583.
DR   EnsemblGenomes-Tr; EBT00001575584.
DR   EnsemblGenomes-Tr; EBT00001575585.
DR   EnsemblGenomes-Tr; EBT00001575586.
DR   EnsemblGenomes-Tr; EBT00001575587.
DR   EnsemblGenomes-Tr; EBT00001575588.
DR   EnsemblGenomes-Tr; EBT00001575589.
DR   EnsemblGenomes-Tr; EBT00001575590.
DR   EnsemblGenomes-Tr; EBT00001575591.
DR   EnsemblGenomes-Tr; EBT00001575592.
DR   EnsemblGenomes-Tr; EBT00001575593.
DR   EnsemblGenomes-Tr; EBT00001575594.
DR   EnsemblGenomes-Tr; EBT00001575595.
DR   EnsemblGenomes-Tr; EBT00001575596.
DR   EnsemblGenomes-Tr; EBT00001575597.
DR   EnsemblGenomes-Tr; EBT00001575598.
DR   EnsemblGenomes-Tr; EBT00001575599.
DR   EnsemblGenomes-Tr; EBT00001575600.
DR   EnsemblGenomes-Tr; EBT00001575601.
DR   EnsemblGenomes-Tr; EBT00001575602.
DR   EnsemblGenomes-Tr; EBT00001575603.
DR   EnsemblGenomes-Tr; EBT00001575604.
DR   EnsemblGenomes-Tr; EBT00001575605.
DR   EnsemblGenomes-Tr; EBT00001575606.
DR   EnsemblGenomes-Tr; EBT00001575607.
DR   EnsemblGenomes-Tr; EBT00001575608.
DR   EnsemblGenomes-Tr; EBT00001575609.
DR   EnsemblGenomes-Tr; EBT00001575610.
DR   EnsemblGenomes-Tr; EBT00001575611.
DR   EnsemblGenomes-Tr; EBT00001575612.
DR   EnsemblGenomes-Tr; EBT00001575613.
DR   EnsemblGenomes-Tr; EBT00001575614.
DR   EnsemblGenomes-Tr; EBT00001575615.
DR   EnsemblGenomes-Tr; EBT00001575616.
DR   EnsemblGenomes-Tr; EBT00001575617.
DR   EnsemblGenomes-Tr; EBT00001575618.
DR   EnsemblGenomes-Tr; EBT00001575619.
DR   EnsemblGenomes-Tr; EBT00001575620.
DR   EnsemblGenomes-Tr; EBT00001575621.
DR   EnsemblGenomes-Tr; EBT00001575622.
DR   EnsemblGenomes-Tr; EBT00001575623.
DR   EnsemblGenomes-Tr; EBT00001575624.
DR   EnsemblGenomes-Tr; EBT00001575625.
DR   EnsemblGenomes-Tr; EBT00001575626.
DR   EnsemblGenomes-Tr; EBT00001575627.
DR   EnsemblGenomes-Tr; EBT00001575628.
DR   EnsemblGenomes-Tr; EBT00001575629.
DR   EnsemblGenomes-Tr; EBT00001575630.
DR   EnsemblGenomes-Tr; EBT00001575631.
DR   EnsemblGenomes-Tr; EBT00001575632.
DR   EnsemblGenomes-Tr; EBT00001575633.
DR   EnsemblGenomes-Tr; EBT00001575634.
DR   EnsemblGenomes-Tr; EBT00001575635.
DR   EnsemblGenomes-Tr; Kfla_R0001-1.
DR   EnsemblGenomes-Tr; Kfla_R0002-1.
DR   EnsemblGenomes-Tr; Kfla_R0003-1.
DR   EnsemblGenomes-Tr; Kfla_R0004-1.
DR   EnsemblGenomes-Tr; Kfla_R0005-1.
DR   EnsemblGenomes-Tr; Kfla_R0006-1.
DR   EnsemblGenomes-Tr; Kfla_R0007-1.
DR   EnsemblGenomes-Tr; Kfla_R0008-1.
DR   EnsemblGenomes-Tr; Kfla_R0009-1.
DR   EnsemblGenomes-Tr; Kfla_R0010-1.
DR   EnsemblGenomes-Tr; Kfla_R0011-1.
DR   EnsemblGenomes-Tr; Kfla_R0012-1.
DR   EnsemblGenomes-Tr; Kfla_R0013-1.
DR   EnsemblGenomes-Tr; Kfla_R0014-1.
DR   EnsemblGenomes-Tr; Kfla_R0015-1.
DR   EnsemblGenomes-Tr; Kfla_R0016-1.
DR   EnsemblGenomes-Tr; Kfla_R0017-1.
DR   EnsemblGenomes-Tr; Kfla_R0018-1.
DR   EnsemblGenomes-Tr; Kfla_R0019-1.
DR   EnsemblGenomes-Tr; Kfla_R0020-1.
DR   EnsemblGenomes-Tr; Kfla_R0021-1.
DR   EnsemblGenomes-Tr; Kfla_R0022-1.
DR   EnsemblGenomes-Tr; Kfla_R0023-1.
DR   EnsemblGenomes-Tr; Kfla_R0024-1.
DR   EnsemblGenomes-Tr; Kfla_R0025-1.
DR   EnsemblGenomes-Tr; Kfla_R0026-1.
DR   EnsemblGenomes-Tr; Kfla_R0027-1.
DR   EnsemblGenomes-Tr; Kfla_R0028-1.
DR   EnsemblGenomes-Tr; Kfla_R0029-1.
DR   EnsemblGenomes-Tr; Kfla_R0030-1.
DR   EnsemblGenomes-Tr; Kfla_R0031-1.
DR   EnsemblGenomes-Tr; Kfla_R0032-1.
DR   EnsemblGenomes-Tr; Kfla_R0033-1.
DR   EnsemblGenomes-Tr; Kfla_R0034-1.
DR   EnsemblGenomes-Tr; Kfla_R0035-1.
DR   EnsemblGenomes-Tr; Kfla_R0036-1.
DR   EnsemblGenomes-Tr; Kfla_R0037-1.
DR   EnsemblGenomes-Tr; Kfla_R0038-1.
DR   EnsemblGenomes-Tr; Kfla_R0039-1.
DR   EnsemblGenomes-Tr; Kfla_R0040-1.
DR   EnsemblGenomes-Tr; Kfla_R0041-1.
DR   EnsemblGenomes-Tr; Kfla_R0042-1.
DR   EnsemblGenomes-Tr; Kfla_R0043-1.
DR   EnsemblGenomes-Tr; Kfla_R0044-1.
DR   EnsemblGenomes-Tr; Kfla_R0045-1.
DR   EnsemblGenomes-Tr; Kfla_R0046-1.
DR   EnsemblGenomes-Tr; Kfla_R0047-1.
DR   EnsemblGenomes-Tr; Kfla_R0048-1.
DR   EnsemblGenomes-Tr; Kfla_R0049-1.
DR   EnsemblGenomes-Tr; Kfla_R0050-1.
DR   EnsemblGenomes-Tr; Kfla_R0051-1.
DR   EnsemblGenomes-Tr; Kfla_R0052-1.
DR   EnsemblGenomes-Tr; Kfla_R0053-1.
DR   EnsemblGenomes-Tr; Kfla_R0054-1.
DR   EnsemblGenomes-Tr; Kfla_R0055-1.
DR   EnsemblGenomes-Tr; Kfla_R0056-1.
DR   EnsemblGenomes-Tr; Kfla_R0057-1.
DR   EnsemblGenomes-Tr; Kfla_R0058-1.
DR   EnsemblGenomes-Tr; Kfla_R0059-1.
DR   EnsemblGenomes-Tr; Kfla_R0060-1.
DR   EnsemblGenomes-Tr; Kfla_R0061-1.
DR   EnsemblGenomes-Tr; Kfla_R0062-1.
DR   EnsemblGenomes-Tr; Kfla_R0063-1.
DR   EuropePMC; PMC6430987; 30799497.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001736.
DR   SILVA-SSU; CP001736.
DR   StrainInfo; 677413; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082793
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC      David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Kribbella flavida DSM 17836
CC   Culture Collection ID :: DSM 17836, JCM 10339, KCTC 9580, NBRC
CC                            14399
CC   GOLD Stamp ID         :: Gi02235
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Soil from China
CC   Isolation Country     :: China
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7579488
FT                   /organism="Kribbella flavida DSM 17836"
FT                   /strain="DSM 17836"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:479435"
FT   gene            342..2156
FT                   /locus_tag="Kfla_0001"
FT   CDS_pept        342..2156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: gsu:GSU0000.1 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29132"
FT                   /db_xref="GOA:D2PQE5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQE5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADB29132.1"
FT                   /translation="MAGDRDEVAPAGLTARPTGHRSDGFGEQRVVEDQSASAGGRAEVK
FT                   DLDEAWTRVLAGLPPNQRAWLTNSRPVTLHESTAIVAVPDDFTRGQLETRLRPDLERIL
FT                   SESFGRDIRIAVTVDPSLDPELREPAPQQPVQEPVRQSMPLHQPPQYQQHQSGQLQPSQ
FT                   QQQPAYGQPSPQRHDQYQQPAPTPQQPEQRSQHAQPSQPLQTEGSYQPTIQSALSAPDA
FT                   IGQHNHPLHQQVQQPLGSVAPPPNGSAPSQTATEAHGEARLNPKYTFETFVIGSSNRFA
FT                   HAAAVAVAEAPGKAYNPQLIYGDSGLGKTHLLHAIGHYVRSLYTGARVRYVSSEEFTND
FT                   FINAIRDDKASQFQRRYRDVDVLLIDDIQFLEGKIQTQEEFFHTFNTLHNANKQIVISS
FT                   DRAPKRLEALEDRLRNRFEWGLITDIQPPDLETRIAILRKKAATERLTAPPEVLEFIAS
FT                   KVQTNIRELEGALIRVTAFASLNRQPVDLSLAEIVLKDLIPEGSKPEVTASMIMGQTAS
FT                   YFGLSIDDLCGSSRSRVLVTARQIAMYLCRELTDLSLPKIGQQFGGRDHTTVMHAERKI
FT                   RQLMSERRSVFNQVTELTNRIKHQAKQQ"
FT   gene            2689..3834
FT                   /locus_tag="Kfla_0002"
FT   CDS_pept        2689..3834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: abo:ABO_0002 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29133"
FT                   /db_xref="GOA:D2PQE6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQE6"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADB29133.1"
FT                   /translation="MKFRVERDVLAESVAWAARSLPSRPSVPILAGLLVEAEEGQITLS
FT                   GFDYETSVRVTVPAQVADTGKCLISGRLVADISKSLPNQPVDIAVDGAKAQVTCGSSRF
FT                   TLQTLPTEEYPALPDLPAASGTVRSDVFAQAVSQVVTAAGREDTLPVLTGVRVEIEGST
FT                   ISLLATDRYRLAIRELEWNPQSPDASAAALIPARVLSETAKAMTGTDIIVSLAAPGSGD
FT                   GIVGFEGEVSGGNRRATTRLLDGEFPKVRGIIPTDSAIATRVRLDTATLVEAVKRVALV
FT                   AERNAPVRLTFSEDSVTLDAGSGDEAQASESIEARVVGEPVTVGFNPTYLLDGLNAIGT
FT                   PVAHLAFTQATKPAELTGVTDFDGDPIAEFRYVLMPVRLNS"
FT   gene            3881..4795
FT                   /locus_tag="Kfla_0003"
FT   CDS_pept        3881..4795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: xcv:XCV0741 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29134"
FT                   /db_xref="GOA:D2PQE7"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQE7"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADB29134.1"
FT                   /translation="MELGLVGLGKMGGNMRQRIRNGGHTVIGLDHNQDISDATDTADMV
FT                   GKLTAEGQPRVVWVMVPVQAIDPVVNELAELLSPGDIVIDGGNSRWTDDTRRSALLAEK
FT                   GIKFVDCGVSGGVWGLENGYALMVGGEAETIATLMPIFTALKPEGDFGFVHAGKVGAGH
FT                   FTKMVHNGIEYAIMQAYAEGFELLEAADIVDSVPEAFESWREGTVIRSWLLDLMVNALK
FT                   DDTHLDKIRGYAEDSGEGRWTVEAAIDHAVPVPAIAASLFARFASRQEDSPAMKAIAAM
FT                   RNQFGGHAVKGAEDPSYATPPQH"
FT   gene            4797..5936
FT                   /locus_tag="Kfla_0004"
FT   CDS_pept        4797..5936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: gme:Gmet_0003 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29135"
FT                   /db_xref="GOA:D2PQE8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQE8"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADB29135.1"
FT                   /translation="MYVTALGLLDFRSYQQAEVELTPGVTAFVGPNGHGKTNLVEAIHY
FT                   TATLGSHRVATDAPLVRAGAPRAIVRTEVRGQYERDVVIELEINPGKANRARINRSPVP
FT                   RPREVLGLLRTVLFAPEDLALVKGDPSERRRFLDELLTLRTPRMAGVRQDYDRVLKQRN
FT                   SLLRSASMARRQNRGAAAEGQLRTLEIWDANLARTGAELLATRLELLEALRPLVAGGYD
FT                   AVARGKGDARLEYKSSVRLEPGVTSREQLAEVLLATVHEKRADELDRGVSLVGPHRDDV
FT                   LLGLGDLPAKGYASHGESWSFALALRLASYELLRADGGEPVLILDDVFAELDTQRRDRL
FT                   AELVAPAEQVLVTAAVGADVPEELSGVRFAVGDGSVQRA"
FT   gene            5929..6513
FT                   /locus_tag="Kfla_0005"
FT   CDS_pept        5929..6513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   geo:Geob_1482 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29136"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQE9"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADB29136.1"
FT                   /translation="MPEPRNSSESGNESEPLPVLPAEEPEHDKHGLDLAKSLAGRLKGA
FT                   AAANGPTRPVLRRRRRRGIDGTQVSGARPDDRDPQRLTATLGRLMRDQGWEVDVAVHGV
FT                   MARWPSIVGPEMAEHCKPESYEDTQLTVRTDSTAWATQLKMLAPDLIRRLNAELGDGTV
FT                   THVNVQGPHAPSWRKGPRTVRGGRGPRDTYG"
FT   gene            6769..8091
FT                   /locus_tag="Kfla_0006"
FT   CDS_pept        6769..8091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB1601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29137"
FT                   /db_xref="GOA:D2PQF0"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29137.1"
FT                   /translation="MLTLVDGFREMVHLIGDTFRLWWRNLLPLATWFLAGYVGFRASIN
FT                   GAIWLSQHQHKSLAFGLFSAGLLIQIAASVGMIRTCATSLYRWRAAAEDQSEETSDPTQ
FT                   QNLMELLSVTLLPLVAVWSAWGFLEQAISELSVSTLVQLGTGPGTQFFEIGGDAWRGYL
FT                   PAIVILLVLRRVVEAIDDRWPSRPAKFVQVWAEAFFLLLTVLVVPRAIDQLKGWLEVRN
FT                   FWVVTVDWWGDVKDFFEGINVPVPAGLEFLWGFFWETLWPLFKEGVGEPLTWLAITTVV
FT                   FGHRVLSGSSVLRGTRLERRLGGEVVVQPPQNRIVALTNKAPNLVLGGLREKFYPTLNA
FT                   FRLLVRVGPVFLGVVCLVYTFWTLGDNWSQYSVMHLIGVHGERWGLMNYEIADLVASII
FT                   FETLRIALLAAAFDLCISVGAQRRAEAAASTGIPEGEPVRS"
FT   gene            complement(8143..8703)
FT                   /locus_tag="Kfla_0007"
FT   CDS_pept        complement(8143..8703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29138"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29138.1"
FT                   /translation="MKVSDRVFRLTAQVALLLTLLALSAFLLLRTYLGDEEQVWNDGAV
FT                   TEVVERGPVTIDKVTWQVESMQPYARLADEQRKEIPVDGLTAGAVVVLVKVKLTPLDGL
FT                   RMGGGGFTCEASLRDDRGNVWKSVEVFRLPLTTYCSNDDKPLKRNQANEVAKVFVVPAS
FT                   AVEHLNGIQVETRQDFRRVLITF"
FT   sig_peptide     complement(8599..8703)
FT                   /locus_tag="Kfla_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.449 at
FT                   residue 35"
FT   gene            complement(8700..9290)
FT                   /locus_tag="Kfla_0008"
FT   CDS_pept        complement(8700..9290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29139"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29139.1"
FT                   /translation="MRLYRPATVIVGVLFVLLGGVVRLADPDQVFDDSTRVVTEGTVGT
FT                   DLKYGDSTFTITRVKFARSFVTGTDDKAVTTEGVFVAVEYDAVRGPGKPARTETTLTAD
FT                   GGSVYAPVSQIIASAIDFPEPGFARTGTFVYEVNPSDLAGLTFRAKPTQLFNSLAQELA
FT                   VDLGVPSEQIAERSVDNAADQYNVQKDSIRVAS"
FT   sig_peptide     complement(9213..9290)
FT                   /locus_tag="Kfla_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.699 at
FT                   residue 26"
FT   gene            complement(9287..9919)
FT                   /locus_tag="Kfla_0009"
FT   CDS_pept        complement(9287..9919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29140"
FT                   /db_xref="GOA:D2PQF3"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29140.1"
FT                   /translation="MESLDDVIDAMIADRVIHRHRRKWLIALAVVVVLALVITVTGGWK
FT                   EHQGRSIPTVEAPVTVEAGRFEFGFTSAKIIRRPKTEYGKAETWLQISFDLKNIDEETK
FT                   TSYFVPGDLLRLVPGGGQEPIESNGASCQGELGYVTVYGLPAQPCTAKFDVPVDFAAEK
FT                   VEIGVLGEQYTAPDEVTGASGKPYWHDETAVTVVRIPATIETEKEDS"
FT   gene            10260..12296
FT                   /locus_tag="Kfla_0010"
FT   CDS_pept        10260..12296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0010"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pca:Pcar_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29141"
FT                   /db_xref="GOA:D2PQF4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADB29141.1"
FT                   /translation="MTDEPTETDAIPSADDTGTEVPLSVIPSSVVEKEYDASAIQVLEG
FT                   LDAVRKRPGMYIGSTGERGLHHLVYEVVDNAVDEALAGYCDKIVVTLLADGGVRVVDNG
FT                   RGIPVDIVESEGKPAVTVVLTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSSRLQVDV
FT                   RKNGKAYTQSFTVGVPDADLAEVGTSDSNGTTITFWPSPDVFETTTYSYETLSTRFREY
FT                   AFLNKGLELVIRDERPDHTPEGVPVEQSFKYDDGLVDYVKYLTGIRETVHSNVIAFEAA
FT                   QADDSLSLEVAMQWSGSFQESVHTFANTINTHEGGTHEEGFRAALTSLVNSFGEDQGMI
FT                   KKKEDRLTGDDVREGLTAIISVKLGNPQFEGQTKTKLGNTEVKGFVQRVVNDRLGAWFE
FT                   QNPAEGREIIRKATAAASARIAARKARDLARNRKGLLGGGGLPGKLSDCQSTNPEECEV
FT                   YIVEGDSAGGSAKGGRDPKFQAILPIRGKILNVEKARIDKVLQNNEVQAIISALGTGIH
FT                   EDFDEEKLRYHKIVIMADADVDGQHIRTLLLTLLFRFMRPLIERGHVYAAQPPLYKIRW
FT                   SNSAHELAYTEREKDGLLAAGFEAGKKLPKENATQRYKGLGEMNPQELWETTMDPANRV
FT                   LLQITLDDAARADETFATLMGDDIEARRNFIQRNAKDVRFLDI"
FT   gene            12400..15123
FT                   /locus_tag="Kfla_0011"
FT   CDS_pept        12400..15123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0011"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gsu:GSU0004 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29142"
FT                   /db_xref="GOA:D2PQF5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF5"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADB29142.1"
FT                   /translation="MTETPISPGHDRIEPLDLQTEMQQSYLDYAMAVIVGRALPEVRDG
FT                   LKPVHRRILYAMYDGGYRPDRGFSKCSRIVGDVMGQYHPHGDSAIYDTLVRLAQPWVMR
FT                   APMIQSQGNFGSPGNDPAAAMRYTECRLAPLAMEMVRDIDQETVDFRPNYDGRSQEPVI
FT                   LPSRFPNLLVNGSAGIAVGMATQIPPHNLREVAAAANWCLENPDASQEEVLAACMEHIK
FT                   GPDFPNGALIVGYKGIDDAYRTGRGSVTMRAVVDIEEDAKGRTSLVVSELPYMVNPDNL
FT                   AQKIAELVNTGKMTGIADIRDDTSSRTGQRLVIVLKRDAQPRVVLNNLYKHTQLQDTFG
FT                   CNMLALVDGVPRTLSLDLFITHWIDHQIEVIQRRTRYRLREAEKNAHVFRGYVKALDAL
FT                   DEVIALIRRSPDVDEARQGLISLLDIDEIQAQAILDMQLRRLAALERQKIIDRLNELEA
FT                   VIADLEDILADPVRQRHIVRDELAEIVDKFGDDRRTTIIAADGDLSVQDLVPDEDVVVT
FT                   ITRGGYAKRTKTDLYRVQNRGGKGVRGATMRAEDEIGHFFATTNHHWMLFFTTKGRVYR
FT                   AKVWQLPESARDAKGSHVAGLLSFQPDEEIAQVLTLRDYDQADYLVLATKKGLVKKTPL
FT                   RDYDSARQSGIIAVNFREADDELIGADLASAEDDLLLVSKKGQSIRFTANDEQLRPMGR
FT                   ATSGVTGMKFRAGDELLSMSVIRAGSEEDTQFVFTVTDAGYAKRSRVSEYRQQGRGGLG
FT                   IKAVKLNDERGSLVGALIVVDSDQVLAIKTSGQVVRSRVDSVPVKGRDTMGVRFAGVGA
FT                   SDAVVAIARNTDLTVADELDAAAGTDALVVDGVVQDEAGSLDGVVVDSGEVDGAQDVDG
FT                   STTEPAPESVQNDDQHSTDVEGPATVEDDDAGQKGI"
FT   gene            15123..16067
FT                   /locus_tag="Kfla_0012"
FT   CDS_pept        15123..16067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29143"
FT                   /db_xref="GOA:D2PQF6"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29143.1"
FT                   /translation="MTNRARPNWPDGTGSAKSPRPPQGGNGKAPATPPATPASNGRANG
FT                   SPPRPGTPGGQQPADRRPSQQRPAAAGQAAAPASVKGKPARPPQQPPVRPATQTPVAPS
FT                   TPGRPEPRPAAPSAPGAVGAVGASAATPEYGQTAKVSTPAGKQGESFGDKMNAAKQAVL
FT                   EKAAAVKDAAADKARPVDTPEPAPRARGQVRKARLRLSRIDPWSVMKTAFLLSIAFGIV
FT                   TWVAVFIVWSAIGAAGVFENINNTVSEVLGTPTAEPFRIENYINTGKVMGFTTLLACAD
FT                   VLIITALATLGSFLYNVAATLLGGLEVTLASED"
FT   gene            16186..16262
FT                   /locus_tag="Kfla_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            16186..16262
FT                   /locus_tag="Kfla_R0001"
FT                   /product="tRNA-Ile"
FT   gene            16298..16429
FT                   /locus_tag="Kfla_0013"
FT   CDS_pept        16298..16429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29144"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29144.1"
FT                   /translation="MLKKFLLVLLASVGGYFVYKKTQQSRAEQDLWAEAVDPVTPGR"
FT   sig_peptide     16298..16360
FT                   /locus_tag="Kfla_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.688 at
FT                   residue 21"
FT   gene            16443..16518
FT                   /locus_tag="Kfla_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            16443..16518
FT                   /locus_tag="Kfla_R0002"
FT                   /product="tRNA-Ala"
FT   gene            16542..16703
FT                   /locus_tag="Kfla_0014"
FT   CDS_pept        16542..16703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29145"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29145.1"
FT                   /translation="MAADFHASNPASNLESRALRVPHPLPQAGPVVGRELVAGVSQVVG
FT                   MGQVWRSS"
FT   gene            16738..17301
FT                   /locus_tag="Kfla_0015"
FT   CDS_pept        16738..17301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0015"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ara:Arad_0162 acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29146"
FT                   /db_xref="GOA:D2PQF9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQF9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29146.1"
FT                   /translation="MTPIEWPVRTERLSLRGYTRDDLAALWAYEQLPQVQHWLGWAPRT
FT                   RDELRDAMEDKSSNTTHVMVRLASTVIGHVMVMPRDSWAQTDVAIRAEGLEAELGWMFD
FT                   PTYGGQGYATEAVRATIELCFDQLKLRRVHAGCFADNTASWRLMERLGLRREEHSRSTA
FT                   LHRDGTWHDGFTYALLREEWLTSP"
FT   gene            complement(17691..17957)
FT                   /locus_tag="Kfla_0016"
FT   CDS_pept        complement(17691..17957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29147"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29147.1"
FT                   /translation="MIEGAAILLVGLVTGYLAGRRSRRPEPLTGAAVCSCHHPRGQHLD
FT                   GKGPCQADNKQSVNGVQVFLSCPCQLYDGPEPLPQFYAPEIQP"
FT   gene            18069..18491
FT                   /pseudo
FT                   /locus_tag="Kfla_0017"
FT   gene            complement(18640..19239)
FT                   /locus_tag="Kfla_0018"
FT   CDS_pept        complement(18640..19239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0018"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bid:Bind_0017
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29148"
FT                   /db_xref="GOA:D2PQG1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29148.1"
FT                   /translation="MDMTKRPYHHGDLRAALLERAENVLRERGSTALSLRELARDIGVS
FT                   PGAPSRHFANKQALLDALALDGFERLVADIAASDKEAGPAFAERLNAMARAFVGFCLSN
FT                   AALVDLMFSAKHSPEASPALGAAAQRWIAQGLALVSEGQRRGEVREGSLEQVALTVFAP
FT                   LQGYVGLAVSGVPLPETADRGLDDVIESIVRGCRPD"
FT   gene            19331..20272
FT                   /locus_tag="Kfla_0019"
FT   CDS_pept        19331..20272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0019"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_0720 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29149"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29149.1"
FT                   /translation="MPRIPLNFTVPDLTGQRAVVTGASDGIGLGIATRLAAAGAEVVLP
FT                   VRNRRKGEAAVAAIRQAAPAAAVSLLDLDLSSLDAVAALGDTLRQAGRPIHLLVNNAGV
FT                   MTPPDRQTTDDGFELQFGTNHLGHFALVAQLFPLLRAGRARVTSQISIAANRGAINWAD
FT                   LNWDRSYNGMKAYRQSKITFGLFALELDRRSRAAGWGITSNLSHPGVAPTNLLAARPEV
FT                   GRDHETLGRKLISALSARGILLGTVESAGFPALYAATSTEAEGARLYGPSGPGHVGGPP
FT                   AEQKLYSPLSNLEEARRVWQLSEELTKVSLPA"
FT   gene            complement(20580..21191)
FT                   /locus_tag="Kfla_0020"
FT   CDS_pept        complement(20580..21191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0020"
FT                   /product="Uncharacterized low-complexity protein-like
FT                   protein"
FT                   /note="KEGG: bbt:BBta_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29150"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG3"
FT                   /inference="protein motif:COG:COG1357"
FT                   /protein_id="ADB29150.1"
FT                   /translation="MADRLHGRPAPATDSTVRDWDDADPSGQTYTRVLFIDSDLTEVAN
FT                   TGGVFEQCTFRGVRFNASTHTDAAFVNCTFVRCSFFDTTFTRCKLMGSFFDDCTYNLLK
FT                   VEAGDWSFAGLPGADLRATEFRGVKLREADLTGVRAAKAVLRDVDLSGAMLHRADLTGC
FT                   DLRGSDLSSLDPLTVELRQAVIDLPQAMVIAQALGLDVRP"
FT   gene            21356..22246
FT                   /locus_tag="Kfla_0021"
FT   CDS_pept        21356..22246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0021"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; dTDP-4-
FT                   dehydrorhamnose reductase; Male sterility domain; KEGG:
FT                   rpe:RPE_3508 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29151"
FT                   /db_xref="GOA:D2PQG4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB29151.1"
FT                   /translation="MVFGAGGFLGSRICALLDERGIEHRGMSRSTGDPHRQFDLAEGHC
FT                   YALDALLSLYKPTVIVNAAGATQGDAVELTRGNVVAVEALLAAMHRTANNARFLHIGSA
FT                   AEYGGAPRGTSQDEQFEPGPGAAYGLTKLAGSELVLRAQRNGADAVVLRSFNISGPGSP
FT                   ASTLLGRVVRQLGTTDTLETGSLEAWRDYVDVRDVAEAVFAVATTEEKPPPVLNVGSGQ
FT                   ATLAREVVHRLVELSGTDTKVVEGQVHDGHAGSPADTVPWQQADTTLIEKQFGWSCQVS
FT                   LDQSLTDTWAGREQD"
FT   gene            22303..23064
FT                   /locus_tag="Kfla_0022"
FT   CDS_pept        22303..23064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pag:PLES_04651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29152"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29152.1"
FT                   /translation="MCEAAPDREPAGGNEDLALVGPDFVVVLDGATAPRGVDSGCRHDV
FT                   AWLVRRLGAELATPLVGRSVAPLPDLLADAITAVGASHANHCDLTNPDSPSSTVSMVRV
FT                   GPDVVEHLVLADSPVVLRAPDGRVTLVADDRIDHLPEYTLESVRRLRNQPGGFWVASTE
FT                   PKAAYEAVRGATERDQVEVFAVLSDGASRYAERYGHSWQELVAVLEASGPRGLVDRVRA
FT                   YDTAAAIGSFRGKRHDDATAVLCRLGRRAEG"
FT   gene            complement(23126..24340)
FT                   /locus_tag="Kfla_0023"
FT   CDS_pept        complement(23126..24340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29153"
FT                   /db_xref="GOA:D2PQG6"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29153.1"
FT                   /translation="MSQPYPGPGQYQGHAQHVGQFQGGYPLPGTSRAKYRSMRRLTLVT
FT                   IALMAATTVVSGIQAVLLWSSYDEVKSLVYGLLSDEEIERGAQAVAGSGTMLNLLGYAF
FT                   LAAGIVVMVWVRQARENTEVLNPLHGTYQGVPAQGVHRHSPGWVVGSWICPIVQFWYPL
FT                   QVVEDVVRASEPPNQPGVARSGQVRGLLYGWWAAWVAFCVIAVGGGAYAVVSFIGWVVR
FT                   LVDRADAASASGDYVDIYDLQDYLVRLALGVNIGFTVGTVLLVIAGTMLSLLLLRVSGW
FT                   YDARMPATGVPLGPPLPATSPSYLRPQDTTPQYAPRPSQALPGAQDPRGFGYQAPATWT
FT                   GGQGLHQPGPYGPGGYGGTTGSSPNAPLPPYSTGPQAPRADHPEPPTPTRESGPHTDSP
FT                   GGTGR"
FT   gene            complement(24444..25985)
FT                   /locus_tag="Kfla_0024"
FT   CDS_pept        complement(24444..25985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0024"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rme:Rmet_5444 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29154"
FT                   /db_xref="GOA:D2PQG7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADB29154.1"
FT                   /translation="MISVGNASLNAARRAKELDWLDTHRKVDVLVVGGGVTGTGVALDA
FT                   AARGLTVALVEKHDLAFGTSRWSSKLVHGGLRYLASGHVGIAYESAVERGILMKTTAPH
FT                   LVHPVPQVAPWLPGARFAQAAMLRSAFLGGDVLRTFAHTSDDYLPHSRRVSSAEVLRYA
FT                   PTVAPNGLRGGFLTWDGQLYDDARLVVAIARTAALYGARVLTRCAAEQVTGRGAVVVDQ
FT                   LTGRRIDVDARVVVNAGGIWADQVAAGIKLRPSRGTHLVLPQSAFGGLSAVLTVPVPGQ
FT                   VRRVVMAIPAPDDRVYVGLTDEEAPGPVSDVPVATDAEIDFLLGTINTAVREPLTRADL
FT                   LGTYAGLRPLLDTGHHRGEDKSADISRRHAVITSPDGVVTIVGGKLTTYRRMAQDALDT
FT                   ALAQSSLEVRRPCLTHRIPLVGAADRVQLAAVRAPARFVQRYGVEAPDVIAGDPALLAP
FT                   VAPGLATTHAEFRFAVRHEGALTEDDLLDRRTRLGLSAADRAMALPAAQAAFASV"
FT   gene            complement(25982..26635)
FT                   /locus_tag="Kfla_0025"
FT   CDS_pept        complement(25982..26635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0025"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sml:Smlt3985
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29155"
FT                   /db_xref="GOA:D2PQG8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29155.1"
FT                   /translation="MSQRSSDFASAATGTDPAPTGRPAPANAIGEQRILDAAYELLLAI
FT                   GMRRMTMADIARHAEVSRATLYRRWPNVQAVVAALMTREWTTALVSAFQPDAVDGRARL
FT                   VEGVVEVVAKTRTHPLMRKIIELDPEFLTPYLLERRGSSTVAHLALVAEGIKAGQADGS
FT                   IRAGDPDWLSRQIILVSLASAVSGPVLATADEYPRLDDELRTMLTRYLVPDPTP"
FT   gene            26753..28567
FT                   /locus_tag="Kfla_0026"
FT   CDS_pept        26753..28567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0026"
FT                   /product="Alkylglycerone-phosphate synthase"
FT                   /EC_number="2.5.1.26"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pla:Plav_1669 alkylglycerone-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29156"
FT                   /db_xref="GOA:D2PQG9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQG9"
FT                   /inference="protein motif:PRIAM:2.5.1.26"
FT                   /protein_id="ADB29156.1"
FT                   /translation="MSESDLPVVQLTPGRWGDPARTVELPAAALAALQHLGVRRPAAPV
FT                   EGKESEGPGADEPTAGPGGGAGGNAGGGAGGNAGGGAGGSAGGGAGDKARGVFAGPPGG
FT                   EGVRFGSEESRVGWGQPGDVPEVGARAVADRAVLGALVEVLGDKWVRADWEARWGHTRG
FT                   YSTADLLKFRAADRADVPAAVVYPGSHDDVLRLLERCAADRIAVVPYAGGTSVVGGLAP
FT                   SRRFVAVDLSRLDQLVELDEVSRTARLQAGVRGTAAEAMLAERGYTLGHFPQSYEGASI
FT                   GGYAATRSSGQSSAGYGRFDQMVVGLTVATPRGTIELGRAPMSAAGPDLRQLWLGSEGA
FT                   FGIITSVVVRIRPRPVERFFEGWRFGTFEQGLDAIRRLAQDGPLPTVLRLSDEAETAVN
FT                   LADPDVLAGGAGGVLAIVGFEGSATAVRRAAVAEVLTAAGGESAGPGPGETWRQGRYRA
FT                   PYLRDPLLDEGALVETVETAGFWSKVPELKTAVTAALVKSLSESGTPPLVLCHVSHVYE
FT                   TGASLYFTVVCAQTDDPLAQWRRAKTAANEAIGRAGGTITHHHGVGTDHREAYQEEIGP
FT                   LAVEALQAVKRVLDPAAVLNPGILLPER"
FT   gene            28679..30910
FT                   /locus_tag="Kfla_0027"
FT   CDS_pept        28679..30910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0027"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   KEGG: bvi:Bcep1808_4773 parallel beta-helix repeat-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29157"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH0"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ADB29157.1"
FT                   /translation="MPPSAPRRPGRRFAVLAIALTTATTGTGLSATAVGSHQLIALQPA
FT                   AVQAVGASLPFTIVEAENSATNGTRIGPSYAQGTLAAEASNRQAVTLNSGQYVEFTAPA
FT                   TTNAITVAYSVPDGRAGSLSVYVDGQKLTQQLAVTSRYSFLDTSWIAGSRTHKLYDHAR
FT                   LQLGRTVGAGAKIKLQVDGENTAGPYTIDDVEFEQVAGAAARPAGSIAITDRGADPSGA
FT                   GDSTGAVQQAIDAARGSGGVVWIPPGRYRVGGTINPDGVTIRGAGHWHSVLLSHHLIDR
FT                   PNGAGNVRLHDFAVIGDVTERNDHSPDNFVNGSLGPNSVVSGLWLQHLKVGLWLTGNND
FT                   NLVVENNRFYDLTADGLNLNGTAYNAQVRNNYLRNTGDDALAAWSLHAANRSSVFANNT
FT                   IVQPNLANGIAIYGGTDLTVRDNLIQDTNPLGGGIAISNQSFGSPFFPLAGTITVSGNT
FT                   LLRTGAMNPNWGQNHPHGALRVDAYDSPINAQVRLTGNRIVASPWSAYQFVDGGGAGRA
FT                   VQNVTVDGGSIEGAGTFAFQAETTGSATVTNVRASGIGRAGVYNCAYPGGTFALNRGAG
FT                   NSGWDSTWNGCTWVAPGSGGGTDPLPPTGNLAAGKPVSASSQVQNYVPGNTVDGNATSY
FT                   WESANNAWPQSLTVDLGSSQNVKRLVLKLPPSSAWGARTQTIAVHGSSNGSTYNQLAGA
FT                   AGRTFDPGSGNTATITLPAVASARHVRLTFTGNTGWPAGQLSEYEVYGS"
FT   sig_peptide     28679..28780
FT                   /locus_tag="Kfla_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.622 at
FT                   residue 34"
FT   gene            30997..31713
FT                   /locus_tag="Kfla_0028"
FT   CDS_pept        30997..31713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0028"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: scl:sce4978 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29158"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29158.1"
FT                   /translation="MTPSLTRPVALVTGASAGLGLALAHGLADRGWSLIIDARGADALK
FT                   NVADALAAKTDVVPLAGDVTDPEHRADLVDAVGELGRLDLLVNNASYLGPSPLQRLASA
FT                   DLSELRRVYEVDVVAPIALTQALLPDLLAAAGMVLNISSDAAVEAYEGWGGYGSAKAAL
FT                   DHAGAVLAVEHPNLAVYAVDPGDLRTAMHQAAFPGEDISDRPEPASVVPAFLGLLDSRP
FT                   ASGRYRASEFAPAVTP"
FT   sig_peptide     30997..31071
FT                   /locus_tag="Kfla_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            31710..32744
FT                   /locus_tag="Kfla_0029"
FT   CDS_pept        31710..32744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0029"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   scl:sce4977 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29159"
FT                   /db_xref="GOA:D2PQH2"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH2"
FT                   /inference="protein motif:PFAM:PF02547"
FT                   /protein_id="ADB29159.1"
FT                   /translation="MRLRPHTRFTLPDELNAVEPPEARGLSRDQVKLLVAEGSTVTHTR
FT                   FDRLGEHLRAGDLLLVNTSGTLAAAVEGSWISSSGVTPVVVHFSTELDDGTWVVELRSN
FT                   GLPMLAGSTGDQVELPEGVLKLLAPYQAGSTRLWRAQPPVAEVVDYLRRHGRPITYQYV
FT                   DQQWPLALYQTVFANQPGSAEMPSAGRPFSFELVSQLAAAGVLIAPILLHCGVSSLESH
FT                   EPPLAERYAVPEHTARLVNWVKSTGGRVIAVGTTAVRAIETAALPSGSVVASSGWTDLV
FT                   LSPERPTAVVDGLITGMHAPEASHLLLLESVVGGEAVQHAYDAALDRGYLWHEFGDTCL
FT                   LLRG"
FT   gene            complement(32791..32961)
FT                   /locus_tag="Kfla_0030"
FT   CDS_pept        complement(32791..32961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29160"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29160.1"
FT                   /translation="MSPRAVDKRARPGNEGGPAATEPAADLAAVGTPENAGTALSAATD
FT                   GPAGAADAEVT"
FT   gene            complement(33144..33821)
FT                   /locus_tag="Kfla_0031"
FT   CDS_pept        complement(33144..33821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0031"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_1981
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29161"
FT                   /db_xref="GOA:D2PQH4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29161.1"
FT                   /translation="MAPSRGEQLRYNDRCNQYNDRCTLAGGPVDKRAAVLAGARRVFAR
FT                   DGYARGSIDVIAAEAGVSTRTIYNHFRDKSGLFAAVIQDSAAGVAAAQLELVDRHLGAV
FT                   DDLENDLVAFGIAWRTPVPGHAEHSALVRQINAEAAHIPAEVIDTWRQTGPLAVRRAIA
FT                   DRFAAFAADGLLVVEDPLRAALHYSALISGADPSFRSVAEDDLTETVTAGVHAFLHGYG
FT                   ADR"
FT   gene            33826..34239
FT                   /locus_tag="Kfla_0032"
FT   CDS_pept        33826..34239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0032"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29162"
FT                   /db_xref="GOA:D2PQH5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH5"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADB29162.1"
FT                   /translation="MTFTAEELDYLNSQPLARIATVGADGQPDVVPVGFEYDGAYFYVG
FT                   GGLNPERTRKVVNVWNGRRQVALVIDDLPSTDPWSPRFLRVYGTAEVVERGGQFGAGTY
FT                   LRITPTVSWSWHLDGRPVDADAFAPRRTEHTAA"
FT   gene            complement(34247..35026)
FT                   /locus_tag="Kfla_0033"
FT   CDS_pept        complement(34247..35026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0033"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: atc:AGR_L_3552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29163"
FT                   /db_xref="GOA:D2PQH6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH6"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADB29163.1"
FT                   /translation="MTLGFSTLGCAGEPLDAVLDLARRHDIAGLELRAADDEFTHVGLT
FT                   ASERRDLRQRIEHAGLEILAINSYVHLCGVEEQPLDAHLELAADLGARGVRVFLRDDQS
FT                   AARPDGPTPGEFRAMDRVARAPKDVSVLLETHDTHSSGQAIAAFCRLLDAEVPGHSARG
FT                   IWDAAHTWRTGESPAESLDLLRPWLEFVQIKDSDSRQDFKPVPIGTGDYPIDRLLQALG
FT                   DSDYPLSLEWERKWHPHLPPLSEALAATRTWLTTAQQ"
FT   gene            complement(35069..37225)
FT                   /locus_tag="Kfla_0034"
FT   CDS_pept        complement(35069..37225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Cuticular protein 76Bd CG9299-PB"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29164"
FT                   /db_xref="GOA:D2PQH7"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29164.1"
FT                   /translation="MSHPHTAVYSAAETDDEWQPHAAEEFQQVGTVGKLATALLFTSTL
FT                   THLLVTWSDWNTYNAVSQFLGDGADVDMAILNRADTIARLTSIPNVIVSVAAAVVFVIW
FT                   LWRARVNSEVFCQADHRRGHGWVLASWFCPGPNLWYPKQIVDDVWLASDPRTPVYADDL
FT                   RRYRTPLLTQVWWLTWIGALAFDVVIRRFLMWMDPTVGTLRGIALAGTASLLLTAAAAV
FT                   GGTLVIRKINAMQTSREWIPWWDQREPKLTAVPTYADDDTSEQQPIAEPIATPTLRLER
FT                   SPAPQSQPPQSQSAQSQYGGAAGSPFGAPAGNPLGAGPGLAGGSPFAPPAASTPAEDEA
FT                   PKWSPFAPAAQTWQDSGPETQQFNPAELWRDEPGPVEEATPSYQQTSAGQEAPSWSTTS
FT                   SSYRSADDDLLSAPLPSWQAETVAPPSLSLVQPDPYSYQPDPAPVAEPEPSWSSSYAQG
FT                   YDYQTSSDYLTSSEPVPEPEPEPAPVARAGRRAARVAVDSPSTVQPAAPTYQEPTYQEP
FT                   AVTPDDDYLTPSKPLPPVSPYAPEPTYSPEPTYSPEPAYAPEPTYPAYDAPAVPSSYES
FT                   AYTPDYGSTSYGSSSTYSDYNSSYTPEPTYDSYSSTYDNYSSSSSTGSSYEAGNSSYDY
FT                   SPNYAPESYGTDYSATPEQSTDYTAPAEPQQQTPYSYEPAEPPAAHGTGRRPNVEHDPA
FT                   TTSGEHAGSGEHAAPRTHPRRRWV"
FT   gene            complement(37431..38342)
FT                   /locus_tag="Kfla_0035"
FT   CDS_pept        complement(37431..38342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29165"
FT                   /db_xref="GOA:D2PQH8"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29165.1"
FT                   /translation="MTGSTAAGPPLQPEPIRPDPLRPPATDLPSYLPETQRSSTPQPPQ
FT                   YQPAPYLPPPYAGPAPNGAHLMPTRPPQPPLDRWFTSEHAMGLAASILIGVVTVMSWAT
FT                   AWSDWNSYRTLRRYAGDPDRMDDADLISGLFGIIAALALFAAAAVFVVWLWRVRWNAEM
FT                   FCRGEHRFTRGWVLGSWIVPVVNLWYPKQVVDDVVAASDPRTPPHVPTLRGIPGTRLVW
FT                   AWWLTWVVGLVLDNIAQRSVLDGAAELGELLQNAVMSTVSAVSTTAAAVLAVLLIRRIN
FT                   DLQTQRPWTPWWAVEPPQPPAR"
FT   gene            38566..39048
FT                   /locus_tag="Kfla_0036"
FT   CDS_pept        38566..39048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0036"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: xac:XAC2823 6-O-methylguanine-DNA
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; methylguanine DNA
FT                   methyltransferase ribonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29166"
FT                   /db_xref="GOA:D2PQH9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQH9"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADB29166.1"
FT                   /translation="MRWSVIDSPIGDLCLAVDDTGLCCVRFGAVDDVEPLTVPDPLLTE
FT                   THEQLKAYFAGERTTFDLPLSVPAGSTFERAVWQQLTRIPYGEMQTYGDVAKAVGDPGA
FT                   ARAVGVACNRNPLPVVVPCHRVVGAGGKMVGFGGGIPRKRHLLELEARVAFENLWT"
FT   gene            39199..39564
FT                   /locus_tag="Kfla_0037"
FT   CDS_pept        39199..39564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29167"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29167.1"
FT                   /translation="MTQSPADPPASGAHLHPDLSALMDKSAEEWSAPEIQSAARAALQL
FT                   HAPDREPLTRTKRFGVLPWMHRNDAVCQHCGGTYPCITHRYATQLLSAGRISTTRGPAD
FT                   VEDGTAPLEAEGSGDKL"
FT   gene            complement(39656..40618)
FT                   /locus_tag="Kfla_0038"
FT   CDS_pept        complement(39656..40618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eck:EC55989_1411 putative tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29168"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29168.1"
FT                   /translation="MGLLKSKGRVETAKDRVRPLAESASQKVAPVASQVRDHLGPAVGT
FT                   ARDKVSPYAEKAVERGATLAHAAVEKAGPVIDDALSKVGPATEHAAEKARERMNDDVLP
FT                   KVTAALAALAAAAEPVVAETSRRGKATKAALRGELQVPKKSHRLRKVVLFLGFGALAAA
FT                   AVKKLLTPPEPAWQSTPTSGRDYSSAPAGSRGTSTTGGDKSAAAGKSATDEKPDTAASN
FT                   GTTGTGTTGTTGSAQATASKTAQSPSSQSPTNQSSTSTTSSSTTSTGQTSTGQGSSGQS
FT                   STGESKADETKAAANGTAKKASTTAKKSAGPNNSKPTDS"
FT   gene            40826..41368
FT                   /locus_tag="Kfla_0039"
FT   CDS_pept        40826..41368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0039"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: bba:Bd0177 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29169"
FT                   /db_xref="GOA:D2PQI2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI2"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADB29169.1"
FT                   /translation="MAEELFATLQTTKGDVVIKLFPDHAPKTVKNFVGLADGTQEWTDP
FT                   ETGEKKTERFYDGLGFHRVIDGFMIQGGCPLGTGTGSPGYSFDDEIHPDLQFDRPYLLA
FT                   MANAGIQFGRGTNGSQFFVTVVPTPHLNRKHTIFGEVADDESKKVVDAIATAKTGAGDR
FT                   PVEPIVINSVQIEKRAS"
FT   gene            41476..42216
FT                   /locus_tag="Kfla_0040"
FT   CDS_pept        41476..42216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0040"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29170"
FT                   /db_xref="GOA:D2PQI3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI3"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADB29170.1"
FT                   /translation="MTETVCYRHPDRPTGVRCQRCEKPICPACMNAASVGFQCPSCFAE
FT                   GVKSVPRTRTSLGGVARGNTQVVTLILLVLNVLVFIAVRAGNSTLVYDLVLVPVLVDSE
FT                   PWRLFTSAFTHLQIFHIFSNLFMLYQVGPLLEQMLGRLRFVLLYFLSALGGSIAVWLLA
FT                   NPVSSTLGASGAVLGLVGALLVISRARGMDVTWILAYVAITAVISFLFPNISWQGHLGG
FT                   FLAGAAIAWLFLRETKWRRDRART"
FT   gene            complement(42229..42834)
FT                   /locus_tag="Kfla_0041"
FT   CDS_pept        complement(42229..42834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0041"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mlr3851
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29171"
FT                   /db_xref="GOA:D2PQI4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29171.1"
FT                   /translation="MATEQRDQTATGRRSGDRTRAAILAAARERFAADGYERATIRAIA
FT                   ADAAIDPAMVMRYFGTKEKLFAAAAEFDLRLPDFAALPHDQLGTRLLEHFLDRWEADDT
FT                   LMALLRAAVTNESAAERLRQIFAAQLAPAIAALAGEGDDGVDPEVRAGLVATQTMGLAL
FT                   CRYVLALGPITSMPRATVIAWLAPTVQRYLTADDPTEP"
FT   gene            42935..44089
FT                   /locus_tag="Kfla_0042"
FT   CDS_pept        42935..44089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0042"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; HI0933 family protein; KEGG: mpt:Mpe_A1733
FT                   2-polyprenyl-6-methoxyphenol hydroxylase-related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29172"
FT                   /db_xref="GOA:D2PQI5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI5"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADB29172.1"
FT                   /translation="MDGLPEQVEVLVVGAGPAGLAAAATVASNGHQVAVVDKLAEGANT
FT                   SRAAVIHARTLEMLEQLGVSDELVQLGRPAENFSIRDGDRELIGVPFGDLPTKYPYTLM
FT                   IPQHVTERVLLDRLQQLGGRVHRPCTATGLTQNPDSATVTFDSGATIEARYVVAADGMH
FT                   SRIRDLAGLGDSVGETLPLSFSLADVRVDGGLRGDQVRLYLATEGVLVVAPLPDGSFRL
FT                   VAEVGEAPEHVDARYAQELLDTRGPRRGGTRVTEVIWGSRFRIHERVAPAYRAGRVVLA
FT                   GDSAHTHSPAGGQGMNLGLRDAVTLGAALSTALKHGTEHELDQYATTARAEALQVVALA
FT                   HQLTRIATAPAFLRPARNTLLHLLGHLPAVRHNLAVRLSAISPR"
FT   gene            44108..44233
FT                   /pseudo
FT                   /locus_tag="Kfla_0043"
FT   gene            complement(44211..45212)
FT                   /locus_tag="Kfla_0044"
FT   CDS_pept        complement(44211..45212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0044"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: rhi:NGR_b02600
FT                   transcriptional repressor, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29173"
FT                   /db_xref="GOA:D2PQI6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI6"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADB29173.1"
FT                   /translation="MVTRLSDVAARAGVSVKTVSNVINDYPHITSQTRAKVEAAIEALD
FT                   YRPNVSARSLRKGRSDFIALAIPEMASPYFAELGAAISRAAKKRGITVLIDQTEGEAAA
FT                   EKLVLDGMRGQLIDGIIFSPITTSPARIGQTETAKPIVLLGERDAGGRLDRVAVDSVQA
FT                   AYDATTHLVSLGRRRIAAIGVGGGAGTGSVRRRGYRKALSAAGLRHDPALELAGTGYHR
FT                   EDGAASMRELLALPEPPDAVFCFNDLLALGALRTLAEAGLSVPDDVAVVGFDDIEDGRF
FT                   HSPSLTTISPDKEWLADNAVGLLLDRIAGNGESERRNLTVPYTLQVRESTAG"
FT   gene            45355..46863
FT                   /locus_tag="Kfla_0045"
FT   CDS_pept        45355..46863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0045"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: vei:Veis_3457 alpha-N-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29174"
FT                   /db_xref="GOA:D2PQI7"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI7"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ADB29174.1"
FT                   /translation="MARLAVDPAFVVGSLDRRLFGSFVEHMGRCVYTGIYEPEHPDADD
FT                   DGFRTDVLALVRELGVTAIRYPGGNFVSNYNWEDGVGPKQDRPRKLDLAWRAIEPNQFG
FT                   TDEFVAWSRKAGVEPIWAVNLGTRGIQEAVELLSYCNLPAGTELPDRRVANGSKEPHDI
FT                   RVWCLGNEMDGPWQIGHKTADEYARLAEETANAMRRVDPGLELVACGSSNAGMPTFGDW
FT                   ERTVLERTYDLVDHISLHAYYEPKDGDQASFLAAAEEMDRMITSVVATADHVKALKRSD
FT                   KEITLSFDEWNVWYQQHFPGELGLDVREVSPLIEDTYTVDDAVVVGSLLITLLRHADRV
FT                   KIACLAQLVNVIGPIRTEPGGAAWRQTIFHPFALTAQHAGSTVLRTEIAGPEVDTRAYG
FT                   RVPALWSTATYEESTGEVVLFVVNRGETGTVELEVPLHAFGHLEVTEHLALHDDDRAAV
FT                   NTAAQPDRVVPRPVDGTGVDSGICRATLPPASWHMIRLSPGGTR"
FT   gene            46860..48188
FT                   /locus_tag="Kfla_0046"
FT   CDS_pept        46860..48188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0046"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SM_b21604 putative sugar uptake ABC transporter
FT                   periplasmic solute-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29175"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB29175.1"
FT                   /translation="MNTINRRLVLGGIGALGAAGVLAGCGEGSAGNPGAGPATGDGGAK
FT                   GYEGPNVELDFWNGFTGGDGPFMRKLVDQFNSENANIKVKMTVMQWADYYTKLPTAVSS
FT                   GRGPAVAIMHVDSLATNAARNVIEPLDDVAKALDLKQEDFSEVVWKAGEYEGKRYGIPL
FT                   DVHPLGFFYNKTLMTQAGLDPAKPPATADEYAAALDALKAKGIQGHWATPFPFTGVLSV
FT                   QALLWQFGGQLFNEDSSKATWHEEPGVKALSWFTDLVKNGHSPKNVAQDADNIAVMNGK
FT                   NAFVWNGIWNINTFKEKKGLEWGVAPLPNIGGTKAAWAGSHQFVLPKLKTPDQNKSTAA
FT                   RVFVNYVSQKSLEWAKGGQVPARKQVRDSAEFKALPEQAALATQIDDLHFPPPVPGIGD
FT                   ALAELNKAVNESVLLKAEPGKALADAAARADKILEANRKKYGA"
FT   sig_peptide     46860..46931
FT                   /locus_tag="Kfla_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.627 at
FT                   residue 24"
FT   gene            48191..49132
FT                   /locus_tag="Kfla_0047"
FT   CDS_pept        48191..49132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0047"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_5336
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29176"
FT                   /db_xref="GOA:D2PQI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQI9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29176.1"
FT                   /translation="MAVQASAGTLRKQRARASAGVRGYGRATPYLFLAPYLLLFLVFVI
FT                   GPALFGIWMSLHDWDFQLPGKPFVGLQNYKDLFDPLSATAEPFWHGMRATGIFTLASVP
FT                   FLVAIPLALAVLLNRKFPGRTFFRAVYFAPYVLGVAVIGLMFRYILDTTFGILNAFLGL
FT                   FGIPEIGWTTEQPWAFVALVAVTVWWTAGFNAIIYLAGLQDIPAEQYEAAELDGANTWQ
FT                   QFRNVTLPGLRPVTVFIVTITLLASANMFGQALLITQGGPGDTTRTALMVITDTGFSQF
FT                   RMGQAAAMSYLLAIFLSIVALITFALMRERKS"
FT   gene            49129..49956
FT                   /locus_tag="Kfla_0048"
FT   CDS_pept        49129..49956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0048"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: spe:Spro_2573
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29177"
FT                   /db_xref="GOA:D2PQJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29177.1"
FT                   /translation="MRRRPSAAFWVMVVLLTLLVVVPLLWMVITSFKTVGESQSDPPTL
FT                   VPEDPTGRAFGEILTTGGQNPVLRWALNSFAAATLHALLVVVVASMAGYALARMEFRFK
FT                   NFIFSFILLTLFIPGFVFLMPNYLLMDNLGWLDTLWALVVPGAAGAFGVFFMRQFFLAI
FT                   PKELEEVALIDGANAWIVFTRIILPNAKPALATLTVLSFLANWNDFVWPLFVLFSPERL
FT                   TLPAGLSLLQGAYTTDYPVIMAGATVAAVPVLILYVFVQRYVIEGVARSGIKG"
FT   sig_peptide     49129..49239
FT                   /locus_tag="Kfla_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.758 at
FT                   residue 37"
FT   gene            49994..52219
FT                   /locus_tag="Kfla_0049"
FT   CDS_pept        49994..52219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0049"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   scl:sce1485 putative Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29178"
FT                   /db_xref="GOA:D2PQJ1"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ1"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADB29178.1"
FT                   /translation="MPRRILAAALAVAAVAAGTTAAVAAPPLAVTTQNDISKPFADTYA
FT                   DPAIIQGRDGYWYAYATSDPLVANGPFGLMHMARTKDFGSWEYLGTVFSDATKPAWAAP
FT                   GSFFWAPDIRYFGGRYVMYFTVTDTAANPGGDPAIGVATAPTPAGPWTATGGPVVTPKP
FT                   DGNGGYFGTIDPAMLTAADGKRYLYYGGFYGGLWVTELTPDGLQAVGTPTQVAIGDRYE
FT                   GSYAVYRDGWYYLTASSSNCCAGPTTGYSVFAGRSKSPRGPFLDADGASMNESRVGGTT
FT                   VLTQNGNKWIGPGHHAFFTDAAGQDHILYHAIDRAKPWLTDPFGINRRPMLVDRLDWID
FT                   GWPRTRAGAGPSETPQPAPVTGSAAGITPADPASGLWNATRRPGDALGGPTAQIRGVAA
FT                   TRQSAPAGSVRVSADVRLGASFTTVLGYGAVVASIVGDKLVLVAGGRTTAVRLPAGFDR
FT                   SRWNRLAVQVTGSTVTARISDAGLGDLYAEARLVVPKLKVKAAPVRWLGQAEVDNLTIR
FT                   PVAEPVRRMVAVPQPGKLLAGDEFNGSGLGAGWSWLRPDAAATVANGKLSWPLQDTDLV
FT                   GGGNNAGLLFHRTPAGDRWIAETKLHLDLGEGDIRNYQQAGMIVHRTDDDFARLGNVAI
FT                   WRTRQTEYGRELVARPSDGATSYGGAAIGRSAPDLWMRLAFHRNAAGEHVYRAATSVGG
FT                   KNWTWGAAWVLPAGETPRLGLYAHGDFTGADPAPVATFDYLRFYESK"
FT   sig_peptide     49994..50068
FT                   /locus_tag="Kfla_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            52219..53211
FT                   /locus_tag="Kfla_0050"
FT   CDS_pept        52219..53211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0050"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   mxa:MXAN_5247 glycosy hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29179"
FT                   /db_xref="GOA:D2PQJ2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ2"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADB29179.1"
FT                   /translation="MLRGLGVSLLLLAVAGCGGGDPSPSPEGASVGFTNPVYDNNFADP
FT                   HVIAAGETFYAFATNGPLGNIQTLKSADLVDWEQVGDALPTLPSWTSAGKVWAPEVAVH
FT                   GPDRYVMYYTTSHDASSRQCIGVAVAERPEGPYVDKSSNPLICQEKEGGSIDASPFQDS
FT                   TGQRWLYWKNDGNAVGQDTWIYVSKLSADGLQLVGETTRMFKQDLPWEGHLVEAPYLVE
FT                   RNGKFHMFYSANAYDKAEYAVGHALCTTPAGPCKKSGDPILTTSEAAAGPGHNMVLEKD
FT                   GRYWFVYHAWDPELVGVDPPGRTMWLSELTFDGDTPKVQPPLRENPVKP"
FT   sig_peptide     52219..52281
FT                   /locus_tag="Kfla_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.486 at
FT                   residue 21"
FT   gene            complement(53201..54658)
FT                   /locus_tag="Kfla_0051"
FT   CDS_pept        complement(53201..54658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0051"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   rle:RL3248 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29180"
FT                   /db_xref="GOA:D2PQJ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB29180.1"
FT                   /translation="MRTTLPLTVDRAAGLALHLQLAEQVRAAVRDGRLQAGHRLPSTRD
FT                   LARELGVSRAVAQAAYDQLHAEGWIVGRTGSGTYIADVVPLTPPVRQRRSRTADSSSNS
FT                   PTAAASTSSSWPGRTSKGLLTLRPGIPFIGTQADAGWRRAWREVSAQTPPQGYDDPAGL
FT                   PELRSALAEHVGRVRGIACGPENLVITNGTVHGFRLLLSTTLRPGDRLAVEDPGYPNAV
FT                   KAAEAHHLKVVDVPVDADGLCVDTLGGLEEPDGIAAVYVTPSHQYPLGGRLPVARRNEL
FT                   VRWARRTGATLIEDDYDSEFRYDVAPLPALAQLDLDRVVHLGTLSKMISPSLRLGWLVA
FT                   SAPVVDRIACHREEASDWPGWPMQAALLAMLRDGYLDQVVRRNRRLYAERRNHTCAQLA
FT                   PYGRVVGQDAGLHITLLLPDHVDDKALAAKARAAGVAIAPLADYRRTVTGSPGLVIGYA
FT                   TPTDEDLHKALRILVDLLERESKSTMA"
FT   gene            54684..55418
FT                   /locus_tag="Kfla_0052"
FT   CDS_pept        54684..55418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29181"
FT                   /db_xref="GOA:D2PQJ4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ4"
FT                   /inference="similar to AA sequence:KEGG:AZC_0404"
FT                   /protein_id="ADB29181.1"
FT                   /translation="MDRVGIPLLCHAAAMTTTSLSPTERTRLRRSKERAATDRRVLHEV
FT                   LREGMFCHLGVVVDGAPLVLPTAYGVDLDSGPDGTLYLHGSVAARSVVAAPDQTICVTV
FT                   THVDGLVLARSAFHHSVNYRSAVVFGTPRPVTDPDEKLHGLTVIVDHLVPGRSSGSRGP
FT                   NRKELAKTSVLALDLTEASVKTRAGGANDEPEDLDLPYWTGVLPLRMVAGEPITNDDCD
FT                   LLVPAHIRTRANQLGAPSCTDG"
FT   gene            complement(55468..56256)
FT                   /locus_tag="Kfla_0053"
FT   CDS_pept        complement(55468..56256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0053"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: aeh:Mlg_2716
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29182"
FT                   /db_xref="GOA:D2PQJ5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ5"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB29182.1"
FT                   /translation="MSATLHPLADTSTMLRRNLRHALRYPSMTLGTLGMPVIMLLLFGF
FT                   VFGKTFEAGLGGGGFDYLDFLVPGILLVTVGSGTVPIAVAVCTDMTEGIVARFRTMAIF
FT                   RSAVLTGHVIGSVLQTLLGLALVIGVSVALGFRPSANVVEWLLAIALLTATTVALVWLA
FT                   VALGLTAKTPEGASNVVLPISFVLPFLSSTFVPIESMPAGIRWFAEYQPFTPIIETLRG
FT                   LLLGTPIENGNGWLAAAWCVAITTVGYFWAQSNYNKGTLA"
FT   gene            complement(56253..57218)
FT                   /locus_tag="Kfla_0054"
FT   CDS_pept        complement(56253..57218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0054"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: aeh:Mlg_2715 daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29183"
FT                   /db_xref="GOA:D2PQJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ6"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ADB29183.1"
FT                   /translation="MTSAIEVRGLHKSYGDQRVLDGIDLTVTTGTIFSLLGPNGAGKTT
FT                   VVKILSTLITADAGEIRIDGTDLHRSPDDVRAAISVTGQFSAVDGLLTGEENLRMMADL
FT                   HHLDRSEGRRRAAELLDQFDLAAAAHKPAMTYSGGMKRRLDLAMTLVGEPRIIFLDEPT
FT                   TGLDPRSRHSMWGIIRGLVAGGVTVFLTTQYLEEADQLADRIAVLDHGRLVAEGTTEEL
FT                   KRLVPGGHVRLRFTAPDELALAERVLPSGQADHSALVLQVPNDGRVQSLRELLARIDDA
FT                   SLEVDELTVHTPDLDDVFFAVTGHSTTDPATTSDEKATIR"
FT   gene            complement(57399..57923)
FT                   /locus_tag="Kfla_0055"
FT   CDS_pept        complement(57399..57923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29184"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29184.1"
FT                   /translation="MPNKTIYVSDDDLALYKRAQEIAGNLSSAISTALRRYVEMEEGRL
FT                   EGYDEITVRVGRGTGRKQRFSGVLLAEGGRSSKDGYEAFKVYRSRTGKFVLHADRRHQY
FT                   KQKQSDPAYENGWRSWVGNWSADQSWSLAQGEATLHVVETIEQLRELIPVELYALVEEA
FT                   ANQPAVEDLDI"
FT   gene            58020..58928
FT                   /locus_tag="Kfla_0056"
FT   CDS_pept        58020..58928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0056"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   rpe:RPE_3955 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29185"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ8"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADB29185.1"
FT                   /translation="MHTAEDRYDALTDEVAALYELGRQADALALMDATAAELGDQLTPW
FT                   AAELAHLRACLLGSLGNAEAALEVLVRASDAGGWWEESILTEDDDLAGLRTLPGFDALV
FT                   ANSRARRTPGITPPLIRLPPDGRTVVRVVVALHGAGQTARHAARDWASVLDLGCALVCV
FT                   ESSQLMSPRYRTWPDPAAAADDIARALAELPAELDGLPLVAAGFSAGGRVAISWALTAT
FT                   PQPVAGVIALAPALRELPTEAATSLAPASVLIGTDDDLLEVVLEAADQLEGFGLRITTL
FT                   PGQGHQVPSDFADLLAQTLGT"
FT   gene            complement(59149..59412)
FT                   /locus_tag="Kfla_0057"
FT   CDS_pept        complement(59149..59412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0057"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29186"
FT                   /db_xref="GOA:D2PQJ9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQJ9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADB29186.1"
FT                   /translation="MPESSSREQKKKPAAEKPQKTPKKPRTTSRPWVAPLMLGCWLLGL
FT                   IWLVVFYVAGQDIPFMNDLGNWNLLIGMGLIAVGFVVSTQWI"
FT   gene            59538..60308
FT                   /locus_tag="Kfla_0058"
FT   CDS_pept        59538..60308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0058"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29187"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK0"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADB29187.1"
FT                   /translation="MSRLRRFSLWRAAAPVALLCAGLLFATSATNARGTDLRPSRNTTL
FT                   AGLVEEQSRRSATLTRQHAALSGDIEKLQTQQGAIEPKLAKQLKDLSVQVGTTPVTGPG
FT                   LTVTLKDAPREVVKDNPDIDADWLVIHQQDIQAVVNALWAGGADAISIQNHRVISTTGI
FT                   KCVGNSVVLHGVPYLPPYKITAIGDRRKLQQALDDSQYIENLQDYVVRFQLGYEVKNES
FT                   NVAMPAYEGTLDLQSATVPGFETTPSVSPSASGR"
FT   sig_peptide     59538..59636
FT                   /locus_tag="Kfla_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.499 at
FT                   residue 33"
FT   gene            60352..60969
FT                   /locus_tag="Kfla_0059"
FT   CDS_pept        60352..60969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0059"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pzu:PHZ_c1759 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29188"
FT                   /db_xref="GOA:D2PQK1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK1"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADB29188.1"
FT                   /translation="MPRILVVDNYDSFVYNLVQYLQQLQADTTVLRNDEVTPEQAAEYD
FT                   GVLLSPGPGTPEEAGSCVDIVQQAAGRVPIFGVCLGLQAIGVAYGGVVGRADELLHGKT
FT                   SQVLHEGAGVLAGLPSPFTATRYHSLAIAEHSVPADLQVTARTEAGVIMAARHRDLPVE
FT                   GVQFHPESVLTEGGHRMLANWLAVCGDPGAVARSTGMAPVVS"
FT   gene            complement(61043..62932)
FT                   /locus_tag="Kfla_0060"
FT   CDS_pept        complement(61043..62932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0060"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG:
FT                   dal:Dalk_2476 serine/threonine protein kinase with CHASE2
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29189"
FT                   /db_xref="GOA:D2PQK2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB29189.1"
FT                   /translation="MTSQARLVGGRYEEGEPLGRGGMADVRRGVDNRLGRAVAIKRLRV
FT                   DLASDSTFQARFRREAQSAASLNHPTIVSVYDTGEEPDPNGSGITIPYIVMELVTGKTL
FT                   RDLIREGRKIMPERALEITSGVLEALDYSHRAGIVHRDIKPGNVMLTPQGQVKVMDFGI
FT                   ARAVADTTSDMTQTAAVIGTAQYLSPEQARGETVDARSDLYSTGCLLYELLTGRPPFVG
FT                   ESPVSVAYQHVREQPVPPSSFDPEIPPEVDAVVLKALAKSREERYQSAAEMRQDIHRVL
FT                   AGQQVTAPMTAVGETRAMAGAAIAPAAATQAYGQTQAHDLLPPDDGMTEAQAARARRNR
FT                   GLAYFLLGLAIVAVAVGAYAIITNLGEDNDGATPPAQVAVPNVVNRSLEDATALLTAQG
FT                   LQVKSTGAANPTVPKGNVASQNPGATTMVDKGAVVTVVVSSGPTSYPVPDVVGKTERQA
FT                   RELLEAPPANFKVADKVNTVDDEQPEGTVLGVSPDPSGRYASGQRFTLTVSSGSVKVEV
FT                   PDVTNQGQADAANTLKSAGFAVAYKAAPPDPNAIPGTVVSQDPKGGTKADKGDKVTLFL
FT                   ANRPTEPSTPPPSSPPTTSPSEDPESPPTDTDTPPTINLPGGGGPRQNTEDDE"
FT   gene            complement(62997..64448)
FT                   /locus_tag="Kfla_0061"
FT   CDS_pept        complement(62997..64448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0061"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: pca:Pcar_1046 cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29190"
FT                   /db_xref="GOA:D2PQK3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK3"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADB29190.1"
FT                   /translation="MNSAIRRLAVAAIILMLALMANSTYLQAFRADELNGRNDNRRVRD
FT                   AQFSVNRGPILIGSTPIAQSKPSKDRFEYQRSYQLGPEYAPVTGYYSYLYGRSGIELNQ
FT                   NSQLNGSDPSLAFRRVVDVITNRRQQGASVGLTLNAKAQLAAYRGLAGKKGAVVAIEPK
FT                   TGKILALVSRPSYNPNELASHDLEKTGAAWKKLNADKNKPLTNRAIKELYPPGSTFKLV
FT                   TAAAALSSGRYTPETKVRSPAVLELPQTTVGLPNQNGRNCGGSDNATLTVALRESCNSA
FT                   FGSVGLDLGAEALREQAEKFGFGERQLPDLGAVASRFPADPNAPQVAQSAIGQFDVQAT
FT                   PLQMAMVAAGIANGGDVMKPYLVQTVRTADLKTISETKPESLHQAVSSEVATQLTQMMV
FT                   DVVENGTGRPARINGVQVAGKTGTAQTAPDRPPFAWFTSFAPANDPQVAVAVMIEDANV
FT                   PRTDIAGGTLAAPIAKDVMEAVMGR"
FT   sig_peptide     complement(64362..64448)
FT                   /locus_tag="Kfla_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.454 at
FT                   residue 29"
FT   gene            complement(64445..65845)
FT                   /locus_tag="Kfla_0062"
FT   CDS_pept        complement(64445..65845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0062"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: glo:Glov_0671 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29191"
FT                   /db_xref="GOA:D2PQK4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK4"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADB29191.1"
FT                   /translation="MSIAPTSTIQIIPRSRRGVELMLLVIATAVSVAAYVSIGLAVQGN
FT                   VPASTGYYAAGIGLLALIAHLALRYRAPYADPVILPCAVLLNGLGVAMIHRVDLGLKAA
FT                   AEAAGREPRGPAAPQQITWTAVGIILFLVVILVVRDHRRLQALTYTAGLAGLVLLVLPL
FT                   VPGLGVDINGARIWIRALGMSFQPGEFAKLCLVVFFAGYLVVKRDVLTLAGHRFLGLDL
FT                   PRARDLGPILIAWGVSLGVLIFEKDLGSSLLFFGLFLFLLYVATERAGWLIIGGLLFAG
FT                   GAYVASQLFGHVQKRVADWLNPFNEVGGQVANGLFGQAWGGVLGRGLGQGRPELLQFYA
FT                   QSDFIISSFGEELGLTGLIAIILIYTLIVERGLRTALGCRDVFGKLLATGLAMSFALQV
FT                   FVIVGGVTGLIPLTGLATPFMALGGTSLVANWAIIALLLRISDQARRPQTPAAPVSDDT
FT                   IAMAVQKQ"
FT   sig_peptide     complement(65735..65845)
FT                   /locus_tag="Kfla_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.680) with cleavage site probability 0.231 at
FT                   residue 37"
FT   gene            complement(65842..67239)
FT                   /locus_tag="Kfla_0063"
FT   CDS_pept        complement(65842..67239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0063"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: nmu:Nmul_A1997 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29192"
FT                   /db_xref="GOA:D2PQK5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK5"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADB29192.1"
FT                   /translation="MTLSLDYAALSDVGRVRRNNEDSAYAGPHLLLLADGMGGAAAGEV
FT                   ASAAAVQVLRRLDTATITGEDMIEALAGAVHRANERLSELVEEDPEREGMGSTVTALMF
FT                   DGEQLGLAHLGDSRAYRMRDGRLQQLSHDHTFVQSLVDEGRISQEEAFTHPHRNLILRV
FT                   LDGRPDSDPDLQMLDVQAGDRLLLCSDGLPDYVNDDVIAAAMADGTPDSVVVDLITHAL
FT                   EAGSNDNVTCIVADVVETAQTGAGAPQLVGAAAELAQGGTGGAEPTIAVRGGGGEGAGA
FT                   SESGEHLDPEELRYAPRPPKRFIWLRRLGALAVVLALVAGGGWFAYSWSQQQYYVGTDG
FT                   DYVAIYRGVDEQVPGLTLSRVHEQKTLEVDKLPTYNREQVEGTIQADDLAAAREIVEEL
FT                   QRAADACAGQQAKTTPSPRPGTPAPSTPPASGKPVVSKPPVSVPVAPPSSTPTNGAVGP
FT                   DDCDGVR"
FT   gene            complement(67250..67732)
FT                   /locus_tag="Kfla_0064"
FT   CDS_pept        complement(67250..67732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0064"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_2621 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29193"
FT                   /db_xref="GOA:D2PQK6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK6"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB29193.1"
FT                   /translation="MSELTLTLIKLGFLALLWMFVLAVLSVIRSDLFGAKVDSRALAGA
FT                   VPAAGRTPKPAKPVKKKKGLPGSVTIADGPQAGVGAALGDEPVVIGRGSDCQIRLDDDY
FT                   SSTRHARVFQSEGQWWVEDLGSTNGTYLDGQRVTRPVPAEIGGSIRIGRTTLNIAK"
FT   sig_peptide     complement(67652..67732)
FT                   /locus_tag="Kfla_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.525 at
FT                   residue 27"
FT   gene            complement(67743..68561)
FT                   /locus_tag="Kfla_0065"
FT   CDS_pept        complement(67743..68561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0065"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce0876 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29194"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK7"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB29194.1"
FT                   /translation="MRPLQRFERRLEGIVSGVFARAFKGDVEPIELAAALKREIDNTAR
FT                   ILSRDRRLVPNHFTIELGPEDFERLNAYGRTLNHELANELRDHADIQRYTFSGPIEIEL
FT                   TQQDDLPTGKFRVVSATVGTPARPRPQTPPPPLDPYDDGRTQPQSAPVPPPPPPPARRG
FT                   HPQVMLEVNGRRRPVNPPGVVLGRGTDADIQINDPGVSRRHAEIRLMPEGPGGVRVVLV
FT                   DLGSTNGTLVNGRRAAEAELTDGSTVRIGNTTMTLRLADEPIAQPPSSGW"
FT   gene            68805..68888
FT                   /locus_tag="Kfla_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            68805..68888
FT                   /locus_tag="Kfla_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(68956..69144)
FT                   /locus_tag="Kfla_0066"
FT   CDS_pept        complement(68956..69144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29195"
FT                   /db_xref="GOA:D2PQK8"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29195.1"
FT                   /translation="MTVTDFAGILGLVAAALLALWMLLGASTTPHRGDPRHSAPTTDPR
FT                   PARHRADPGHLLHRLRR"
FT   sig_peptide     complement(69064..69144)
FT                   /locus_tag="Kfla_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.561 at
FT                   residue 27"
FT   gene            69348..70325
FT                   /locus_tag="Kfla_0067"
FT   CDS_pept        69348..70325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0067"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; KEGG:
FT                   afw:Anae109_0915 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29196"
FT                   /db_xref="GOA:D2PQK9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQK9"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB29196.1"
FT                   /translation="MQDGALLDAREEQAYRLLVGLSVARAQDLAEVAELPQQEIDELLQ
FT                   RLQAKGLVAVSPGDEPVFRPLPPDVALGTTLLRQQESLESARKTVASLSEEFRASASRR
FT                   DAHHLVEVIVGATALRDRLRDLQESAREEILWFCRANPLAMQGAENTEEYGALSRGVRY
FT                   RAIYERALLETPGELDTIAEGVSWGEEARTLPSLPVRLAIVDRATAVCPLVRDNELGIG
FT                   EPTAAVIGRGQLLDALLALFESHWEAATPVKLQADDAEVGEGLDGSERFLLSLMVAGVP
FT                   DKSIASQLGISRRTVQRRLDRMMALAGVDTRTGLAFQAAKRKWL"
FT   gene            complement(70378..74064)
FT                   /locus_tag="Kfla_0068"
FT   CDS_pept        complement(70378..74064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0068"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; protease-associated PA domain protein; KEGG:
FT                   she:Shewmr4_1596 peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29197"
FT                   /db_xref="GOA:D2PQL0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL0"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADB29197.1"
FT                   /translation="MSTPVQKAALFAAGLALAATSSLTATAAPPGPAAQAASPVAAGKA
FT                   QKVTLITGDVVEIADAGAGKKSATVLPAPGRERVAFHTVEVDGGLRVLPSDAVPYISSG
FT                   LVDSDLFDVEELLADGYGDAATGTLPLIVRYADGARIQSLAGTTNNRPLASIGGAAVSA
FT                   TKAELPGLWESLKPAAPTARSLDQGVSKVWLDGKVKPVLDRSVAQIGAPAAWQAGLEGS
FT                   GIEVAVLDTGVDAHHPDLAGKVQKAEDFSGSPTGAEDHFGHGTHVAATIAGTGAGAGGT
FT                   RKGVAPKADLLVGKVLGDDGSGYESWIIAGMEWAAAEGAKVVNMSLGGGATDGTDPLSQ
FT                   AVNDITADSGTLFVVAAGNEGQDQSVGTPGAAAAALTVGAVDRNDALADFSSRGPRVGD
FT                   SGLKPEITAPGVDIVAARATGTAMGTPLDNLYTAASGTSMATPHVAGAAVLLAQAHPDW
FT                   TADRIKNALTSTAKTTPDLSVYAQGTGRVDLARAVAQKVYATGVADFGLTGVGSSPTTR
FT                   PITYRNDTPAPVTLNLAVDVDNLDSHQPETDAFGVPATVTVPAGGSVDVPLALDPAKLE
FT                   RGLFSGWLVATGPNGVSVRTAVGSLKAGPTHQVRLRAVGLDGQPTGVPVISLYGDNPRS
FT                   DTLAWLDDGQTLTAQVEEGTYLLHSLVENNDPQDEKVSLFTDPNIVVDRDREIVIDARK
FT                   AAPITIHTPKPSEQRAVLSYYVHREYPNGRKVSHGVMHFSTVSQVLVTPTRPVKGGSFE
FT                   FASRWQLVAPLVQASVQGVSGPLDINLLHRSPSYEGRKRFSLVAAGPDLRGVKGAIAVL
FT                   ESSEDGWGNGSEQDQIAEAAKAGAAGVILVRPADWSAWTVWVPTGEREPIPAMVTTQRD
FT                   GARLVNRAKAGRATIDLTLTTSSPYLYDVFQVSAGHIPAKIDHRVTTANSARISTSYAD
FT                   NGGFGWAKEQRFGWRPWQDYSWNDSQRFVQTPKVREEWVSAGDSLWKHRVHHLYTWDTL
FT                   NPLAGGMTSLPRSYRTGTSSETWFEPVVRPAAAPGLVSTRTGDRFSLRVPSFVDAAGHY
FT                   TLGETTSSSAVLKRNGAVVADLPDAWQDVLTSGGDAAYRLEVATERVDEAGEWNWGTRT
FT                   QTAWDFRSKTAAGEQAVALPLLQVGYDVPADLTGRVAGRAHVIGFKVQQQAGAPAPRST
FT                   ALQAEVSFDEGKSWRRIAAVGAFGKYIAVVPAGKGTVSLRVSAADNAGNKVTQTVIRAY
FT                   GLR"
FT   sig_peptide     complement(73981..74064)
FT                   /locus_tag="Kfla_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 28"
FT   gene            74384..74845
FT                   /locus_tag="Kfla_0069"
FT   CDS_pept        74384..74845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0069"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: cti:RALTA_B1222
FT                   putative cyclase/dehydrase; putatively involved in
FT                   polyketide (linear poly-beta- ketones) synthesis;
FT                   antibiotic biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29198"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL1"
FT                   /inference="protein motif:PFAM:PF03364"
FT                   /protein_id="ADB29198.1"
FT                   /translation="MAESIAESIDVETPVSVAYRRWNEFASFPEYMEGVDDVRGSDEIH
FT                   SHWVTSFGGVVREFDATITDQEPGERIAWVCSSGPLRAGSVTFAPVTDRRTRITVQLEL
FT                   EPHGLAENFAEKTGILHRMVVADMYRFKNVVEAETQDPAPSPASSAQLS"
FT   gene            74851..75990
FT                   /locus_tag="Kfla_0070"
FT   CDS_pept        74851..75990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0070"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   sme:SMc04326 putative aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29199"
FT                   /db_xref="GOA:D2PQL2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADB29199.1"
FT                   /translation="MPSLPEFRLETYFSRWEFGARFHLTASDAQTLPLSELLALADDDG
FT                   RERWESLALGYTETRGLPALREEIARTYEHVVPEDVLCFAGAEEALYLAMRTLLAPGDH
FT                   VVVLTPNYQAAETVPLEICDVTGVALRAEDDWALDVDAIEQALRPATRMVSVNFPNNPT
FT                   GALPSPEAWHRLVRLCDARGITLFSDEVYRGLELDRASLPQATDLSPSALSLNVMSKAY
FT                   GLPGLRIGWIACRDRSVLDRLERAKHYTTICNSAPSEVLALIALRARDRLLSRNREIVA
FT                   RNLPVFDEFFRGYPDLFEWAPPQGGCVCYPRYAGADGVEAMCADLVEQAGVLLLPSSIY
FT                   RSELTETPQDRFRLGVGRLDPEPALAAWGAWLDQRPTVA"
FT   gene            76250..77509
FT                   /locus_tag="Kfla_0071"
FT   CDS_pept        76250..77509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0071"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: smt:Smal_2683 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29200"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB29200.1"
FT                   /translation="MKFRSLAVAAVTALSLTALAACGSSDGDSNAAAGPTTIDVWLMKG
FT                   SVSDDFLQRFTADFAAKHPDIKANVQIQEWNGIGPKIIGALASKDAPDVIEVGNTQVAQ
FT                   YSASGGVKDLTDKKADLKGDDWIEGLAGPGNYEGKQYGIPYYAANRVVIYRKDLFQAAG
FT                   VTPPKTRAEWLAASAKLNTGGNQGIYLPGQNFYVLSGFIWDEGGDLAVKEGDSWKGALS
FT                   TPEALKGMEFYRQIQALGKGPKDSDEAKPTQTDVFAQGKVAQMIAVPGAAELIAQANPA
FT                   LKDKLGFFPIPGKTADKPGAVFTGGSDLIIPEASDGQDAAYTFIKELAGEQWQTDLAKT
FT                   MKYVPNRKALATSVGSDEGVAAMAAGAANGKATPNSPNWAAVEAKNPIKEYQTKVLTGG
FT                   DPVAAAKAADEIITQALNAK"
FT   sig_peptide     76250..76312
FT                   /locus_tag="Kfla_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.648 at
FT                   residue 21"
FT   gene            77514..78488
FT                   /locus_tag="Kfla_0072"
FT   CDS_pept        77514..78488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0072"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SMa0710 ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29201"
FT                   /db_xref="GOA:D2PQL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29201.1"
FT                   /translation="MAVTHAESPAAPAPVAPTGSPAPGRRGRSLPVRLLPYLLVVPTVL
FT                   GTAYLLVYPLIRNLVISFQKFGIAQLIRGGADFVGLDNYRQILSDGMFWSVVARTFVFT
FT                   AINVALIMGLATAVALLIGALGKGLRLAVMGGLVVAWAIPVIAATTVFQWLFQSQLGVV
FT                   NWVLVALGFERFEGYAWFANGTSTFAIIVVLIVWQSVPFAALTLYAAMTTVPRELHESA
FT                   QIDGAGGVRTFTLITFPILRPMFGLILCLEIIWVFKCFVQIWAISQGGPGNATLTLPVY
FT                   AYQVAQSLNRYDLGAAISMVTVLILAVVLLAYFRQMFKEEGEL"
FT   gene            78485..79318
FT                   /locus_tag="Kfla_0073"
FT   CDS_pept        78485..79318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0073"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_4515
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29202"
FT                   /db_xref="GOA:D2PQL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29202.1"
FT                   /translation="MRPRIGRRISLNVLALIVVACSVFPVYWMVLTAFKPTKDIQAETP
FT                   SFLPTNVTFTHFGTAVNADGFWLFWRNSALVAVTAVLLALVVACLAAYAVARMKWRGRK
FT                   QFILMVFIAQMTPWEALLIPMYVIARDTDMLDKLTMLTLIYFMVTLPFTIVTLRGFLKA
FT                   IPIELEEAAQVDGCNQFQAFRRIVFPLLAPGLLSTSLFGFITAWNEFAFANLLIIKNQD
FT                   QRTLPVWLSSFSNTFGTDWGATMAAATLFMLPVLLIFLVLQGRVTSGVAAGAVKG"
FT   gene            complement(79319..80023)
FT                   /locus_tag="Kfla_0074"
FT   CDS_pept        complement(79319..80023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0074"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: ret:RHE_CH04035 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29203"
FT                   /db_xref="GOA:D2PQL6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL6"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADB29203.1"
FT                   /translation="MRRKETRDRLLALIEDSGPGQVLPSERSLSETLGVSRPTLRAALD
FT                   DLARDGLVVREHGRGTFISARKIHQELEPTEAGDFAVPPAEGSPWHSRLVSFGLEPAGA
FT                   RMGRRLEVSPGTELVSVVRLRLVDGLPMCIERILVPAAAVPGITGRDFELGSFYGLLRG
FT                   RYGVAPKDAVQVTEPTVTDAQESALLDVPLHSPALLIERTTRTADRAVIEYTRSVYRGD
FT                   RYRITTRLTFAD"
FT   gene            80165..81115
FT                   /locus_tag="Kfla_0075"
FT   CDS_pept        80165..81115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cja:CJA_1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29204"
FT                   /db_xref="GOA:D2PQL7"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL7"
FT                   /inference="similar to AA sequence:KEGG:CJA_1083"
FT                   /protein_id="ADB29204.1"
FT                   /translation="MARSRVFRLTSAVAVLAAVGAAAGSGVPASARPSPDRSPQQAAAC
FT                   GAFFDDFNYSSRTDPAFTARDWSIRTSAGGPGVGGATWSASNISFPVVDGQKSLQLRAT
FT                   TNGTAAGTTHAQVQQNRQRFFEGTYATRFKFSDTPVSGADGDTINQTFYTISPLRYDWD
FT                   PIYSELDISEYLPNGGWGETSATNFFTSWNTYQADPFDGWRATTARRQSHAGWHTLVAT
FT                   VSGGHVKYYVDGTLVADHTTDSAGRTVYPRQAMTLNYNQWFIDLTGHTGGTSVWAQSAD
FT                   WVYYAKNEVLSPSAAVARVSSYRSAGRTHADTISC"
FT   sig_peptide     80165..80260
FT                   /locus_tag="Kfla_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.889 at
FT                   residue 32"
FT   gene            81478..81972
FT                   /locus_tag="Kfla_0076"
FT   CDS_pept        81478..81972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0076"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; regulatory protein LuxR; sigma-70 region 4
FT                   domain protein; KEGG: xac:XAC3989 ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29205"
FT                   /db_xref="GOA:D2PQL8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB29205.1"
FT                   /translation="MADWKSAFDELVAVRGPALRGYAYLLAGDAPTAADLVQEALVRVF
FT                   GRLRVGSDVQQLEGYVRRAILNLYVDDRRREKRWRETRHLLVDPDPPGEDLVTTNAVRQ
FT                   ALSDLSPKQRACVVLRYYEDLTVPEIADQLGCAEGTVKRHLADARSRLAAQLGVTEESV
FT                   Q"
FT   gene            81969..82658
FT                   /locus_tag="Kfla_0077"
FT   CDS_pept        81969..82658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5102 flagellar hook-length control
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29206"
FT                   /db_xref="GOA:D2PQL9"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29206.1"
FT                   /translation="MTSKDLKDLLGAVADEGRETVAVDEQQVAGRIKSRRRRQSVVVAA
FT                   ASVGTAAVIAAAAVAIVPNLGTEQAPVAGPRQAATGVAIGGCGETVSGEPRADAPLTMS
FT                   AVTGVKPVSGTTDYATIDLVVTNTTQQTLHLSTGRSAAITVAQGGKVVATPAPARDAAV
FT                   QLTLLPGEKKTVTSTVGLRRCDGATTQTGGRLAAGGYQLYATQKFNPTEGGEVLEAQGG
FT                   PWTVELK"
FT   gene            complement(82662..83852)
FT                   /locus_tag="Kfla_0078"
FT   CDS_pept        complement(82662..83852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5466 S1E family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29207"
FT                   /db_xref="GOA:D2PQM0"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29207.1"
FT                   /translation="MRMTRRSLSLAIAAVSVGAGGLVVAGQPSLAQPLGETAVAAPAAA
FT                   DPALAAARADKQRAAATAPDGPQTAQEKKFGQVDDYATKAGGLGVYLDSTTGKYVVRMP
FT                   RNAMASKAARSVRIAGAETVVQPSRTTQAELTAIRSTLESRQWTAGAKKYSYGFHYDAQ
FT                   GDVMSVTTNAPAAVMKPLLAKYPSLVQAKYGDVGRASRRSDPAPHRGGASITNGTGVCT
FT                   SGFTITSTARYMVTAGHCFTINQRVYSTGGGQLWGTVRNRPRFPYYDFEAVGGGSYGSV
FT                   IYVGNATGRTILVSGASDPAVGAAYCRSGQTTFERCSQVVTSLHAQFCDESGCTVELIA
FT                   YRGPASSGGDSGAPLYQYVNGTVQIRGMHIAHADDTMYAERWTTIRSVFKANIAIR"
FT   sig_peptide     complement(83757..83852)
FT                   /locus_tag="Kfla_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.621 at
FT                   residue 32"
FT   gene            84056..85213
FT                   /locus_tag="Kfla_0079"
FT   CDS_pept        84056..85213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0079"
FT                   /product="Endonuclease I"
FT                   /note="PFAM: Endonuclease I; KEGG: hch:HCH_00124
FT                   endonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29208"
FT                   /db_xref="GOA:D2PQM1"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM1"
FT                   /inference="protein motif:PFAM:PF04231"
FT                   /protein_id="ADB29208.1"
FT                   /translation="MTVPRSRRALRAGRPVLIVGVLLALLGFGVTPAPAAVSAPLTVAA
FT                   ALQQQNGGVGTVEGYVVGQPTATSTVVRSNFPSDYALALADSATQTSTSSMLYVQIPTA
FT                   FRASYGLRSNPGLLGRKISVTGTLTAYFTHPGLKDATAFSGAGGGADPGDPGTPGDYYA
FT                   TAVGKTGPALRSALHSIIANQTKLSYDQVWNALKDTDQDPANPNNVILLYSGRSQSKAG
FT                   NGGGANDWNREHVWAKSHGDFGTATGPGTDVHHLRPEDVSVNAARGNLDFDNGGGAVAE
FT                   CAGCAADGDSFAPRAAVRGDVARMIFYLAIRYEGGDGFANLEPNDAVTNGSAPYHGRLS
FT                   VLKAWNQADPPDAFEKRRNQVIFDTWQHNRNPFIDHPEWVGAIWP"
FT   sig_peptide     84056..84172
FT                   /locus_tag="Kfla_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.823 at
FT                   residue 39"
FT   gene            85230..85652
FT                   /locus_tag="Kfla_0080"
FT   CDS_pept        85230..85652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0080"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pla:Plav_0011
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29209"
FT                   /db_xref="GOA:D2PQM2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB29209.1"
FT                   /translation="MTSSLPRFHLAMPVDDLAAAAEFYGSVVGCERGRSSDTWIDWNLR
FT                   GHQFVTHLAPGRSVGMHNPVDGHDVPVPHFGLILEVADFHALADRFRAAGTPFAIEPYL
FT                   RFEGQPGEQWTMFLHDPAGNALEFKAFADEAQIFAT"
FT   gene            85697..86026
FT                   /locus_tag="Kfla_0081"
FT   CDS_pept        85697..86026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0081"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein ArsR; transcriptional
FT                   regulator TrmB; SMART: regulatory protein ArsR; KEGG:
FT                   cti:RALTA_B2187 putative transcription regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29210"
FT                   /db_xref="GOA:D2PQM3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM3"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB29210.1"
FT                   /translation="MDTISRSEVLARFGHALSDPTRTRVLLALQDGPGYPADLAERIGV
FT                   SRQSLSNHLACLRGCGLVVAEPEGRRTRYELADPQLGTALTELLNVVLAVDPACCRPDQ
FT                   SGECR"
FT   gene            86023..86694
FT                   /locus_tag="Kfla_0082"
FT   CDS_pept        86023..86694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29211"
FT                   /db_xref="GOA:D2PQM4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR026765"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM4"
FT                   /inference="similar to AA sequence:KEGG:GSU2959"
FT                   /protein_id="ADB29211.1"
FT                   /translation="MSSSPELPLLSVGPAPDRRKLGRRAQWLAGASVAYNLVEAVVAIS
FT                   AGAVAGSVALIGFGLDSIVEVASGLIILWQFRHPLPETRERRALRLIAVSFFALAAYVT
FT                   FESVRALTDRSSPDNSSIGIGLAIASLIVMPVLSTLQRRTGRALGSGSVVADGTQTLLC
FT                   TYLSAVLLAGLLLNATLGWFWLDPVAALVIAAVAVREGVEAWQGMGCCAPSQAGCDDGC
FT                   C"
FT   gene            complement(86699..88030)
FT                   /locus_tag="Kfla_0083"
FT   CDS_pept        complement(86699..88030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA4606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29212.1"
FT                   /translation="MSPIFGTPRRPAYTVTRTDPSGQPISLDLRGPSGHSVLFTGAPGM
FT                   GKTVELDRAQQLARQNGWTCLRVDASPREPLENRFVRAATQDLGGMRKRYGFFALRKLK
FT                   KTLKDLTQRSRSQQNGAEVRFGVAPVQLVAKKQWDAPGKDGVGTTLDQLASDLGELAAK
FT                   KGQPVMLMVDNLDVASDRDLAALTELSAHLERSGQPVYLIGAGGEMAATRLMTASGGVS
FT                   GIATGVTHRFDVRECGPLSTEELRPALTEPLRQAGVPFRSEAVDQLLHAAGGNPGRLRD
FT                   LADEAVQLARPPEGITPEVAEVATAQVNARSRVVYQAAWNTCSDAEKELLAKTAARGAR
FT                   GLSMPAETQAAGPGKWQEVDKARQGLVARGLVRESASGQRISIADPGLRDWVEMRIGKS
FT                   AAHAGVALAGSPAPAITPQTPGRHAQGPSTATRQAGNTTFTVNR"
FT   gene            88257..89087
FT                   /locus_tag="Kfla_0084"
FT   CDS_pept        88257..89087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0084"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: mxa:MXAN_3639
FT                   iron-chelator utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29213"
FT                   /db_xref="GOA:D2PQM6"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM6"
FT                   /inference="protein motif:PFAM:PF04954"
FT                   /protein_id="ADB29213.1"
FT                   /translation="MSKPAPRTRRAKLGVVRRTERLTPHMIRVVLSCDEFTGNGNTDMY
FT                   VKLLFPQPGVEYPDPLDLGLVREQYPSEQWPTMRTYTVRNWDEAAQELTIDFVHHGDEG
FT                   VAGPWAANAQPGDKLWFNGPGGAYAPDEAADWHLLVGDESALPAIGATIEALPAGARAT
FT                   VLLEVEDESEQQKFDGPGDVDLTWFHRAGADRARGDRLVEAVEALEFPAGDVQAFVHGE
FT                   AGFVLRIRRNLFATRGLPRDRVSLSGYWRLGKNEDGWQAEKAETARKEREAAGA"
FT   gene            89158..89817
FT                   /locus_tag="Kfla_0085"
FT   CDS_pept        89158..89817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0085"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: mxa:MXAN_2180 NADP oxidoreductase, coenzyme
FT                   F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29214"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM7"
FT                   /inference="protein motif:PFAM:PF03807"
FT                   /protein_id="ADB29214.1"
FT                   /translation="MKIGIIGTGNIGGTLTRRLTALGHEVKVANSRGPQTLRELEQETG
FT                   ATAAEVKDVAHDAELVVVTIPQKAVPALPAQVFDGAAPGLVVVDTGNYYPQRDGRIAGI
FT                   EDDGLTESGWVAQQLGRPVVKAFNNIQARHLLQNGRPAGTPGRIALPVAGDDEAGKAKV
FT                   LALIEQLGFDAIDAGPLAESWRQQPGTPAYGTDLDVDGLRAALSAASPERPAELRG"
FT   gene            complement(89818..90588)
FT                   /locus_tag="Kfla_0086"
FT   CDS_pept        complement(89818..90588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29215"
FT                   /db_xref="GOA:D2PQM8"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29215.1"
FT                   /translation="MCLGFPVSSELARRHRKVQLVVGTIYLGIPVVLLGVGLWLGSGAW
FT                   TAAVLPVALLAVGAFLLPRHRYRPQRWGVTAAAFGAVAGLFVALYPLAQGHYWPAFLFL
FT                   PALWAGVVLCVALARYAERTLLVPAVPELADTPYELAFRLRGLRLTTLVLGKDSVTIQS
FT                   IPLGRRGPKPADLARTYPLSKVTGVYDVSLTGAERLRFPVALPIPAVGTAGPAVILQAA
FT                   GDDWVLPTDLAPTLAQLLTHRVNSTTDQELGDEA"
FT   gene            90618..91529
FT                   /locus_tag="Kfla_0087"
FT   CDS_pept        90618..91529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0087"
FT                   /product="aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /note="PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; KEGG: pfo:Pfl01_3891
FT                   aminoglycoside/hydroxyurea antibiotic resistance kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29216"
FT                   /db_xref="GOA:D2PQM9"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQM9"
FT                   /inference="protein motif:PFAM:PF04655"
FT                   /protein_id="ADB29216.1"
FT                   /translation="MTDFVIPPALWHAHAEDEDALRWLKSLPETANSYLDRWQLTVDGP
FT                   PLHGGASLVLPVRRSDGVPAMLKLQPLNEENAAEALGLRTWDSNDVVQVLRADDSTATL
FT                   LLERLQPRSLSDVPDDVEATRILAELLARLSVVPAPAQVRTLAEVAGEMVADAPELIPE
FT                   LSDPAERALVRRCVARVTELLAEPGDRLLHWDLHYDNVLGSERAPWLVIDPKPLAGDPA
FT                   FELLPALGNRWDDLIATGDLSGAIRYRFDLMVDVVDLDRDRAVGWTLGRILQNVLWDVE
FT                   DGERRIDRHQLAIARALSPTLG"
FT   gene            91562..92023
FT                   /locus_tag="Kfla_0088"
FT   CDS_pept        91562..92023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0088"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: mlo:mlr0267 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29217"
FT                   /db_xref="GOA:D2PQN0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN0"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ADB29217.1"
FT                   /translation="MSTPTVYEWAGGAEAFRRLTEVFYDKVRSDELLAPVFAGMSPHHR
FT                   EHVALWLGEVFGGPSRYTDELGGYPAMLGHHVNLGLTEPQRARWAALIAASADPAGLPD
FT                   DPEFRSAFVAYVEWGTRLALANSQPGATPPPRAPVPRWGWGEAPPYLPG"
FT   gene            92176..93231
FT                   /locus_tag="Kfla_0089"
FT   CDS_pept        92176..93231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0089"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: mxa:MXAN_2249 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29218"
FT                   /db_xref="GOA:D2PQN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN1"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ADB29218.1"
FT                   /translation="MTAQLEYPDPQESEALLSVQGLWKVFGPKASRVPRRPELAELNPA
FT                   ALYDRTGCTAAVHDLSFDVAPGEVFVVMGLSGSGKSTLVRCLTRLVEPTAGGLYFEGED
FT                   LRAADEKRLRALRRSKFSMVFQHFGLLPHRKVIDNVSYGLEVRGESKPGRRRRAQEVID
FT                   LVGLKGHENMYPEQLSGGMQQRVGLARALANDPDVLLFDEPFSALDPLIRREMQTEVVR
FT                   LHREVGKTMVFVTHDLSEALKLGDRILLMRDGAAVQLGTGDELVGAPADDYVREFVRDI
FT                   PRADVLTLRWIARQPRPDEQLDGPELGPDVLVREATRLVLESDRPVKVVAEGQLLGVIG
FT                   DEEILAVVADA"
FT   gene            93235..95196
FT                   /locus_tag="Kfla_0090"
FT   CDS_pept        93235..95196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0090"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_6172
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29219"
FT                   /db_xref="GOA:D2PQN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29219.1"
FT                   /translation="MASITGSIELNVRKPRRIVLVGGLLVVWLALWFVLRGVHTLALGG
FT                   QETTPFHRWLTEQAGVVGSGNAISDAIRVTVDQLVVLLQNVIAQPSYGRPVPVVGWLGV
FT                   VAVAAFLAWAFGNWKVALLTAAGLTFIGLQGLWQESMDTLSLTLAAVLLALLAGIPLGI
FT                   WAGLSDRCFKVATLVLDLMQTLPTFVYLAPLTLFFAIGPAAATIATLVYAAPPVIRLTA
FT                   HAIRSVPSESVEAARSLGSTRGQTLTKVLLPMSRSTVVVGINQTIMAALSMVTVAALID
FT                   APGLGQTVLKALQTLDVGVAFNAGLAIVVLAIVLDRVTTAAGDRPWRTASRRRKVLLGL
FT                   GAVAALVAVWFSRTYLWAAEFPSEPAIGSRIAVAAADVTTWVQDVFGGFTYGVRDAVTV
FT                   GVLNPLEALLTESPWWLVTAVVVALGAVLGGWRGALPAAVCLLLLVGTGVWRDAMVTLA
FT                   STLLATVVVVAVGIVLGVWTGRNRRVDQWVRPVLDAGQTMPPFVYLVPFLALFGTSRFT
FT                   AIAAAVVFAVPVTTKIVADGIRAVPVATVEAANSVGSSTWQVISKVQLPVARRAITLAV
FT                   NQGLIYVLSMVVVGGLVGAGALGYDVAAGFAQSELYGKGLAAGLAIVLLGVMLDRITQA
FT                   AARRTRKFRGTVRGDNLW"
FT   gene            95193..96152
FT                   /locus_tag="Kfla_0091"
FT   CDS_pept        95193..96152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0091"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: sil:SPO1548 glycine
FT                   betaine/proline ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29220"
FT                   /db_xref="GOA:D2PQN3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN3"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADB29220.1"
FT                   /translation="MTNKLRSAGVLAAVALALTACGGAKVGEADQPAAGGKECGTFNLA
FT                   VSPWVGYEANAAVVAYVATKDLGCTVNKKNLKEEISWQGFATGEVDAVLENWGHEDLKK
FT                   KYVEQQKVAVVVGPSGNQGVIGWYLPPWLAAQHPELKDWKNLNKYASLFKTSESGGKGQ
FT                   LLDGDPSFVTNDEALVKNLKLNFKVVYAGSETALIQAFRDAEKNKKPVIGYFYEPQWFF
FT                   NELKLVKVDLPKHTPGCDADPAKVACDYPAYALDKIVSKKFADSGSPAYDLVKNFSWTN
FT                   DDQNQVAKYIAEDKLSPDAAAEKWVNDNRAKVDGWLGK"
FT   sig_peptide     95193..95273
FT                   /locus_tag="Kfla_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.521 at
FT                   residue 27"
FT   gene            96346..96942
FT                   /locus_tag="Kfla_0092"
FT   CDS_pept        96346..96942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0092"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: mno:Mnod_3460 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29221"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN4"
FT                   /inference="similar to AA sequence:KEGG:Mnod_3460"
FT                   /protein_id="ADB29221.1"
FT                   /translation="MIIVTAALKGGVGKTTTSVYLAALASSNRRTSTLIDADPQGSAAD
FT                   WIETSDDDHLARIEITEAPTERLLTKALDKVPPEGIGVVDMPPSHERLLNKALERARIV
FT                   IIPTRVGGVETPRVKAVLDLVPDDTPVGLVICSARTYTRSYQETMQQYADENIPVWGSI
FT                   PERVSITAGPTGPLAEDGLEAYRKVWRKILAAARS"
FT   gene            complement(96987..98195)
FT                   /locus_tag="Kfla_0093"
FT   CDS_pept        complement(96987..98195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0093"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sme:SMa2303 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29222"
FT                   /db_xref="GOA:D2PQN5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN5"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADB29222.1"
FT                   /translation="MPLRPNRPLPLATPAGVEVLTRILTQGPIPRVQIARRTGLSQAAV
FT                   TKAVAPLIEAGFVTDEPVAPTEGSGESQLGIGRPVSPLTVLADSVSVIGVKVTPTGLIG
FT                   VTTDLTAGIRTVRHSPLRDSSTETVIPRIVELARELMDFLDDQANGAGPLIGIGVAVSG
FT                   DVDAAHGVVRDSPFMGWREVPLAATLTEELGAPVVVTNDVRALTVAEHWFGVGVDADSF
FT                   AVVTIGSGVGCGLYLNGEVVSGAYGVSGELGHLPLAPGELICTCGRRGCVETVASSDAI
FT                   LARTRETTGRPELDLAGAIELAHAGDEHAREAFDQAGEVIGSALAAMVNLVGPELVVIA
FT                   GEGVADYDLYEQRMRRAFSAHAFGAAGDCRLMLRSHTFDDWARGAAATVIRSYVRGEPP
FT                   LQR"
FT   gene            complement(98275..99174)
FT                   /locus_tag="Kfla_0094"
FT   CDS_pept        complement(98275..99174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_3367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29223"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN6"
FT                   /inference="similar to AA sequence:KEGG:BURPS668_3367"
FT                   /protein_id="ADB29223.1"
FT                   /translation="MTAIPAQNALLDPVRDGLAKMIMTKVAGPDPRAERNRVHNTPGPR
FT                   WFAPDRPIRRVHGDASMFAGGLRALLLQSLHPLAMAAVSAHSGYRGDPWGRLQRTSFFL
FT                   AITTYGAEADAEAAIARVKAVHERVRGTSPDGRPYRAGDPHLLEWVHLAEVDSFLVAHQ
FT                   RYGETPLDAAEQDGYVEDTARVARALGVLDPPTTVAELHEMLQAYRPELRGTTEARQAA
FT                   RFILVHPPVPFAARPAYGVLTAAAVGLLPWWTRWPLRLPYLPLAEGTVVRAAGEGLTRT
FT                   IRWALTSPILVDVDKSTG"
FT   gene            complement(99214..100875)
FT                   /locus_tag="Kfla_0095"
FT   CDS_pept        complement(99214..100875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0095"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: pzu:PHZ_c2314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29224"
FT                   /db_xref="GOA:D2PQN7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN7"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADB29224.1"
FT                   /translation="MTSGQQLPEWADPGVPEQALDAQGVSRRGMLRGAGLLGAGLAAGA
FT                   VAGGTSEAAATGTASSGDPELVWLVGDHHVHSRYSHDAKYGFGQLAQRGAQFGLDWMAF
FT                   TEHSNVGHADKGAVAEHAEVVNARAENPRMLIFQGLEWYIPAAEHGTVLVAPGPNDVAL
FT                   LQAFERQYDGKLTNRSGNTAENEQYAVQALRWLAEQKRSGYVDDVLVLANHPLRLGIDS
FT                   PHELRAWRDTGICIGMEGAPGAQGDAEPAWVAHRGATNAQRGEYVNAPGAGSHPGYPAD
FT                   AYRTYGGFDWATATVGGLWDSLLAEGRLFSITSNSDNHRTIWDTWKDGEFPPGQNFDSL
FT                   GWKPAPTDSGVPQAGSDFWPGQFSRTHVGVTRYSYLDVMAGLRAGRVWVDHGQLVDGLD
FT                   VRLTTAGSRQRGVTLGGRLKVRRGERLELRVTVTSATRPNFHGILPRLAHLDVIRGLVT
FT                   GPAADRDSWKAPDTRVVEQLDVRRKTGTYTLRIPLGRAERSHYLRLRGSDGRRNGPGYL
FT                   GRAIDPAGPIQHPVNDGDPWLDTWLYTNPVFVDVQR"
FT   gene            101005..101343
FT                   /locus_tag="Kfla_0096"
FT   CDS_pept        101005..101343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0096"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sdn:Sden_0473 transcriptional regulator PadR- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29225"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN8"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADB29225.1"
FT                   /translation="MSSSEMREPTFFVLAALADGRKHGYAVIAEVKTLSDGRLRLRPGT
FT                   LYAALDRLSEQGLVRAAGEEVVDGRHRRYYEMTPAGADTLAAEAARLQANAEQAFRRLR
FT                   LRPAGGAA"
FT   gene            complement(101554..102102)
FT                   /locus_tag="Kfla_0097"
FT   CDS_pept        complement(101554..102102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0097"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pla:Plav_1643 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29226"
FT                   /db_xref="GOA:D2PQN9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQN9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29226.1"
FT                   /translation="MDPLTGERCRLREVRLDDLDDYLAITGDNRVTSWLSFDSHTRDGA
FT                   QRSLRAAVDRSARADRPDYLLAVTRLDDDRMIGFARLGPTGVQAAHLGYAIAHRYWGHG
FT                   YATDAARTMLRLAFTDLTLHRVSAAIGPDNQASIAVVDRLGFSYEGRIRHHVFTNNAWR
FT                   DSLLYSLLTDEWTPTGPHS"
FT   gene            complement(102102..103397)
FT                   /locus_tag="Kfla_0098"
FT   CDS_pept        complement(102102..103397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29227"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29227.1"
FT                   /translation="MAGRYAPRTVLAHLIQRRNQTYSEIVAEFVELGGTITERHLRRLA
FT                   SGERAGTTPQTRRTLQRMFGKPVEELLAPYVPEQAAQVVPVPAASGRITTGNEMEVLDM
FT                   AASRARAFALAAQTGLGSEAMEQVYDDVKHVAKAYPQRPLPEILGQLVETQDLVFALLE
FT                   SRQRPEHLRQLYFLGGVTGGLLAKASHDLGNPHAALTQARTAFLCADNADHHGLRAWVR
FT                   GLQSLVSYWAGNPHDSVRYAQLGAGYAEQANSTTSVWLPVSEARAWAALGNPDATRAAL
FT                   ERAENAWNSVRNDELDEMGGLCTFGRNRQLYYAADALAWLPGEMETAERYSNQAVDAYT
FT                   DQSHPEWAFGDAAGSHAAMAITRIASGELDGAADAIAPVLGLPAERRINGVVHSARRVH
FT                   QALRQSGHADDARELQEEIEAFTRTPMQSFPH"
FT   gene            103628..103804
FT                   /locus_tag="Kfla_0099"
FT   CDS_pept        103628..103804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29228"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29228.1"
FT                   /translation="MTSRQHRRRVRVWFGEHVIAQYVAEAPLAARYEQAMRRRFAGLRV
FT                   TNDLLGPQDSTDN"
FT   gene            complement(104195..104590)
FT                   /locus_tag="Kfla_0100"
FT   CDS_pept        complement(104195..104590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2658 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29229"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29229.1"
FT                   /translation="MYMSDDNKPIGWWLKELDRLIEASLDSVLATEGLSRRQWQALNAA
FT                   SEEQPIAVALAPFLAGDPAELAAVTDPLAGRGWLDGEQLTPAGRAALDRLTERMTAQRR
FT                   RLTAGIDATEYAMAVDVLRRMAVNARS"
FT   gene            104620..105075
FT                   /locus_tag="Kfla_0101"
FT   CDS_pept        104620..105075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0101"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: mlo:mll6841 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29230"
FT                   /db_xref="GOA:D2PQP3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PQP3"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB29230.1"
FT                   /translation="MPSADPAAAVETAMVAVRRRQTRRAFAAETGGDASQQVLDAIEAA
FT                   GRTPIGVNGIAEALGVDQPRASKLVAAVVSAGLVRREADQQDGRRTHLVLTAAGRDRLT
FT                   EVHAFRRQRFAAAMRDWSDVERATFATLLTRFVSALDQRPAGGEVRP"
FT   gene            complement(105205..106218)
FT                   /locus_tag="Kfla_0102"
FT   CDS_pept        complement(105205..106218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0102"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; GCN5-related N-
FT                   acetyltransferase; KEGG: spe:Spro_3549 GCN5-related N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29231"
FT                   /db_xref="GOA:D2PRQ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB29231.1"
FT                   /translation="MREVDCVGALIRDARQRVYVHRRTAERRLLPGIWDIVGGHLEAGE
FT                   TPEQALAREVEEETGWTVREVLAPVADWEWEYAGRVRRELDFLVAVDGDLERPRLEQGK
FT                   HDAGAWVGPDDVELLMVGRTDGDRRLLDIVAHAVRIRLTERLRLEPVRGPGEVLAGHAA
FT                   DLERLFADPWVAEWYAGTWSAEQSVRRATEMQAAWERDGVSKWMAYERSGGALVGRGGL
FT                   SRLGANAAVTEQLAALAGPDWVADRLELGWALVASARGRGYATEIGAAGLDFAFEQLGA
FT                   RAVVAFTERHNHASRAVMERLGMTYAGELTAEGLVDGAAGVRPDAPFAVYQARRGG"
FT   gene            complement(106298..107200)
FT                   /locus_tag="Kfla_0103"
FT   CDS_pept        complement(106298..107200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0103"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; NAD-dependent
FT                   epimerase/dehydratase; KEGG: mxa:MXAN_2144 NmrA-like family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29232"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ2"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ADB29232.1"
FT                   /translation="MSDVVVVTGATGQQGGAVARRLLAAGVPVRALVRRPETAAAKAIA
FT                   QAGAELVTADLTDPTSLGSALRGARAVFSVQTPDLADLGSDSERSQGENLVAAAREAGV
FT                   AQYVHTSVAGVGDYVRQAAVGRTEGWSTHYWGSKARVGQLLPESGFESWTELRPAFFME
FT                   NLLRPSIWFEGMTGEAIVTVVSPQTRLPVVAVQDIGTAAAAAFADPVRFNGVALDLAGD
FT                   IRTLPELAARLTAVGAPARVEVVAAEEAKARGMVPELIDNQQWLNTYQNPARPALAAAL
FT                   GIPTTTFETWASEKFTAPE"
FT   gene            107294..107905
FT                   /locus_tag="Kfla_0104"
FT   CDS_pept        107294..107905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0104"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_2145
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29233"
FT                   /db_xref="GOA:D2PRQ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29233.1"
FT                   /translation="MTPDRRLRADARRSREQILRAAEVAFARDGFEASLEAIAKDAGVG
FT                   SATLHRHFRSRRQLVEAVFHERTEAVIGEATQLATTNPPGPALYYWLRSVLRVTVENRG
FT                   LAVALLPLPEGTPTDSSCHSRLTDVAEGLIEAARATGDIRADVTAADVLSLVNAIALLA
FT                   EQPGCTHLDAERLLGLTITGIGPEACASGKDASPRHSLPG"
FT   gene            107874..108551
FT                   /locus_tag="Kfla_0105"
FT   CDS_pept        107874..108551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29234"
FT                   /db_xref="GOA:D2PRQ4"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29234.1"
FT                   /translation="MRRRATRSQADPRDACRGSLQSVLYPPAPSDVRENRSGDRVGVVA
FT                   TEQRPPPHVRRGVATGFLVAVTCGLGGAFVGEEVVGTIARVVGHRELVLRGLGWCWGGL
FT                   PFVLAMVALLAQRRIAARAKPVVTTVLVVWAASGALLIPGRGSDLEGRFESAYPEARLI
FT                   GFGWAAGFLSVVLVGAALVVGVLVVQKVFGARGGTAFAWFIGVVGAAVIGAGLAAALVA
FT                   PVF"
FT   gene            108572..109546
FT                   /locus_tag="Kfla_0106"
FT   CDS_pept        108572..109546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0106"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: bte:BTH_I1366
FT                   proline dehydrogenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29235"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ5"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ADB29235.1"
FT                   /translation="MRADRAILFKLATNERLEHVVKALPGGEANAYRAASRYVAGRTRE
FT                   EALAKATELLGQGHGVSLDLFGELSTSTTDARRVADDYLALADSLPKASPDSATQGSTD
FT                   SPAQASPDSPAQAPTGDQAGSVPADAWLSVDLSHLALDVDPRRTADLLAQIAGALPPGR
FT                   RIQVGAEDLRRAEEILTCVLDAAGRGLADRLGATIQANLLRSPSDVEALTEAGVHVRLV
FT                   KGAYVEPRGVHPYGEPTDIAYLQLAHQLAAAGTPWSLATHDGRLREAVLLALGPVPVEQ
FT                   LLGVRPEVLDDLRSRGVPTRVYLPYGPDWFRYWLRRIAESRGA"
FT   gene            complement(109578..111032)
FT                   /locus_tag="Kfla_0107"
FT   CDS_pept        complement(109578..111032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0107"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_0884 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29236"
FT                   /db_xref="GOA:D2PRQ6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29236.1"
FT                   /translation="MTTEQTDPTGVGLRSARGPILLSVMLSIGLVAIDATILATAVPAV
FT                   VEDLGGFTQFPWLFSIYLLAQAISVPIFGKLADLRGRKPVMLLGVGLFVLGSVLCGFAW
FT                   SMPALIAFRLIQGLGAGAIQPIGMTIIGDIYSVAERARVQGYIASVWGISSFVGPALGG
FT                   VFADYVSWRWIFFVNIPLGLAAAWVLVRRFQENVDRGTRHQIDYWGTILLAVGGSLLLL
FT                   GLLEGGVIWAWDSVASVTILAVSVLLLTAFVLVERRAPEPVLPLWVLGHRVLNSANSSA
FT                   LLVGVLMVGLSTYVPLYAQGVLGTSALVAGFALAAMTLGWPIAASLAGRLYLRLGFRTT
FT                   MLFGAVIVVIGSILLLTVSADSSVLSLALACFVIGLGLGFSASPGVVAAQSSVDWTSRG
FT                   VVTGANMFARSVGSAVGVAVFGAVANAVVAARLGSNHGDLEHLSGDVLAAAIHDVYLGA
FT                   AAAAVLLVAAVVFMPNRVAEQPRGPA"
FT   gene            111240..113483
FT                   /locus_tag="Kfla_0108"
FT   CDS_pept        111240..113483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0108"
FT                   /product="putative signal transduction protein with Nacht
FT                   domain"
FT                   /note="KEGG: similar to scavenger receptor cysteine-rich
FT                   protein type 12 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29237"
FT                   /db_xref="GOA:D2PRQ7"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ7"
FT                   /inference="protein motif:COG:COG5635"
FT                   /protein_id="ADB29237.1"
FT                   /translation="MLRVALVVLTLSLTLVLLPIAINVGTGGTAPDFLAPYVGWTWPAI
FT                   GVLWLVAIVTGLWELRSRRLGVTLTARSADQPRNRPNALARVDRYYAERVAGSLAARTR
FT                   LALAVEESPEAVVRPYDLLVQPLHGEVHEVRQNADIAEVFDDLQDSMLILGAPGAGKTT
FT                   LLLELARALAATAHQQADQPIPLLLDLSGWNGPIATRREDDDPGDSPLLAGFVRWLLDD
FT                   LHSRYQIPPPVGRVWLRNGSLALLLDGVDEIAPAHRVKLTPVLEELQQRYLVGQLAVTC
FT                   RIHDYELLPQPLKLYGAVRIRPLSRAQVLDYFASAGRELAGARAAIEQDDELWDLITSP
FT                   LMLNVMALAYQGRDADEIAAGAVADHRRDLFDTYLSEVLARPRPASRQYDSRTAVRSLW
FT                   CLAWWTRTRAGDRTAVPRWLTPNGWYGLPLPAVGYLAHMVCLPALFAGLVGGAALAVAA
FT                   LYGVLAGVAVGAMSLLLVHIRPRPWRVFRDGSGQPRLLVAVAMVATGAVAGFGWALAGA
FT                   LVFAALPGWLALAVLGATVAASYGVELILSEGHRRRLLLGLRLLVVVVGSWLVLTLFDH
FT                   PSTFLACAAVGMIVAQGIRLVKALPMDHLVHQVNDEPRARDRMDLWVVGGLAAAVLVAL
FT                   ALGADPVGSRVEAVLGIVAGVVTAKAWRRRPPLFAGPISRLMHGLLLRWTGYLPWRRRA
FT                   FLRYAADRYVLTRTGRDEYAFIHLLVRDHLAECHPDTLAAKVERRIASRRRPR"
FT   sig_peptide     111240..111305
FT                   /locus_tag="Kfla_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.181 at
FT                   residue 22"
FT   gene            complement(113492..114124)
FT                   /locus_tag="Kfla_0109"
FT   CDS_pept        complement(113492..114124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0109"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_0079
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29238"
FT                   /db_xref="GOA:D2PRQ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29238.1"
FT                   /translation="MSEALRGIRTGEPLREPQQDRSRVTRQKLLEAAVESLAQVGYAAT
FT                   TVAVVAARAGVSRGAAQHHFPTRADLFEAAVEYMTEVRLAEIRSQAAALPVGAGRTEAI
FT                   VSMLADVYTGPLFRAALHLWVAASTEEPLRRQILRLEAHVGRQAHRALLEVLEVSERTP
FT                   GVRETVQGVLDMARGLGLADLLSDDSARRTGIVRQWSKILDQALSAG"
FT   gene            complement(114161..115723)
FT                   /locus_tag="Kfla_0110"
FT   CDS_pept        complement(114161..115723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0110"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29239"
FT                   /db_xref="GOA:D2PRQ9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRQ9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB29239.1"
FT                   /translation="MVMYSEFPPVEVLDVPIHDAVLGRAQEYGDRPAMVDGVTGKEISY
FT                   AQLDGMSRRVAAGFAELGIRKGDVIALYSPNTILYPVVFYGATRAGATVTTVNALYNAS
FT                   ELHKQLLDSKAKLLVTISLFLPVATEAAAGTDVQEIFVCDQAEGYRSVLELVASTGPEP
FT                   VVEFDPAEDVAVLPYSSGTTGAAKGVMLTHRNIATNIAQAEVTINVAENERIIAILPFF
FT                   HIYGLTVLMNLPLRLGATVVVLPKFDLEQFLTTLDQQRITRAFVAPPVVLALAKHPAVD
FT                   GVDLSGLKYVTSAAAPLDAELAEACAKRLGLHAVLQAYGMTELSPGTHAVPQDDQDPPP
FT                   GAVGKLFPSTEMRLVGADGNDVGDGETGEIWIRGPQVMKGYLGRQAETDATIDPDGWLH
FT                   TGDIGRVDERGYLYVVDRVKELIKYHGYQVPPAELEAVLLTDERVADAAVIGIQADGNE
FT                   VPKAFVVPMPGVELTEQDVMDYVAARVAPYKKIRQVEFIEAVPKAASGKILRRELRARE
FT                   AGA"
FT   gene            complement(115766..116923)
FT                   /locus_tag="Kfla_0111"
FT   CDS_pept        complement(115766..116923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0111"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bxe:Bxe_C0513
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29240"
FT                   /db_xref="GOA:D2PRR0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB29240.1"
FT                   /translation="MSFVETEERRALRAAVSELGSKYGYAWFTERARSGGQTTELWQEA
FT                   GKLGYLGVNLPEQYGGGGGGMADLSIVLEELGAAGCPLLMMVVSPAICGTVISRFGTDE
FT                   QKRRWLPGLADGSVTMAFAITEPDAGSNAHNLTTTARRAGDGWSLSGRKVYISGLDVAH
FT                   AVLVVGRTEDARTGRLRPALFVVPTAAPGVEFRQIEMDLISPDKQFALFLDDVTLPDDA
FT                   LVGSADAGLLQLFAGLNPERIMAAAFAIGIGRHALGKAVAYVRDRQVWTGPIGAHQGIA
FT                   HPLAQVKIELELARLMMQKAAALYDAGDDLAAGEAANMAKYAAGEACVRSTDQAVQSLG
FT                   GNGMTVEYGVASLVAAARATRIAPVSREMILNFVAQHSLGLPKSY"
FT   gene            complement(116920..118917)
FT                   /locus_tag="Kfla_0112"
FT   CDS_pept        complement(116920..118917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0112"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; biotin/lipoyl
FT                   attachment domain-containing protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: pmy:Pmen_2030
FT                   3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29241"
FT                   /db_xref="GOA:D2PRR1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR1"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADB29241.1"
FT                   /translation="MTNSLPISSVLVANRGEIARRVFATARALGVSTVAVYSTADAGLP
FT                   YVGEADAAVELPGAAPGETYLRGELVIEAARRAGADAVHPGYGFLSENAGFAQAVLDAG
FT                   LTWIGPPVAAIAAMGSKIEAKKLMAAAGVPVLAELTPESVTAEDLPVLVKASAGGGGRG
FT                   MRVVHRLEKLAGEIEAASAEAESAFGDGTVFCERYLATGRHIEVQVLADRHGTVWAVGE
FT                   RECSIQRRHQKVVEESPSPLVERVPGMRESLFTAARAAAEAIGYVGAGTVEFLADQNGN
FT                   FFFLEMNTRLQVEHPVTESVTGLDLVALQFAIADGAALPPEPPVAVGHSIEVRLYAEDP
FT                   AQDWLPQTGRLHRFAVGRVRSEFAPGGPRQNSPWLRVDSGVVDGSEVSPFYDAMLAKVI
FT                   VWGPSRRAAAGRLARELTAARIHGVRTNRDLLVWVLRHPAFLAGDTDTGFFERYGVGEP
FT                   LADKQAQELSALAAALGDAALNRQRAKVQGRLPSGWRNVPSQPQRKAYLAGDATYEVAY
FT                   RLTRDGLETDGGVRLVSARTTSGPGAEVVLEADGVRRSFAVSVHPGLVCVDSSLGPVAL
FT                   TPVARFPDPSRQVAAGSLLAPMPGSVIRVAVAVGDEVSQGQPLLWLEAMKMEHTIAAPA
FT                   DGVVEKLAVEAGQQVEVGAVLAVVRAGEDA"
FT   gene            118968..120173
FT                   /locus_tag="Kfla_0113"
FT   CDS_pept        118968..120173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0113"
FT                   /product="putative transposase IS891/IS1136/IS1341 family"
FT                   /note="PFAM: putative transposase IS891/IS1136/IS1341
FT                   family; transposase IS605 OrfB; KEGG: ecm:EcSMS35_0448
FT                   IS605 family transposase orfB"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29242"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR2"
FT                   /inference="protein motif:PFAM:PF01385"
FT                   /protein_id="ADB29242.1"
FT                   /translation="MARYRLYPTSAEEHALLEHCAHARFVWNLAVEQHRRSTEGQRRTQ
FT                   GFGEHCRQLTEARAESAWLASGSCTVQQQALKDFAVCTAAWRSGRSGRPSWRKRGRHES
FT                   FRIVAVRPDHVRRTSRRFGSVFVPKVGHVRFRWSRPVRVAKSFRIKQESDGRWYVAFAT
FT                   VPASVPGPGNGAVVGLDRGVVSSVTLSTGEMYRCPMPRSADITRRRRLQRRLARAERGS
FT                   NRRQRTKRALGRLTVREVDRRRDWIEKLSTELARRFDLIRVEDLRIGNMVRSARGTIDH
FT                   PSRGSRCKARLDGRILSNGWGLLVRRLEDKAAGRVERVHPAFTSQRCSVCSYRSSENRK
FT                   SQAVFLCGRCGHRANADVNAARNIAAGRVVTARGGGPTGPPVNREPRHSASLVAVSEPS
FT                   HR"
FT   gene            complement(120182..121747)
FT                   /locus_tag="Kfla_0114"
FT   CDS_pept        complement(120182..121747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0114"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: carboxyl transferase; KEGG: ppu:PP_4065
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29243"
FT                   /db_xref="GOA:D2PRR3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR3"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ADB29243.1"
FT                   /translation="MSNREAMLEKLAALDVEHAKALAGGGEKYVARHHQRGKLLARERI
FT                   ELLLDPDSAFLELSPLAGWGSDFTVGASLVTGIGVVEGVECLITANDPTVKGGASNPWT
FT                   LKKALRADEIARANRLPVISLVESGGADLPTQKEIFIPGGAMFRNLTRFSAEGIPTIAL
FT                   VFGNSTAGGAYIPGLSDHVVMVDGGAKVFLAGPPLVKMATGEDADDESLGGAGMHARVS
FT                   GLADYFAVDEPDAIRLGRQIVSRLNWKKLGPPPAARYDEPLYDADELLGIVPADLKIPF
FT                   DPRDVIARVVDGSVFDEFKPLYGSSLATGWASLHGYPVGILANARGVLFSEESQKAAQF
FT                   IQLANQSSTPLIFLHNTTGYMVGQEYEQGGIIKHGAQMINAVSNSRVPHLSILMGASYG
FT                   AGHYGMCGRAFDPRFLFAWPSAKSAVMGPQQLAGVLSIVARAAAAAKNQPYDEDADAAM
FT                   QAYVQGQIEAESLPLFLSGRLYDDGVIDPRDTRTVLGLCLSAIHSAPVEGTRFDGANFG
FT                   VFRI"
FT   gene            complement(121744..122865)
FT                   /locus_tag="Kfla_0115"
FT   CDS_pept        complement(121744..122865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0115"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dol:Dole_0626
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29244"
FT                   /db_xref="GOA:D2PRR4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR4"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB29244.1"
FT                   /translation="MTDFRESVRRFMATEVLPELADWERAGELPRELHRKAGKVGLLGV
FT                   GFPESVGGGGGSLADAVAVVEEMHYSGGSGGLVASLLTGGIAVPHIVVGGNEQQLDRWV
FT                   RPTLEGELIGALAITEPDGGSDVASLRTTARRDGDHFVVNGAKTYITSGCRADFVTTAV
FT                   RTGGPGAHGISLLVIERGMPGFVVSRKLEKLGWLCSDTAELSFAEVRVPVENLVGAEGS
FT                   GFVQLAQNFVAERLTPAVQAYAGAQRALDLTVEWCRARETFGRPLISRQTVQHTLTEMA
FT                   RRIDVARVYVHDVVRRAEAGDDVIAEVCFAKNTAVEAGQWVCDQALQLHGGFGYLREAE
FT                   VERQYRDQKILALGGGTTEILTGLAAKRLGFTG"
FT   gene            complement(122862..124583)
FT                   /locus_tag="Kfla_0116"
FT   CDS_pept        complement(122862..124583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0116"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   mxa:MXAN_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29245"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR5"
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /protein_id="ADB29245.1"
FT                   /translation="MTAPVRIGNASGFYGDRFSAFHEMVTGGPLDYVTGDYLAELTMLI
FT                   LGRDRLKDSSLGYARTFLKQLETGLGEALDRGVKVVSNAGGLNPAGLAEAIQQLAGTLG
FT                   LHPRIAYVEGDDLLDRAAELGFGSPLTANAYLGAWGIAEALREGADVVVTGRVTDASVI
FT                   VGPAAAHHGWQRDQYDELAGAVVAGHVIECGCQATGGNYAFFRELRNLDRPGFPIAEVH
FT                   ADGSSVITKHDGTGGAVTVDTVKAQLLYEITGARYAGPDVTTRLDTVELADDGPDRVRI
FT                   TGALGEPPPPTYKVSLNTLGGFRNEVQFVLTGLDLEAKAELVQRQLEHGLTSKPAELKW
FT                   SLTWTEQPNAETEELASVLLRCTVKDPDPKTVGRAFSSAAVELALASYPGFHVTKPPED
FT                   AAPYGVFTAGFVEVGEVEHAVVLPDGTRRGIDAAAETRPLEPVEDADLPMPLPQLVAAG
FT                   RPARSLTREVPLGRVVGARSGDKGGDANVGVWVRNETAWRWLAHTLTIGLFKELLPETE
FT                   DLRVTRYVLPNLWALNFVVEGLLGEGVAAQARFDPQAKAVGEWLRSRYVDVPEVLL"
FT   gene            complement(124618..125406)
FT                   /locus_tag="Kfla_0117"
FT   CDS_pept        complement(124618..125406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0117"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="PFAM: Wyosine base formation domain protein; KEGG:
FT                   dal:Dalk_2661 wyosine base formation"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29246"
FT                   /db_xref="GOA:D2PRR6"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR6"
FT                   /inference="protein motif:PFAM:PF08608"
FT                   /protein_id="ADB29246.1"
FT                   /translation="MQLDEVLADLWAESTELDMLVGGLAADGWATPTPAEGWTVAHQIA
FT                   HLAWTDEAALRAVTDPDAFQAVLDHAAADPAGHVDRGAAEGAALPAEELLPYWRETRAE
FT                   LAEALKQVPAGQKVPWFGPPMSPVSMATARLMETWAHGQDVVDGLGVTRQPSTRLRHVA
FT                   HLAVRARDFSYLLHDRKPPAAPFHVELTGPDGQIWSYGDESAEQRVTGPALDFCLLATQ
FT                   RRHRDDLAVEAVGADAEEWLGIIQAFAGLPGKGRTAGQFG"
FT   gene            125536..126126
FT                   /locus_tag="Kfla_0118"
FT   CDS_pept        125536..126126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0118"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="KEGG: lhk:LHK_01519 DNA polymerase, beta domain
FT                   protein region"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29247"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR7"
FT                   /inference="similar to AA sequence:KEGG:LHK_01519"
FT                   /protein_id="ADB29247.1"
FT                   /translation="MVSAAPPLLPIFRSDAQARILSWLLLVPEREQPIATLVPVAGVAQ
FT                   SNVLREVNRLVSAGLLTERRAGPTRLVSANRSSPYFEPLVQLLGRAFGPASLVPEELEQ
FT                   VPGVERAVIAGSWARRFHGEPGPPPNDVDVVVVGEPDRRRLRRANARLEERLGTPVQVT
FT                   VVTSEEWDSQSSGFLQEVRTRPHLTVIDNTLGE"
FT   gene            126133..126600
FT                   /locus_tag="Kfla_0119"
FT   CDS_pept        126133..126600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29248"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29248.1"
FT                   /translation="MNAAAARASLATLIGEDSLERMPVDRDVVGNLLRQAGNHLRTAGA
FT                   GLEADDPEGAFQLAYDACRKACLALVMATGLRPKGQSAHVITFEAAAAVAATFGAQRVV
FT                   IEAADLRFVRHGAEYRAEAVGQADVRDAISIGAELVEALTVAVDKILRSQP"
FT   gene            126648..127331
FT                   /locus_tag="Kfla_0120"
FT   CDS_pept        126648..127331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29249"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29249.1"
FT                   /translation="MTRLPIVSGMDFGRPIGTVVPSLDGAVLQVLAGADRGLSGRQVHG
FT                   LAGVGSVAGVRLVLQRLTSTGLVQVTEAGNSLLYTLNRQHLAAQAVELLADLRTTFVAA
FT                   LRAELSTWTLPPVHASLYGAAVRGDGDLGSDVDLLLIRPDHVAVDDPLWERQAADLLQT
FT                   VVDMTGNPAQFHELDLAELALHVTTGEPIVGQWRDEAVGVHGPDLTTLLSRVHATRELL
FT                   CTTAG"
FT   gene            127732..133251
FT                   /locus_tag="Kfla_0121"
FT   CDS_pept        127732..133251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0121"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; KEGG: rso:RS05070 putative
FT                   hemagglutinin/hemolysin- related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29250"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS0"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADB29250.1"
FT                   /translation="MSELFDRNVRGRSRALHALLVVLVALVPALGATVVLAPSASAAPG
FT                   EISFVGGTSTSGARTSHVVRVPANAQAGDLLVLHLTVNATVGTLTDSLAGWTLLRSRDG
FT                   NGVRGRLWTKTATAADVNANVAVSTSDTLKSVIGVAAYRSTGNAAVSASAVGGSDLSGS
FT                   SHTTPSVPVALAGSWLVNIWSEKSSVDLTWTLPAGSTARSNAAAIGTGKVSAVLADSAG
FT                   AVPTGTAAGRTATTSAATSRSMLFSLVLSPGEVAAPVNQPPVAAFVSSCNGLVCGFDAS
FT                   SSTDPDGDTLSYAWNFGDGQTGTGVNPNHTYAGDGPRTVTLTVGDGTLTDTETSQVSPV
FT                   GTVSQGEISAVGAASTAGNRSSHTVRVPAGVRVQDRLLLFLVTNSTTGTVTDAVPGWTL
FT                   IQTRDGNGVRGRAWTKTATASDAGSDVTVSGSELSKSVLSVAAYRSTGVAAVSASAVRG
FT                   VDTSASSHATPAVPVAKGNSWLVNVWGEKSSVVQSWTLPGTATSRTTAASTGTGKVSAV
FT                   VADSGAGIPIGTATARTATTSSAASRSVMFSVVLDPGPDAGATNEAPIPDFTTGCASMT
FT                   CEFDANRSFDPDGDPLTYTWDFGDGRTGTGDNPSHTYGTTGSRTVTLTVSDGTHSAQKT
FT                   GVAVAAAQPPGPGHGDRIVPDVPRTNFPLISTGEIWDIEVVGNRVYVAGGFTSLRNNAS
FT                   GNTTTVNQSQLAAFSLSTGLIDTTFRPVIGNGGVEAVEASPDGTKLYIAGNFGTVNGLT
FT                   RKGIARIDPVTGAPVSGFVADANAKPQELAVTNSTVYVGGRFTAINGAPRGALAALDGT
FT                   TGAVRTDFVNDVSGGIGANGDFTVQRLKLSPDLGRLLVVHTGRQINGQDRYGVALINAR
FT                   TQKLLPWRTRLWDDNLQFVGGIQRIYGGDISPDGTYFAVTSGSGGDRPPINDTVVAYPM
FT                   EGGDHVQPLWISRLFDSVYSIAIAEKAVYVGGHFAWQESPTSPQPWPGLTDQGYGTGQG
FT                   LSGYGLGDAVVRREHLGALNPADGTAIDGFNPGSNSFEGDKHLELTPRGLFVGGDGQTK
FT                   GEYNVGRVAFFDFTSVAAPNGVETAITDPIEGRIKPVDEQFQVSGTASAASGVQRVQVE
FT                   IMDRSSRRYLNDDLTTWGTTTPNTINATLASPNATSTTWSLPLTMTQNRVLTATARTVA
FT                   GNSTQDPTKATKKFETFGLADETPNTSVTGPAQSVVNSFTYTITGSATDDLGVNSVGLT
FT                   LRDLSNNRYLQNDGTVSATGNTFRITPDVVGATSTTWSHEVTVPYEGEWQAQARATDTS
FT                   GQSDLDTADRTWIVTESGLPPTVSISSPVTMVPPTTVQPVVVTPGQPITFAGSANDEQA
FT                   LQNVEISLRNSTTRENLAADGTWGVDAIAGWYRVAPQNLNQAGYNWSYTTPFNLKPGTY
FT                   SFSVRATDQLGLTTSSSNQGRLTLSAQIPGDAPPDGRLAVTGTVTGGQVLHLDLTGTAT
FT                   DDVGVAEIRVSLEDQDTNRYLQPNGSMAANFATLPVTLATPNGTSTTWTLPVDLPTQGD
FT                   WAVTAFAYDTAGQQDTSTSGATARYRIYPGDNPPTLNEALLTPNEGNEFTDGKIFVTGR
FT                   AEDDQAMQRVEIGIVNAAGQYLSSSGAFTSTTASWRTAFLTSPGTPGSNFSYTSPVIPP
FT                   GAYTVRVRAIDQHDQVTPVPSERHVTVVHPPGNLPPVPSFTISCNQNVCTYDARGSTDE
FT                   SPTTLTYSWNFGNGTGSGPLPTRTYTSANTYTVVLTAKDEWGATATATQTVTITEPAGN
FT                   AAPVPVINQPACSGLSCNISGVGSADPNTGDTFTYLWDFGDGTPTSTASAMSHVFPAAG
FT                   TYTVSLTTTDGWGKAATVTRQITV"
FT   sig_peptide     127732..127860
FT                   /locus_tag="Kfla_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 43"
FT   gene            133383..134618
FT                   /locus_tag="Kfla_0122"
FT   CDS_pept        133383..134618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0122"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29251"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB29251.1"
FT                   /translation="MGVRRRLVAAIGGLGLLAGVAACGGGDEPEGASGKLTLWQYYGDP
FT                   SSPTGKPLYDLVKKYDDARPDVTVDVRFIPYDDFNRTLLQSAAAKELPDVALIGAFDTA
FT                   TMASAGIVQDLGERVGEWGQQDKYFKTSWATTQVEGKTYGIPHVADAYAVYYNKQLLQQ
FT                   AGVQPPTTWAEMETAAKKLTAQGRTGLAISGIEGPEGATVPIIRMLAAGASIDKVDSAE
FT                   GRAGLDQLARMIKAGSISKGALTWNEEDAKNQFANGKAAMMINSATYVNILRKENPKLQ
FT                   WDVALLPKDRTGQTFLSAENLAIGATSTNPDGAWDLITWLQQPAELQSYLPVRNKLAAR
FT                   NDVPDSSNDPVRKVFAQQLEEAWAPDEKLAPKASEVMTHLQAALQASASGSASTEDALK
FT                   AAQKAIDDSLAK"
FT   sig_peptide     133383..133457
FT                   /locus_tag="Kfla_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.433 at
FT                   residue 25"
FT   gene            134618..135529
FT                   /locus_tag="Kfla_0123"
FT   CDS_pept        134618..135529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0123"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_7294 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29252"
FT                   /db_xref="GOA:D2PRS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29252.1"
FT                   /translation="MAITVPQERLLTSRTTLRRNNAAEYLFLVPAVLFVGFTVLYPLAY
FT                   NVVQSFQDVGIAQIVSGQAKYVGLDNYADQFGRPEFWESFGISLVYTGGTVLVTFVAGL
FT                   ALALFFHRDFPGRNVLRALLLLAWVLPTVVSANVWRWLLDGTYGLLNTVLGTEIFWLGA
FT                   PSTAMIAVVLASAWSFAPFAMILLLAGLQGISGSLYEAARIDGAGAWAQFRRITLPLLK
FT                   PVSLTTVLLCFISTFKTFDTVFLMTQGGPGGATEVLPVYAYKLAFSFYKFDVAAVATTM
FT                   LLVVPVVLSVFYFRSLRKEELA"
FT   gene            135526..136347
FT                   /locus_tag="Kfla_0124"
FT   CDS_pept        135526..136347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0124"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PE00357 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29253"
FT                   /db_xref="GOA:D2PRS3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29253.1"
FT                   /translation="MRRRWPKTVAGVLITFVYLLPVYWMLNTSFKKPADIFATPPQLVP
FT                   LAPTLRSYADAAFGNPAIAKGLANSAVIAIGTTLVTVLVAVPAAYALARLRLRGVSVVL
FT                   MLFLVVQMVPAVNLALPMFAIFSDLGLVNSYAGLILANASLAIPLGIVLLRPYFLSVPG
FT                   EILEAARVDGCSTFTAFVRIAVPISRPGLITLAVISFLGAWGEFVFGLALASDENLQPI
FT                   TVVLAGLTNAFGTRWNDLMAVSAVVALPVIAAFVFLQRYIVAGLTEGATKS"
FT   gene            136344..137246
FT                   /locus_tag="Kfla_0125"
FT   CDS_pept        136344..137246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0125"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG: npl;
FT                   n-acetylneuraminate lyase; K01639 N-acetylneuraminate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29254"
FT                   /db_xref="GOA:D2PRS4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS4"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ADB29254.1"
FT                   /translation="MTSTLEIWAATPTPFGPDGELNLPVVADQGKHLLAHGAHGAFVGG
FT                   TSGEFPALTTAERKALVDEWARTKPAGLALGTHVGHSTLAEAKALAAHAAAAGVDLIAS
FT                   VTPYFGVANTVDTAVDYLAAVAAEAPSVPFLYYHFPAMTGSPYRPSELVAAAVERIPNF
FT                   AGVKFTHEDLLEFDRTRAVSDRIRVYFGRDELLPAALAFGADAVIGSLYNALTPQAHQI
FT                   AAAMATGRLADALVLHEPFRQVAVEAGRYGGVGFVKEWLNACGPDTGVARTPWGPLPTA
FT                   AHDTIERLAASWRAVTPEG"
FT   gene            137250..137927
FT                   /locus_tag="Kfla_0126"
FT   CDS_pept        137250..137927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0126"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   ret:RHE_CH00610 transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29255"
FT                   /db_xref="GOA:D2PRS5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS5"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADB29255.1"
FT                   /translation="MSRSPIYREAQVKLRDFIKARGLGPGDRLPAEAVLAAELGVSRLS
FT                   LREATRSLQTLGVIEAQHGNGLFVSTFSFRPLIEQLPYGLAAPGMALEEILTAREAMEV
FT                   GLMPAVARRAGSDELAECARLAHRMTELEAAGEQITAVDRAFHLLLYKGLGNPLVDNLI
FT                   ELFWEIFVRLGDAIPAPVEGGRGAVHLRIVEALQSGEALDAVQRMQEHFDDVRVRAAML
FT                   RET"
FT   gene            138032..139210
FT                   /locus_tag="Kfla_0127"
FT   CDS_pept        138032..139210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0127"
FT                   /product="Exo-alpha-sialidase"
FT                   /EC_number="3.2.1.18"
FT                   /note="KEGG: pha:PSHAb0159 putative sialidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29256"
FT                   /db_xref="GOA:D2PRS6"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS6"
FT                   /inference="protein motif:PRIAM:3.2.1.18"
FT                   /protein_id="ADB29256.1"
FT                   /translation="MQLTRTLLTLALTLSVAGTVTAGASGPPDSAKGKCVESVPFRSGT
FT                   DGYASYRIPAVVKAADGALLAFAEGRRGGSSDTGDIDIVLRRSGDGGCTWSPQQVVTDQ
FT                   GPNTIGNPAPVVDPASGDLVLLSVRNGPVTETQILRGEASAEDTRRVFVQRSTDDGRTF
FT                   SAPTEITAATKLPNWRWYATTPGHAIALRSGRLLVPANHSIAPPAGSADTGAEAKYYGG
FT                   HSLYSDDGGRSWQIGYVDDNPNGYLNVNETTAAQLPDGRVYFNTREHNGTAPGTRADAY
FT                   SADGGETLVKPFRPQATLIGPVVQASVLSVGSTLVYSGPADPAARAAMTLRTSTDQGVT
FT                   WQPALAVSGLPAAYSDLVSVDRSTLGLLYETGDFSANETITFRRIPLKDVVR"
FT   sig_peptide     138032..138106
FT                   /locus_tag="Kfla_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.638 at
FT                   residue 25"
FT   gene            139207..140469
FT                   /locus_tag="Kfla_0128"
FT   CDS_pept        139207..140469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0128"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="PFAM: Kelch repeat-containing protein; KEGG:
FT                   yen:YE1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29257"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS7"
FT                   /inference="protein motif:PFAM:PF01344"
FT                   /protein_id="ADB29257.1"
FT                   /translation="MSGPVSASAAARRPSAPTPGRRGLLAGGIAVSAAPFVVGHSTAEA
FT                   AGPAGRPSPAGAAGTWSRLPDLPPNRVDWHPAAPVGKSYWTQLGLAGPIAGSHRGHLLV
FT                   GGGANFPEPALTSNRPTTLGKVYWNELFVLRPGATRWSDPIRLPDAIAYPACVSTPYGV
FT                   LVIGGEGFRGGPSGTGLAPAQKFADVFLLRADGTRSALPDLPRPMSYAVAGLLGSTVFV
FT                   AEGPDFFSLDLARPDRGWTALPPWPGPPRSVAVGVAADGRFHLLSGRAQLPDKSWRFYT
FT                   DVYAYDPRRARWSRLPDLPFCVTAGLAHPTRGGFLVLGGDKDLARWNLIQHHTALRDAA
FT                   PPGSPTWTEHNNVITWTYDHHTGFNPEILQYTAGRWKVVGHFPGPPQVTTPAVPHANGL
FT                   AVLTGEIRPGVRTATNWHFRP"
FT   gene            complement(140495..140881)
FT                   /locus_tag="Kfla_0129"
FT   CDS_pept        complement(140495..140881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29258"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS8"
FT                   /inference="similar to AA sequence:KEGG:sce7135"
FT                   /protein_id="ADB29258.1"
FT                   /translation="MNYDEALTKVQRATGVSSREEAQQLALAFLRTLGERLSGGETFDL
FT                   ASQLPLHLAEALPPLGSGEPFGVQEFYRRLAHRTGTDEQTAALHTRALMSLLREAVTGT
FT                   AYAHVLAQLPQEYADLATGPAARE"
FT   gene            complement(140975..142213)
FT                   /locus_tag="Kfla_0130"
FT   CDS_pept        complement(140975..142213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0130"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29259"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRS9"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB29259.1"
FT                   /translation="MDSITFGGTATTLIRLGAFTVLTDPNFLHKGQRAYLGKGLWSRRL
FT                   TEPAVVPANLPVLDAVVLSHLHGDHFDRVARRELDRAVPLVTTEPAAKRLRKYGFATTG
FT                   LPVWSSFELTRDDESLTVEALPGTHARGFMRALLPPVMGSMLVHRRQGEVQRRLYISGD
FT                   TLSGDHLDEIGSRYPDIDAAIVHLGGTRVLFSTVTMDGREGLDCLRRVRPKLTVPVHYD
FT                   DYGVMKSPLSEFLDEVNRDTEDWQIEAPARGETVELGTRDGRAEGDSVAGRLTGASVDE
FT                   AGLGLTWWFGCEPATVWAALSRPELLGEWLGPTVLSDTDFGVFSTRCLDDDVERSGTVV
FT                   TCNPEVSLHVEWSEPGGHPDRIGAKLAPDQRGTLLTLTLQDKSRADAAAYRAVWEQRLE
FT                   RLGRVVGTEALRR"
FT   gene            complement(142287..144350)
FT                   /locus_tag="Kfla_0131"
FT   CDS_pept        complement(142287..144350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0131"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="TIGRFAM: YhgE/Pip C-terminal domain protein;
FT                   YhgE/Pip N-terminal domain protein; PFAM: ABC-2 type
FT                   transporter; KEGG: bps:BPSS1434 membrane-anchored cell
FT                   surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29260"
FT                   /db_xref="GOA:D2PRT0"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT0"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ADB29260.1"
FT                   /translation="MTSIRMALSELRRLTSGRLPRLAVVALLCVPMLYGGLYLYANHDP
FT                   YGRLGKVPTAVVVEDTGTTLSTGEKLAVGPQVADELVRSKSFDWHRVDRADANAGVADG
FT                   RYEFALVLPKTFSADLASSAEFEPRQATLELTTNDANNYLAHTIANQVVAQVTKTVAAQ
FT                   VSETAASKLLAGFSTIHGQVAKAATGAGQLQSGLTSANKGVGQLQSGANQLYTAQKQLS
FT                   AGATKLSSGVSQAGKGAAELATGAGRLSSGLGTLKAKTAGLPAQTKALANGADQVADGN
FT                   EKIAGVGQQVATASSTLLTDLTKLDAGLADRLRQQGFTQAQINQVLAETAKLRTPVVTA
FT                   NTKIQATSKQLNELATGARKVSNGAAALSKATPALTSGISTAANGAAQLNTGAKQLKTG
FT                   LGTLQTGASQLATGERQAVTGQGQLLTGVNSLAGGVGKLKTGATELNTALTNGAKQIPD
FT                   PSPEARKAVAETLGAPVDLQNTSQATADSYGAGLAPFFLSLSCWIGAYVLFLLVRPLSP
FT                   RGLAALQSPFRVALGGWLPPALFGAIQAALVFTVVIFGLGIDTTHPWLTAGFLMLTSLT
FT                   FVAILHALSAWLGAVGKFLGLVLMVIQLVSAGGTFPWQTIPAPLYFFHHVLPMSYAIDG
FT                   VRHLMYGGPGLSLGTDLLVLLSWLAAALLASTLAARNQRVWPAKKLQPELAL"
FT   sig_peptide     complement(144225..144350)
FT                   /locus_tag="Kfla_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.621) with cleavage site probability 0.559 at
FT                   residue 42"
FT   gene            complement(144347..145039)
FT                   /locus_tag="Kfla_0132"
FT   CDS_pept        complement(144347..145039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c0928 ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29261.1"
FT                   /translation="MQLRAYAIGVRGPHAPLLDATSVDVRDHELVLLTGYPGPGHVAAS
FT                   LALSGRLMPDGGEVKLDGRNDPAVLRRRVAVVDAQGVTEPDDALPVRSVVGEELAIAGR
FT                   KAGAKAVQAWLDKHGAAEHAGKRFEHLPVDVRTRLLAELTAARPDVAVVILTMPDRFGG
FT                   DPQGWYGVGRELAARGHGVIVTCAEASARLLGVPAARMGAVDQPEPVKVEAAPADGGND
FT                   SEEAEDDA"
FT   gene            145135..145740
FT                   /locus_tag="Kfla_0133"
FT   CDS_pept        145135..145740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0133"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:blr6538
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29262"
FT                   /db_xref="GOA:D2PRT2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29262.1"
FT                   /translation="MPLPKRRRSATRARLLEGALEVFAERGFHGASVEDICDRAGFTRG
FT                   AFYSNFGSKDELVLALFEATTDRLLEQIAALLPDLANQPGTLLDAVLGLLDDAAPDQRQ
FT                   WHLISTEFTLHALRNPAAAEALVRQRTVFRQRLTELVEEISRTSGLRLSVPAEQFVRLV
FT                   TALHEGARAQTLLEPEEVPAGSLEHTFLPMVLDAISRR"
FT   gene            complement(145727..147307)
FT                   /locus_tag="Kfla_0134"
FT   CDS_pept        complement(145727..147307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0134"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   har:HEAR2349 sulfite:cytochrome c oxidoreductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29263"
FT                   /db_xref="GOA:D2PRT3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT3"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ADB29263.1"
FT                   /translation="MNQPHAPTDRPLDAPGAGSTDSSPRRRTGLVLRAALGGVLAALAG
FT                   LAAGSVAAALLGTRQTPVVAIGSAFIDRVPPWLKDLAISLFGVHDKTALRAGILIVLLA
FT                   LAAVGGLLAVRRYWAGAAVVVVLAGIAVLAAATRPDSGQTGFVPSLVAGLAALLLLRLF
FT                   SRRLAGLRTDPDDGVSRRGFLQLSAGVTLGTIAIGALGKVVGGRRAAVAEAREGLSLPL
FT                   PPSTDPPAGVQAPGAAPWVTPNDEFYRIDTALSVPLIMPSDWRLRIHGLVGRELELTFD
FT                   DLLERPVVHQWVTLTCVSNEVGGDLVGNALWSGVLLKDLLAEARPAGNADAILSTSKDG
FT                   FTAGTPLSTLLDDRQSMLAFAMNGQPLPLEHGFPVRIVVPGLYGYVSATKWLTDIEVSR
FT                   FDRFEAYWTPRGWSELGPIKLSSRIDVPRSKAPAGQVTVAGVAWDQHVGVSRVEVRVDG
FT                   GAWQEATLAADPSTDTWRQWHWSWNATRGNHVLQVRAFDAQGNPQVEAQAPPAPNGSTG
FT                   LHSVDVNVG"
FT   gene            complement(147425..147976)
FT                   /locus_tag="Kfla_0135"
FT   CDS_pept        complement(147425..147976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0135"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ank:AnaeK_4236 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29264"
FT                   /db_xref="GOA:D2PRT4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB29264.1"
FT                   /translation="MTIAPTLSSPLALADAEPTHVTEPWDNDVITAYGLLREAAAELDH
FT                   LMRHSLKRSGLQMAMFELLLRLARSHGEKQRLTSLARELTVTTGGITRLVDRAENLGLV
FT                   RREPCPDDARGSFAVLTEEGKRRLREALPDHLLEIDSLWTSQLADERDLVLGKLRRVRD
FT                   NARRWPNGRPGLGPITSDRI"
FT   gene            148180..149091
FT                   /locus_tag="Kfla_0136"
FT   CDS_pept        148180..149091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG32656 gene product from transcript CG32656-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29265"
FT                   /db_xref="GOA:D2PRT5"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29265.1"
FT                   /translation="MTDQETSPEATSPYGRGFVAACLVLGAILLCGGALVVTDLATSPG
FT                   TPAAGSDAAGAEPGDGRADATGWPADPADGRADDPAAQGDSGTADPGSTGVNAARPASP
FT                   DPAASDPASANSSGAGDPGRSACGLADGDQVVPTEAPAVDGWEVSRRVVVPRSAAHGPA
FT                   EVDPDGFRRCFAHSPTGALFAAYNAVAAVGDQRQAVPTAGKLMLPGPDTDSLLRELRKQ
FT                   RPSSSRDEATQLAGFRILDATRDRVTVLLALPVQSEYMSANLTLVWHRGDWRVVPPRPG
FT                   RPFGAPFAQHRDLDDFVTWRGI"
FT   gene            149091..150374
FT                   /locus_tag="Kfla_0137"
FT   CDS_pept        149091..150374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce6359 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29266"
FT                   /db_xref="GOA:D2PRT6"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29266.1"
FT                   /translation="MCGPMELSCSIREGFATLVTNQFESLAAKVGETATTGLEAVATFW
FT                   VRIDSPTLATQQGSDWTLNGPVQTLHDNVLWVTGTIFCIAVLITGVRLAWEQRAEPLRQ
FT                   LLKATLTLVLVTGAGAAFLQLLISVSDWFAQDVMDRTLEPGQTFDKAVGALVLAGAGSA
FT                   PVNAMPLIAMMFVGVAVFMASVVQVVLLLIRSAMLVLLAGTFPLAAAATNTEVGRAWFR
FT                   KYCAWALAFIAYKPAAALVYAAALELGDAGVNPGPGNRLVSALTGLMMMLLALFALPAL
FT                   LRFAVPVTSAVAGGAAGSGAGLADPGGFASGAISTGRSVFGSASAGRAGGGGGGGGGGA
FT                   TGAVTAGSAAAGAVTAGSAAAGAALNATKKAGGALAGAAAHSAGEPGGGGSSSTGGGSQ
FT                   GWTSRRPPRTTKTAAQPTEQPTGPTGSR"
FT   gene            150606..151406
FT                   /locus_tag="Kfla_0138"
FT   CDS_pept        150606..151406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0138"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bra:BRADO0087
FT                   putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29267"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADB29267.1"
FT                   /translation="MPLQRIALISDVHGNLSALEAVLADIESRGIRRIFNLGDYVGKGP
FT                   RGQAVVDRCQEVCEVNILGNWDDFLPDPDRGYDSEGLRWWKNELREDQWKWLRSLPFCH
FT                   DFVLSGRRIRLFHASATSVHRRVRFDHDEQEFLGLFENTPATGDGPVPTVVGYGDTHDP
FT                   FYEVDLDRRTVFNAGSVGNSMGDPTPVYVILEGVPDTLDEAPFSIQFVRVPYDAPAELE
FT                   IARTLGMPELNGYQSEIIHGIYRGDLYAGTAPTYHRRSVPAAGS"
FT   gene            complement(151604..152680)
FT                   /locus_tag="Kfla_0139"
FT   CDS_pept        complement(151604..152680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29268"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29268.1"
FT                   /translation="MAGPAGVAYGQIYVVSSAEHSDLPESFAGQQNGLCGAVQAGVLFL
FT                   RTGLHTGEVDFTVELHDEAPPIDETWEEIVEASYRPSGEAALTSWGGGGRWPLALDEVD
FT                   YRVRYCGWGMDAGHQAGPPMDGEPLVDRYLLQFWPAPPQPDRVVKQTSAQAAYWHGVAR
FT                   ETPPPPTPEQRAEMERERERKAAEERAAEKLRGWGGTPPSERLEGIWKAYHLALDYRPI
FT                   MDAAERADPQTQWAVTKWLVHRMCVEADLIQFAWITDALERVDHEEHAWQALRIPVDAY
FT                   DPPLPAGGSLFALAGWNHNLDVPSKAMTIFGPFMYDDRLEAVVDALWIARDVFGRDRAR
FT                   AFVPDLWDSFPPLRAAQG"
FT   gene            complement(153154..153798)
FT                   /locus_tag="Kfla_0140"
FT   CDS_pept        complement(153154..153798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29269"
FT                   /db_xref="GOA:D2PRT9"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRT9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29269.1"
FT                   /translation="MTTLADILRGIERGVFPAADLTTSLVPAPSARDTCVLGLTGHLVV
FT                   AADVAGEWFAQHLDADDLAAPLNPPFLYALEQLTGREVNGIDALLLAPAITDPAERAPL
FT                   TADLEPFTDESHPRIRRARRYRDQVRAFTDPRGGLVLTGLGVAGRQEVAIEIPESSRGR
FT                   GLGRHLARTARALVPPGTHLWAQVTPGNAASLRTFLAAGYTPVGSEALLVR"
FT   gene            153959..154885
FT                   /locus_tag="Kfla_0141"
FT   CDS_pept        153959..154885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0141"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   xau:Xaut_1854 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29270"
FT                   /db_xref="GOA:D2PRU0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU0"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADB29270.1"
FT                   /translation="MRKPQLTRAEGLPERVTIYEVGARDGLQNEDAIVDVAVKAEFVRR
FT                   LVDAGLTTIETTSFVHPKWVPQLADAAELLTALDLPSGVRAPVLVPNERGLDRALAAGV
FT                   REIAIFASATETFARKNLNSTLDEQFAMFTPTVERALDAGLAVRGYVSMCYGDPWEGDV
FT                   PVEQVVQVTARLAELGCHELSLGDTIGVATPGQVIDLIGALGQAGVGVDRLAVHFHDTY
FT                   GQALANTLTALREGVTTVDSSAGGLGGCPYAESATGNLATEDLVWQLDGLGIRTGVDLE
FT                   KLVTTSTWMSTHLGKPSPSRVVQALAG"
FT   gene            complement(154996..155256)
FT                   /locus_tag="Kfla_0142"
FT   CDS_pept        complement(154996..155256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29271.1"
FT                   /translation="MSAALISVTDDGVTLLGVISLGVALLSVVEGEVDEGAAEAATSLR
FT                   GSALEPHPLDTTPTATAAYATTLKPDEEARIPRSYWPPIAR"
FT   gene            155333..155557
FT                   /locus_tag="Kfla_0143"
FT   CDS_pept        155333..155557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29272"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29272.1"
FT                   /translation="MYAATSKVVGTVEAALKGMPATKPYQDAASNLRLFQKTYRTMRTL
FT                   GCFAAKKPKEAELCTSLANVARLTLLIAV"
FT   gene            complement(155612..155998)
FT                   /locus_tag="Kfla_0144"
FT   CDS_pept        complement(155612..155998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29273"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU3"
FT                   /inference="similar to AA sequence:KEGG:POPTR_795544"
FT                   /protein_id="ADB29273.1"
FT                   /translation="MVAPLWGPTLDCPEPLELATFYQRICGGSIAAADETFVELRLDGV
FT                   SLGFQRDLNHRAPTWPDPRVPQQCHLDFKTADLDATEAEVIAAGATKTVLQPSPAVFRV
FT                   YLDPAGHAFCLTTWGTPAGPPESR"
FT   gene            complement(156005..156700)
FT                   /locus_tag="Kfla_0145"
FT   CDS_pept        complement(156005..156700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29274"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU4"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_6257"
FT                   /protein_id="ADB29274.1"
FT                   /translation="MAGVARFVASSLAPAAQRFAPQAAAGILRQVLEIAIDGYQRFPGA
FT                   EKLAEQKLAKADGDVAVAIEAVIDQHIRLAGVQGFVTSVGGLVTLPVSLPANLTGLAVV
FT                   QARMVAAIAHLRGYDLGDPRVRTAVITCLLGEDGVTDRLKKASLPTSPLAIATAPVFDP
FT                   ELDRLVAGEVVGELIARVSGKRMALTVTRRVPLLGGAVGAGVDGWSTYRIGEYADKSLV
FT                   RRIPRPIEQ"
FT   sig_peptide     complement(156629..156700)
FT                   /locus_tag="Kfla_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.459 at
FT                   residue 24"
FT   gene            156862..157572
FT                   /locus_tag="Kfla_0146"
FT   CDS_pept        156862..157572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0146"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   acp:A2cp1_1641 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29275"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU5"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB29275.1"
FT                   /translation="MTVVGCAGSAPGPDSGASSYLVDKDGFRLLLDLGAGSAGPLQRYA
FT                   TAEDIDAVILSHAHSDHWADVTQLSYYRSKAVREGSACGPLRIYGPSTMNEVLTSNPDD
FT                   FTSTFVQAGDLELGPLQVRLAQVRHGDLECWASRVDDVLCYTADTEPCAALDELADGCG
FT                   VLLAEASGFDADGPLRGHLTAGDAGRLAARAGARLLVLTHLRAWQDHLRLLDEAAQLAG
FT                   CPVILATPGLRVAL"
FT   gene            157622..158287
FT                   /locus_tag="Kfla_0147"
FT   CDS_pept        157622..158287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0147"
FT                   /product="leucyl/phenylalanyl-tRNA/protein transferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="KEGG: ade:Adeh_0792 leucyl/phenylalanyl-tRNA--
FT                   protein transferase; TIGRFAM:
FT                   leucyl/phenylalanyl-tRNA/protein transferase; PFAM:
FT                   leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29276"
FT                   /db_xref="GOA:D2PRU6"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU6"
FT                   /inference="protein motif:TFAM:TIGR00667"
FT                   /protein_id="ADB29276.1"
FT                   /translation="MPVEPPASVWEFPPVAVAGAGDVVAAGADLEPGTVLAAYRRGLFP
FT                   MPDSHGPLLWWSPLERGVIEVAGFAPSRSLRRARNRYEIRVNTAFDQVIRACADPRRPG
FT                   SWIDRDIIESYTRLHRMGWVHSVEAWDGDELAGGLYGVAIGGLFAGESMFHHKTDGSKA
FT                   AVAGLVELLDDKYAAERVFDIQWVTDHLATLGAVSIPRDQYVRRVQRALELPLPDAFA"
FT   gene            complement(158267..158968)
FT                   /locus_tag="Kfla_0148"
FT   CDS_pept        complement(158267..158968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0148"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_0701
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29277"
FT                   /db_xref="GOA:D2PRU7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29277.1"
FT                   /translation="MNAGRTARDRARAELTREIKDAARRQLAAEGAERLSLRAVSRELG
FT                   MVSSALYRYFPSRDDLLTALIIDAYDALGAAAEDAARAEQDPRAAWLAISRAVRSWAKA
FT                   NPHEYALIYGSPVPGYTAPQTTIQPATRVAAALLGVLSRAQEAGVLVVPADAVEPHDVL
FT                   VEQLAQLIEVAPGVPESLLLRMAMVWTQLFGLISFELFGQLVGTFDPADTFFELAIAEH
FT                   AAFVGLGEGVG"
FT   gene            159086..159547
FT                   /locus_tag="Kfla_0149"
FT   CDS_pept        159086..159547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29278"
FT                   /db_xref="GOA:D2PRU8"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29278.1"
FT                   /translation="MQNYDSNRLITAGSRSMLVFNKIVAGLTKRGISLMGSRVLSVRGR
FT                   KSGEWRSTPVNLLTLDGQTYLVAPRGHTQWVRNLRAHPEARLRLGRTTETFHAVELADA
FT                   DKPEILRLYLKKWAWEVGAFFDKDVRKDSPTERLLEVAPGVPVFRLTPA"
FT   gene            159638..160714
FT                   /locus_tag="Kfla_0150"
FT   CDS_pept        159638..160714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0150"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: afw:Anae109_0100 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29279"
FT                   /db_xref="GOA:D2PRU9"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRU9"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ADB29279.1"
FT                   /translation="MISPEQLTAAPKVLLHDHLDGGLRPATIVELAQEIGHRLPRTDPA
FT                   ELGEWFVESADSGSLERYLETFDHTVAVMQHAEAITRVASECVQDLAADGVVYAEIRYA
FT                   PEQHLTAGLSLEQVVDAVGAGFEHGMAHAERPIVARQLLTAMRHQARSMEIAELAVAYR
FT                   DAGVVGFDIAGAEAGYPPTRHLDAFEYLQRENAHFTIHAGEAFGLPSIWQAIQWCGADR
FT                   LGHGVRIIDDISTDGPDGKVELGRLAAYVRDNRIPLEMCPSSNLQTGAASSIAEHPIGL
FT                   LAKLRFRVTVNTDNRLMSGTSMSRELALLADAFGYDLTDFRWFAINAMKSAFLPFDERL
FT                   AIIDDVIKPWYAANQDLA"
FT   gene            160754..161308
FT                   /locus_tag="Kfla_0151"
FT   CDS_pept        160754..161308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0151"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 4 domain protein;
FT                   KEGG: xau:Xaut_2662 ECF subfamily RNA polymerase sigma-24
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29280"
FT                   /db_xref="GOA:D2PRV0"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV0"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADB29280.1"
FT                   /translation="MQAEVSEGQPGWAVAPVRRADAAAEFSEYVATRYDGLLRMSYLLT
FT                   QDRGLAEDLLQTTLARCWLSWPKIKADNPHHYVRRALVNAHRAWWRVKRTKLEIPTDAV
FT                   PADAADGGYDVLHENTVLLAALARLPRKMCVVVVLRYLEDLSEADTAAVMGCSVGTVKS
FT                   QTSRALAKLRLDPALTKEDWR"
FT   gene            161305..161991
FT                   /locus_tag="Kfla_0152"
FT   CDS_pept        161305..161991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29281"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29281.1"
FT                   /translation="MNPDELRRRLHQAAASVSGEGDPAPAIQHRADGIVRRRATATTCA
FT                   LVLTIASTALLTSNRPGSWPLPTSRLATGGGTVAAGPVECCPDGVSPGLTELPSRTALR
FT                   YQVDRTSMNVRFGDNPAQQRWTTIGPAMAKDSIWLLAACSGAPAEITLAVHRESRSAAP
FT                   VAQQAIACTAHATLTQLQVPESWPDDAQAVLAVGVPSRFGAVSSVVVNAGLYRADPCRA
FT                   RGCAPI"
FT   gene            complement(162024..162977)
FT                   /locus_tag="Kfla_0153"
FT   CDS_pept        complement(162024..162977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0153"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: bmj:BMULJ_02574 AraC subfamily transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29282"
FT                   /db_xref="GOA:D2PRV2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV2"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADB29282.1"
FT                   /translation="MVRKVAVVLMEDVAVFEFGVLSEVFGIDRTDDGVPAFDFKVCSTR
FT                   PGEPLRTSSHSAVIAPYGLEELADADLVALPATTWRDEYDERVLTALRQAADRGAILLT
FT                   VCSGAFVLAAAGLLDGRNCATHWRYADLFRKRYPDAKLDPDVLFVDDGNIITSAGTAAG
FT                   IDACLHLVRRELGSAVATRIARRMVVPPQRDGGQRQYVEVPVPESSGESLQPVLDWMVD
FT                   NLTVEHTVPDLARRARMSDRTFARRFVAETGTTPLKWLTTQRVLHARTLLEQTSLGIEQ
FT                   IAAESGFGTAALLRHHFRRVVGIPPQNYRRTFQTTA"
FT   gene            163049..163330
FT                   /locus_tag="Kfla_0154"
FT   CDS_pept        163049..163330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29283"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29283.1"
FT                   /translation="MITAMTGIVVLAVLVLAVVAVLESSHRRHSTGLRPGPNGSSAAGD
FT                   RDLARSKLDLLALGGTAEPFTHKPVSTTDSVVHLRRARLHTPQSRPAA"
FT   sig_peptide     163049..163111
FT                   /locus_tag="Kfla_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.550 at
FT                   residue 21"
FT   gene            163398..164225
FT                   /locus_tag="Kfla_0155"
FT   CDS_pept        163398..164225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0155"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: pen:PSEEN2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29284"
FT                   /db_xref="GOA:D2PRV4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV4"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADB29284.1"
FT                   /translation="MSDYRELNRRSWDERVPAHAASPDYKLEWFERDPAFISDVVRFDV
FT                   PRLGDVSGLRGVHLQCHIGTDTVSLARLGARMSGLDFSGPAIAQARSFADTLGLEIDFH
FT                   QADVYDAVEVLGAAAYDLVFTGIGALGWLPSIDRWARTVSGLLKPGGRLFLREGHPMLW
FT                   AVSGDRGPDLLTVDHPYFETEEPMVWDEGGTYVQTEVEFQHNVTHEWNHGLGEIVTALL
FT                   SHGLELTALEEHDSVPWPALPGQMTQDEDFGEWRLTDRPERLACSYTLQALKR"
FT   gene            complement(164290..164433)
FT                   /locus_tag="Kfla_0156"
FT   CDS_pept        complement(164290..164433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29285"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29285.1"
FT                   /translation="MGFVKSLFKGAVVAKLAQVAQRELSKPENQRKAKEMFQKVQQRRN
FT                   SR"
FT   gene            164601..165464
FT                   /locus_tag="Kfla_0157"
FT   CDS_pept        164601..165464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0157"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycosylase catalytic
FT                   domain protein; DNA glycosylase/AP lyase, H2TH DNA-
FT                   binding; KEGG: afw:Anae109_0505 DNA-formamidopyrimidine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29286"
FT                   /db_xref="GOA:D2PRV6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV6"
FT                   /inference="protein motif:PRIAM:3.2.2.23"
FT                   /protein_id="ADB29286.1"
FT                   /translation="MGVPELPEVESLAGFLRERAVGRAVVRADITAISALKTYDPPISA
FT                   LVGLLIDDVRRHGKFLDIEAQGVHLVIHLARAGWLRWREQQSTTPVRPGKGPIACRVVL
FT                   DDESGFDLTEAGTQKKLAVYVVRDVAEVPGIARLGPDPFTLSAEDFGAILHEAGRVQLK
FT                   GVLRNQSVIAGIGNAYSDEILHVARMSPFKPASNLSDDELHVLYTAMQETLRDAVDRSK
FT                   GLAAQDLKSEKKSGLRVHGRKGEKCPVCGDVVREVSFADSSLQYCATCQTGGKPLADRR
FT                   LSKLLK"
FT   gene            165538..165870
FT                   /locus_tag="Kfla_0158"
FT   CDS_pept        165538..165870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0158"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: bch:Bcen2424_5472 beta-lactamase
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29287"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV7"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADB29287.1"
FT                   /translation="MTQNPMLPSVPSVVVNDVDDDLLAEAFVLDVREPDEWASGHIAGA
FT                   THIPLGQLQERVGEVPLGQKVLCVCAVGGRSGVATQYLVSEGREAINLDGGMHAWQAFG
FT                   RPVTTD"
FT   gene            166030..169521
FT                   /locus_tag="Kfla_0159"
FT   CDS_pept        166030..169521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0159"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29288"
FT                   /db_xref="GOA:D2PRV8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADB29288.1"
FT                   /translation="MSTPAPPGPEPTREPARLPYRAGVLAAGLAVGGLLVATVQPAAAQ
FT                   PSPDLTTLQQPVEAHRGSSAVSDVPDVALAPPGEGIVTRRSDSPVAPGVTYTSFDRLDA
FT                   RGWLRGDILVADLDAGGVTVDYLNPGTVSGREVLSQQAARKGAIAGVNGDFFDINDTGA
FT                   PLGVGIERDADGGAGRFVNGPAAGHNETAVIGTDGLGRIAQVFLAGSATDDDASKVELT
FT                   NLNSPSVNAGGIGLYTPQWGEAARTRTVDGLPMVREVILRDGVVVSSSATPATTPLAAN
FT                   EQALIGREAGATALGAFEPGDKVEVKYGPRADAADAAVALSGNKQLARDGQILTVDDTA
FT                   LHPRTSIGFSADGRRMVLLTVDGRMVDSRGLTEKELARLMLDLGSDDVLNLDGGGSSTM
FT                   LKRSPGEATPEVVNKPSDGAERLTPNGLGLLPVKGTGRLKGFRVEAAGTANEPADADLT
FT                   RSARVLTGLSRVLTARGHDETFAPVAGTPHWSVGGKARISNEGIVTGRRAGDVVVTAAQ
FT                   GAAYGRFPLTVLGAPVRLAPTTKQVSLPNAGSKGLFGVNGYDADGFSTWVEPRDVQLSY
FT                   DKTLVAVVAKGNGFEVNALGTDAVSTVITAKVGALTTQLSVTAGLSSVVVDEVDELTRW
FT                   QANAVPAGAATASRSVAAGHDGGQAIALDYSLTGSTATRAAYLAATPQQTLPGQPQKLG
FT                   AWIHGDGKGAWLRANAYDGAGGSAQTLNLAAAVDWTGWKYVEADIPPGLTMPLRFWRIY
FT                   VVETVPSRQYSGRIVVDDLTVRGAPPVTVAPAAKVVDPMVVADGKLDGRRWKFAVLSDA
FT                   QFTADAPESDLVKQARRTIREALAQRPEFLVINGDFVDRGFAHDIALAQRIIDEEVAGK
FT                   VPVHYVPGNHESYGPGDLSEWSKVFGAPSSTFDHKGTRFVLRDSSLGSLRAGGFAQILD
FT                   LRKQLDDAAKNPAIRNVVVMAHHPIDDPSPTANSQLGDRKEAELLVRWLAGFRAASGKG
FT                   AAYLAAHAGTFAATRTDGVLLPLTGNSGKGPSGAPDAGGFTGWALVGIDPTARAADAGV
FT                   RRWSAPERAWFQTEFRPHVDALELSAPATLRRGQTATATATVVQENRRVPVAFPVSADW
FT                   TGSTFLHLGPATSAPPWAVAAYDPATNQLTALRPGTVNLTVTVNNTTRTTSIRVDW"
FT   gene            169531..170055
FT                   /locus_tag="Kfla_0160"
FT   CDS_pept        169531..170055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0160"
FT                   /product="protein of unknown function UPF0157"
FT                   /note="PFAM: protein of unknown function UPF0157; KEGG:
FT                   lpn:lpg1614 glutamate rich protein GrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29289"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRV9"
FT                   /inference="protein motif:PFAM:PF04229"
FT                   /protein_id="ADB29289.1"
FT                   /translation="MRLDRITITEYDVHWPALFEQQRRRVEPVLEPWLVRPVDHIGSTA
FT                   VPGLPAKPIVDMVAVITDHRSVAGCFGELAAVGWVPAPEPGDDEARKHSWCYPSVEHRT
FT                   HHLHVVEQASPGWRTWLAFRDHLRADPADRAEYARIKRELAAADDQDRPAYRAGKAPFI
FT                   TAVLSRLPAED"
FT   gene            170120..171037
FT                   /locus_tag="Kfla_0161"
FT   CDS_pept        170120..171037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0161"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   pst:PSPTO_2030 muramoyltetrapeptide carboxypeptidase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29290"
FT                   /db_xref="GOA:D2PRW0"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW0"
FT                   /inference="protein motif:PFAM:PF02016"
FT                   /protein_id="ADB29290.1"
FT                   /translation="MTDVRRPRRLVPGDRVAVVAPAGPIKAERLELGTKYLRDWGLEVE
FT                   VMPSVLARDQRLPYLAGDDAARVADLRAAWLDDRYQGVFCGRGGYGVQRILPLLDLDEL
FT                   AAVEKVFVGFSDITGLHEGFNARGLVTVHGPMAAAVEQLGAEAGRERLRALLFEPESVT
FT                   DLLAPAGARTVVPGTAEGRLLGGNLALLASSLGTPTLANPAGIVVLEDVSENGYRVDRM
FT                   LTQLLRAGWFQHVTGLVIGDFSDTDEGALVAGVIRERLAPLGLPMVVGAAIGHEDLNLA
FT                   VPLGLPVRLDATSATLQPLQVPFR"
FT   gene            complement(171039..171977)
FT                   /locus_tag="Kfla_0162"
FT   CDS_pept        complement(171039..171977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0162"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; protein of unknown function
FT                   UPF0074; KEGG: scl:sce5223 DeoR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29291"
FT                   /db_xref="GOA:D2PRW1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW1"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB29291.1"
FT                   /translation="MSTAGRRLETLAQLQSHPGISAPGLAERLGVTERTVRRDIAQLRE
FT                   LGYRIDGEAGRTGGYRLAHGRAMPPLLLDADEVAAVALSLRTAVGVDGLETAAVTALAK
FT                   LTQVVPSRWQARLTALTEVQALPGQSSRRAGRDVLVPIALACRAGEAVRIRHRSAGSGE
FT                   TKPIEVQPHRLVTLRRLWYLVGCPRGTEDWRVYAVDRIEQVQPLGTRFPAPEPPGDAAQ
FT                   LVAQTLAHGRWRHQVRVRVHTSAELVRELVNPSVAAVIERGDECELHFGTDDLDWAARW
FT                   LAYLNLDLDVLEPELLNDHLRVFGRWLAERY"
FT   gene            172039..172437
FT                   /locus_tag="Kfla_0163"
FT   CDS_pept        172039..172437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0163"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: mlo:mll4506
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29292"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW2"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADB29292.1"
FT                   /translation="MTEIALLRPEGLVNSPAFTHVAVVPPGATTIYIGGQNAVDAEGRL
FT                   VGGDDAAAQTQRVMENIRTALAAVGADVHDLVSMTIYLVEGVDLAQAYPVAAAGLEGAV
FT                   PTVQAVRVAGLGVPGALLEVSAVAAVMR"
FT   gene            172434..172877
FT                   /locus_tag="Kfla_0164"
FT   CDS_pept        172434..172877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29293"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29293.1"
FT                   /translation="MSETGKSHEVSKQVGRTKGAGWQIGVSKTIDRPVEEVWDFVTSPA
FT                   GVAIWLGEGVTVLTAKGTGYQTTDGTHGELRSYRDLDRIRLTWQPPDWSHDTTLQLAVS
FT                   PTGSGRARLVMHQERLADATEREQQRRHWQGVVTALAAAITAD"
FT   gene            complement(172899..174689)
FT                   /locus_tag="Kfla_0165"
FT   CDS_pept        complement(172899..174689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0165"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S15; dienelactone hydrolase;
FT                   KEGG: oan:Oant_3086 peptidase S9 prolyl oligopeptidase
FT                   active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29294"
FT                   /db_xref="GOA:D2PRW4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW4"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ADB29294.1"
FT                   /translation="MLPALLSLPSLVAFDIDSEGRLLIGYDGSGVRQVHEVAPDGTWRA
FT                   LTALSERVVAAKYVPGSRRVVVEHDTGGDERGQLSLLDLSEPGDLPTLQPLVHDAAYFH
FT                   HLVTARPGRVLFTTNRRNDVDFDLVALDLGTGTQTTLYDVGGYLATVEPSPDDRWVGVI
FT                   RAGGPANSGHVLLVETSTGRITDVTAYEDETCALELSWLPDSTGLLVSSDAGRDRIAVF
FT                   RYDVADGSTTELVTDAESDLIGWASPSGQHLLVARSADGAVTLALHSTEGERLTPIELP
FT                   PGGCAALLVESAPHWSPDGGQLVITYSSPAEPPYVFRYAVATGETVAVRAPEAAELPAG
FT                   LRQPSSHRVASFDGEQVPVFVYRPESGGDGSAVIVVHGGPEWHAGLVFNPLVAGLVAEG
FT                   HTVLVPNVRGSAGYGKRWYALDDRELRLDSVRDLAALHAWLPEIGVDQSRVALWGGSYG
FT                   GYMVLAGLAFQPELWAAGVDIVGIASLVTFLENTSAYRRVVREREYGYLDRDREFLELA
FT                   SPLNRVDAIEAPLFVIHGANDPRVPLSEAEQVVAALAKRGVTSELLVYPDEGHGLAKRK
FT                   NKLDAYPRAFAFLREQLGRE"
FT   gene            complement(174716..176494)
FT                   /locus_tag="Kfla_0166"
FT   CDS_pept        complement(174716..176494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0166"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   maq:Maqu_2187 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29295"
FT                   /db_xref="GOA:D2PRW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29295.1"
FT                   /translation="MKRPEYDPAAPQEAARLPVAGPATVRAYLKTLFRRHRRSFAWLTV
FT                   VNAVAALSGMVGPWLLGGVVEKLSLGERDVQLPYVVLGFVVALLVQTVFVRITRLRGAV
FT                   LGEEMLADLREDFLVRSVALPPGVLERAGTGDLLSRITTDVDRLSHAMRDAVPQLTIAV
FT                   VWAGLLIGALVVTAPELAVALVIAAPILIVGGRWYFRRAPSAYRSEAAGYAAVASALAE
FT                   TVDAGRTVESHRLGRRRIELGDTRIGQWVGWERYTLFLRMILFPVINMTHAVALAAVLT
FT                   IGGALSIQGWITVGALTTGALYIQMLVEPVNMMIRWYDELQVAQVSLARLVGVREIEEA
FT                   ADGDEREPDGRTVLADEVRFGYLEGRDVLHGVTLTVEPGARVALVGPSGAGKSTLGRLL
FT                   AGIYSPRVGDVTLGGAALGKMSAEQVRTHVALVNQEHHVFVGSMRDNLLLARPDATDAE
FT                   LWDALRSVDAHAWVAGFEHGLDTEVGSGGTTLTPAQAQQVALARLVLADPHTLVLDEAT
FT                   SLMDPRAARHLERSLAGVLEGRTVVAIAHRLHTAHDADVIAVVEDGRIVELGGHDELVD
FT                   ADGPYAALWHSWHGDR"
FT   gene            complement(176491..178272)
FT                   /locus_tag="Kfla_0167"
FT   CDS_pept        complement(176491..178272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0167"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; KEGG: mex:Mext_2356 lipid ABC
FT                   transporter ATPase/inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29296"
FT                   /db_xref="GOA:D2PRW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29296.1"
FT                   /translation="MSLRLVPFADPGVPDTRSGLRLILWLERRQLRGQFAALGWGMLYF
FT                   GGIAAAPVAVGIAIQAVIDKSWSRLMLAGVLLLAFGAAKSAADSYFHRAVVTNWICTAS
FT                   RLQQLLFRKASELGSLLTRRIAAGEVVAVSSGDVEKIGWFVEVLGRFAAALLTCFAVVV
FT                   GLLLYEPQLGLVVLVAVPVLAFSIVPLMGPAERRADLQRAKGGRATELAADTVAGLRVL
FT                   RGIGGEQLFLDRYRSASQEYRASAVHSARMWSLIAALQVLLFGLFLVAVVWLGVRLVLA
FT                   GRITVGELVTTYGFVTFMMVPLHTFEETASAFIFSKVSARRAARVLSLQRMDDTRGTGA
FT                   AQVPEGDLLDPVSGLEVPAGGFTAVVCGNPDAGGRLADRLGGHSPEAEPGDASVLLDGV
FT                   ALDDLPLESARTAVLVQDKDPVLLSGTVRNLFDVPSSGAVTVEQALEAAQCADILDVLR
FT                   QSLPAGGPTDPMDAVLTERGRSLSGGQRQRVALARSLYVDPAVLVLDEPTSAVDAHTEA
FT                   RIADGLRALRSGRTTVVFTSSPLMLDRAERVVFVPDGQVVAVGTHHELVHSERQYRAVV
FT                   TRAVLTDEGEPTLEESV"
FT   gene            178472..179890
FT                   /locus_tag="Kfla_0168"
FT   CDS_pept        178472..179890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0168"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_2818 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29297"
FT                   /db_xref="GOA:D2PRW7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW7"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB29297.1"
FT                   /translation="MPELTRRRRLLVLGICCLSLFIVGLDSTIVNLALPAIRADLDASV
FT                   SKLQWTIDAYTLVLASLLMISGSTADRVGRRRTFQVGLVLFGLGSLLCGLAPTVDLLIA
FT                   SRMLQAIGGSMLNPVAMSIITNTFTDPRERAQAIGVWGGVVGLSMSVGPLAGGALVDSA
FT                   GWRYIFWINVPVALAALLLTAKFVPESRAAVARRIDPVGQVLVVLLLVGLTFGIIEGRA
FT                   AGWASPLIIGCFTIAVASLAGLVAYERRREEPLLEPRFFRSAPFSGATLIAVAGFAALA
FT                   GFLFLNSLYLQEVRGFSALHAGLLTLPMAAMTVVFAPLSGWLVGNRGPRLPLVVAGLML
FT                   TASGLILSRLTTSTPTVELLVAYLVFGLGFGMLNAPITNAAVSGMPRAQAGVAAAIAST
FT                   SRQVGASLGVAIVGTVLTARLTGALETGFVSAAHLCWLIIAGCGALVLVLGLVTTSRWA
FT                   RRTADAVADDLARI"
FT   sig_peptide     178472..178546
FT                   /locus_tag="Kfla_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.601 at
FT                   residue 25"
FT   gene            complement(179952..180980)
FT                   /locus_tag="Kfla_0169"
FT   CDS_pept        complement(179952..180980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0169"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: ecz:ECS88_2201
FT                   hypothetical protein from phage origin"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29298"
FT                   /db_xref="GOA:D2PRW8"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW8"
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /protein_id="ADB29298.1"
FT                   /translation="MGGVEVRDWAQQAAAQYERMHQQYVGGARKLEALIDELIGEEEGI
FT                   NYLSATARAKDPESFLAKASKAHPEDPDRPKYDDPLNQITDLVAARVITFLVEAVDRVC
FT                   EVIEAEFEIVEHTDMGAHTRAQGVFGYASKHYLVRLNAHRRELPEYAVLRHLVMEIQVR
FT                   TAVQHAWAEFEHDIRYKLDIPPDRKPEFDRRFLLAAALMELADNEFTEIDRLYRELAAA
FT                   ADDEAPRDLTPATLTTYLTRRYPDAPHAKTNHYAWILGILAELGVTTEEQLTELLQGID
FT                   SAAVQAAMTHRFPAGTVRRLDDDLLAAKGAQYVELFPDEERRQKILRGRLKALARAGLA
FT                   EL"
FT   gene            181142..181495
FT                   /locus_tag="Kfla_0170"
FT   CDS_pept        181142..181495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29299"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29299.1"
FT                   /translation="MDGRQVIERLLNGGLDARYIAVAAGQELETWQREGLADASSGESD
FT                   RYEELLVNPALVLLARQRGDIDCGGLNYLVIRYGNFFQVVVPTGAGHVSVAVEPTGDPV
FT                   AVADRIGRLLAAA"
FT   gene            181546..182865
FT                   /locus_tag="Kfla_0171"
FT   CDS_pept        181546..182865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0171"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   mlo:mlr1373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29300"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX0"
FT                   /inference="protein motif:PFAM:PF06224"
FT                   /protein_id="ADB29300.1"
FT                   /translation="MAAVRRPVGEAISRDAARRIALTAQGFAEPRPTGRVDVRHLRRMI
FT                   EQVGVLQVDSVNVLCRSHYLPLFARLGPYPRATLDRMCWGADRELFEYFWGHKASLLPL
FT                   SSYPLLRWRMRAAERQDWNADPDPELAVPWSVVTGMRRLSTERPGLVDDVLARVADRGP
FT                   IGAGEADPDGRRRKPGDPDPDPTTGRMWNWQDAKIAVEYLFCAGRVTIAARRNFERLYD
FT                   LSERVLPADVLQAPELDGDQARRELVRSSARTLGVATAQELCGATHGHYPLPRATARQA
FT                   VDELVEAGDLVPVRVEDTPQQSYRWRDADDGPIQARALLSPFDTLIWNRDRTHRLFDFF
FT                   YRISIYTPQSHRVHGYYVLPFLLGDRLVARVDLKADRRTTTLLVPTVTPEPGVPISYLV
FT                   DPLAAELTQLAHWLDLTQIHVTATSNLGRALSQAVATADQ"
FT   gene            183169..183447
FT                   /locus_tag="Kfla_0172"
FT   CDS_pept        183169..183447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29301"
FT                   /db_xref="GOA:D2PRX1"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29301.1"
FT                   /translation="MLSVEVDKWSKNEDLTITVAHPDDGSAVAISGAADLDPVPKVGNS
FT                   IPVIVDPDDPSNVLAADADWVMHWYWYALVVVIGLVLAGMFLGIALG"
FT   gene            183514..184707
FT                   /locus_tag="Kfla_0173"
FT   CDS_pept        183514..184707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0173"
FT                   /product="ATPase"
FT                   /note="KEGG: geo:Geob_1221 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29302"
FT                   /db_xref="GOA:D2PRX2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX2"
FT                   /inference="similar to AA sequence:KEGG:Geob_1221"
FT                   /protein_id="ADB29302.1"
FT                   /translation="MDPIRNPYAPGAGQRPPELAGRDTEVRQFEVVLERVAAGRPERSL
FT                   VLSGLRGVGKTVLLNTLRSQAIKRAWGTGKIEARPDQSIRLPIAQAMHTAMRELGHRHR
FT                   DDDRVDQFSAVLKAFALRTAQNDRKGIRWHPPVDVVAAKGRADSGDLEMDLIELFADAA
FT                   DLAGDLSVGVGLFIDEMQDISTDDLSALCAACHEISQQSAPLVVVGAGLPHLPAVLSAS
FT                   KSYSERLFRYIRVDRLARDACDRALMIPAESEDVYFEDEALDELYAQTDGYPYFVQAFA
FT                   HATWDHAPASPITVKDVAVAAPEASAELTVGFFGSRYERATPAEREYMRAMAELGVGVA
FT                   DGSVPTAEVASTLNRKPQSLSPARDGLIKKGLVFSAERGTVAFTVPHFGKFLRTRTA"
FT   gene            complement(184717..185775)
FT                   /locus_tag="Kfla_0174"
FT   CDS_pept        complement(184717..185775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0174"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: tbd:Tbd_1489
FT                   Appr-1-p processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29303"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX3"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADB29303.1"
FT                   /translation="MIRNVTGDLLRQDADALVNTVNTVGIMGKGIALQFKRAWPQMFED
FT                   YVAACERGEVQLGSMHVWTPDALPPPRYIINFPTKQHWRSRSRLSDIETGLQDLARTIA
FT                   DLNITSIALPPLGCGNGGLDWADVEPLIHSYLGPVAHKTDVRIFAPAGAPEPQKMVNRE
FT                   KPPPLNSTRSAMLALIHAYVQFTFGPPSLIEVQKLAYFLQLSGEDLNMEFRPHIYGPYA
FT                   DALRRALSAMEGHYITGFGDGSARVADAAPIEVLPEAVSQVESYIAEHPETAARIASVM
FT                   DEIAGFESAYGLELLASVHWVMTHDAEARSSLEAAHTAVRRWSQRKSTLFTPSHVERAW
FT                   RSLHERRLLQAI"
FT   gene            complement(185808..186446)
FT                   /pseudo
FT                   /locus_tag="Kfla_0175"
FT   gene            186594..187451
FT                   /locus_tag="Kfla_0176"
FT   CDS_pept        186594..187451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29304"
FT                   /db_xref="GOA:D2PRX4"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29304.1"
FT                   /translation="MTTRRTGQRASTRARGRRRAGRHSRKKSYKAQWFSVTALAVLGTV
FT                   MVVHPDAGRQTLAAQFGEVTASREATLPPVIVPPTPVPTPTATFTKPQRPAPSLIRPPK
FT                   GAKPNVTVSSGKLGVVPGTDKATRDVGTMTYRVEIEQGLSFNGAAVAAAVHKTLTDPRG
FT                   WQALHQVSFERTDRPDADLRIILATPTLTDKLCLPLDTGGEVSCRVEDRVVLNAKRWMY
FT                   AVPAYAGKIDLYRNYLVNHEVGHALGYGHSPCPEPNTPAPVMMQQTKGLDGCLPNAWPT
FT                   TKAT"
FT   sig_peptide     186594..186752
FT                   /locus_tag="Kfla_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.244 at
FT                   residue 53"
FT   gene            187517..188368
FT                   /locus_tag="Kfla_0177"
FT   CDS_pept        187517..188368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100120494"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29305"
FT                   /db_xref="GOA:D2PRX5"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29305.1"
FT                   /translation="MSSPQFPTYGRGDDPDDEDRSEYYAKPAPYGPGNYSHPPYPAPPG
FT                   PGQPQAPAGPGQPPLPGYGPGYGQPADPGHPQPADAYTQPPAYRPGHPYGAAASPQPHE
FT                   LPTYGPTPGPRRDPRAARVVLLATIIAAVYGLLVVSVQRVSLRDISQAPGSPLNHPLRT
FT                   DVIDTIGQLLTVVVGVAALVMWLRDLRVRRQARRRPDPVELAGLGLVGLSLIPILIWAG
FT                   IVLSTGLGAVDESLDRLPTAYGWGGLGLLVLALGFALGYRELKPEIPNPVVQAAPERPP
FT                   WE"
FT   gene            188359..189042
FT                   /locus_tag="Kfla_0178"
FT   CDS_pept        188359..189042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_1448 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29306"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29306.1"
FT                   /translation="MGMTPLAVLVPGLGLGPESYGPTRKHLEIPSEVITLPGFGYPADK
FT                   HDDLRVDAQADRLAAEVKDRRPEGRALLVGHSASCHVVVAVAVAYPELVSGLVLIGPTG
FT                   DVEASSWPRLAERWVRSAVWERPYLIPTLSKQYFRTTFRAMARAEDVGRHYNLAAALVH
FT                   VGVPTVVLRCRHDSLCPPEWAQRVADLAGGEAWTLPSGSHMPVLTNGRELAAFIHRTAG
FT                   VYKTG"
FT   misc_binding    189067..189194
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 48.26"
FT   gene            189187..190518
FT                   /locus_tag="Kfla_0179"
FT   CDS_pept        189187..190518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0179"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: bxe:Bxe_A3437 nucleobase/cation symporter,
FT                   (NCS1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29307"
FT                   /db_xref="GOA:D2PRX7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX7"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADB29307.1"
FT                   /translation="MAFTAVRKSTPVPTEAPLVLTTDAPRTLGFWDQFTLWGNLGISLF
FT                   GPVTGALVAAYTGSLVKGLLAVVVGCGMGALVLGGAAVFGSQTGAPAMASLRGLFGRRG
FT                   SAAPTVLNIAQNVGWATMEIIVISQAAVAVTSERWRWLFVILAGVLATAMAVRPLGSVK
FT                   LLRKFMVWLVLLASVYLFFQVLSKPVHDLPQDSVFGFWPAVDLAAAGVVSFAPLAADYT
FT                   RHSRTNKAAFAGSALGYGLAAILYYGLGVLAVATLQTNSADVITALVTLPAGAIALFVL
FT                   LVDEVDEAYANVYSTTMAAHNLVGHLDRRWISVVIGVIATVLALFVDLGNYTQFLYLIG
FT                   SVFIPLFAVAIADFFLVSRMRWDVSDTAPFRWQPAAAWLCGFVAYQLVNPGTVGGWSPF
FT                   WLELQSTVFAGHAVPGWLGATYTSIVVSMVAAVAFGAIGRRRAA"
FT   gene            190610..191290
FT                   /locus_tag="Kfla_0180"
FT   CDS_pept        190610..191290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0180"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mlo:mlr6226 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29308"
FT                   /db_xref="GOA:D2PRX8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29308.1"
FT                   /translation="MLNSALRSRAEYAELGAEGLASRTTPERDAATVRAVEELLEGRES
FT                   VLDLCCGYGRIALPLRRAGKVVRALDISPNLVAAGQAQAAEQDLKIDWAIGSMTDLPYR
FT                   SDSFDAVICLWTAFHELFAEDEQLSTIWEISRVLKPGGLAVIEGPIWGPATASEIANGL
FT                   RQGPEHRIVTTEHFGSSSIHFIHDEASYGRLCAAAGIKDYQVYKRDWGGRRRLILEIHQ
FT                   PTSS"
FT   gene            complement(191436..192005)
FT                   /locus_tag="Kfla_0181"
FT   CDS_pept        complement(191436..192005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0181"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: pmy:Pmen_1887
FT                   methylated-DNA--protein- cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29309"
FT                   /db_xref="GOA:D2PRX9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRX9"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADB29309.1"
FT                   /translation="MNDLERRLAQLGGPRPSRPPVLPEADVSYTLHDSPIGRLLLAVAG
FT                   GKVVASSFGDEETLTNRLAQTISPRVLRQAGPLDDVRRQLDEYLDGRRKTFELAVDLTL
FT                   ATPFQRLVLSDLPQHTSYGRTTTYGELAGEIERPKAARAVGTALGANPLCVVLPCHRVI
FT                   GANGALTGYAGGLDAKRFLLNLESKS"
FT   gene            complement(191998..192492)
FT                   /locus_tag="Kfla_0182"
FT   CDS_pept        complement(191998..192492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0182"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; KEGG: ret:RHE_PC00138 RNA polymerase
FT                   sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29310"
FT                   /db_xref="GOA:D2PRY0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB29310.1"
FT                   /translation="MVAKKTSLPPFQLLLDEHWRDVVRLARALAGRVDGDDVAQRAWEK
FT                   AYAAYPKLTSARNLRSWLLTITARCATDVHRARRPQSPLEEAPPVAVDGPDAAEWPDPI
FT                   LWKAVNALPERQRVAVTLKYVGDLDHHGVAAALGTTPAASRRLVSDALATLRTTLGADD
FT                   E"
FT   gene            192569..192745
FT                   /locus_tag="Kfla_0183"
FT   CDS_pept        192569..192745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29311"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29311.1"
FT                   /translation="MARLSSFLIDFDETVFDMTTTGEHRGEGRTVTLPVLTTRLLTRRR
FT                   VIDQMLTASATCR"
FT   gene            192884..193435
FT                   /locus_tag="Kfla_0184"
FT   CDS_pept        192884..193435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0184"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: dac:Daci_0096 flavin reductase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29312"
FT                   /db_xref="GOA:D2PRY2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY2"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADB29312.1"
FT                   /translation="MSVHAFNPAQNRRPGLSVVPDHTEERPVDTDLFRSVFRRHAAGVV
FT                   VITADAGHGPAGFTATSLVSVSSLPPLVSFSIATSASSWPTVQAARSLVVNFLDAGQRD
FT                   LAGRFATSGIDRFAEPTRWSRLRTGEPVLDDAPSYLRALVEHRFAVGANHIVVARLAVH
FT                   AERRIHDPLLYHDGQYVTTA"
FT   gene            193464..194519
FT                   /locus_tag="Kfla_0185"
FT   CDS_pept        193464..194519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll9181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29313"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY3"
FT                   /inference="similar to AA sequence:KEGG:mll9181"
FT                   /protein_id="ADB29313.1"
FT                   /translation="MLKNRLAVLAGAAAAITLLAGCGGDAAAGGGPKLALDAALPASVP
FT                   DGARIVVGDPTTQKALELSGQLGKVTKFVQFANLSGGPQTTEAFRAKALDVGAVAEIPP
FT                   IHATWTGLNVRIVASKFRQDPLNHPIYELGVAPGVEVKTLADLRGKKVAYSPGQAQGAL
FT                   VLKVLKKAGLTKEDVELVELPSTGDIYPNALAARQVEVAPIGGVAIKRYLSKYGKDGAT
FT                   TIRHGLRDDAAHLYVQTASLEDEGKAAAIRAYVAAWGVAQDWIDKHPKQWIEGYYVKDQ
FT                   GLSQADGEWLVDNAGHPEITADWSAAIERQQETIQLLAKETGNEEIKAADLYDLRFQAV
FT                   AAEAIKAGAAK"
FT   sig_peptide     193464..193547
FT                   /locus_tag="Kfla_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.618 at
FT                   residue 28"
FT   gene            194516..195373
FT                   /locus_tag="Kfla_0186"
FT   CDS_pept        194516..195373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0186"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce0166 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29314"
FT                   /db_xref="GOA:D2PRY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29314.1"
FT                   /translation="MSGQTATIGGVRAKREQQAVTTRPVRRRRRLGPGKPIRFGAAIGP
FT                   VLLLAIWSIGSAAGWLDPRVLSAPWTVVTTTGDLIADGRLQSNLLTSTQRAFVGLGLGI
FT                   LLGTVLALASGLSRIGEAVLDGPIQIKRAIPSLALLPLLILWLGIGETMKITTITLGVF
FT                   VPIYIHTHNGLRTIDSRYVELAQTVGLSRWTFVRRVVLPGALPGFLLGLRFAVTGAWLS
FT                   LVVVEQINSTSGIGYMMELARTYGQTDIIIVGLVLYGILGLLSDGAVRLIQRKALSWRR
FT                   TLAD"
FT   gene            195349..196077
FT                   /locus_tag="Kfla_0187"
FT   CDS_pept        195349..196077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0187"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce0167 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29315"
FT                   /db_xref="GOA:D2PRY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29315.1"
FT                   /translation="MATHTGGLVLEKAVEVRGLVRSYGDRAVLDDLDLSIAPGEFVALL
FT                   GKSGSGKSTLLRALAGLDHDVDGHGELVVPANVSVVFQDSRLLPWARVLDNVVLGLRTA
FT                   NAENRGRQSLAEVGLAGREKAWPNELSGGEQQRVALARSLVREPELLLADEPFGALDAL
FT                   TRLKMHALLRKLCAAHRPAVLLVTHDVDESIVLADRVIVLDEGRVAAEQRIEPAISRSP
FT                   ADPGFAAVRSRLLDALGVSL"
FT   gene            196074..197426
FT                   /locus_tag="Kfla_0188"
FT   CDS_pept        196074..197426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0188"
FT                   /product="monooxygenase"
FT                   /note="KEGG: scl:sce0168 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29316"
FT                   /db_xref="GOA:D2PRY6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY6"
FT                   /inference="similar to AA sequence:KEGG:sce0168"
FT                   /protein_id="ADB29316.1"
FT                   /translation="MSKQLHLNAFLMSTGHHEASWRLPESNPLANTDVEHYRELARIAE
FT                   RGKFDSVFFADSPVLFSDVGRRPAGSLEPTVLLTAIAAVTSRIGLIATASTTYNEPFNL
FT                   ARRFASVDHVSAGRAGWNVVTTAGPEAAKNFNLADQPAHAERYERAAEFLEVSFKLWDS
FT                   WQDDATLADKESGVWGENAHVRPIEHVGRHFQVRGPLNLPRSPQGYPLIVQAGSSEDGK
FT                   GLAARYAEAVFTAQQTLADAQAFYSDLKARTAALGRNPDGLKILPGIVPVIGATEAEAL
FT                   ALERELDELIKPEYAREQLARTLRVKPEDLPFDRQLPADLPDEDEIEGAKSRYTLIVTL
FT                   ARREQLTVRELIGRLGGGRGHRTFSGTPEQVADAIQEWFDAGAADGFNIMPAVLPSGLV
FT                   AFADHVVPLLQQRGLFRTEYTGTTLRDHYGLPRPSGRREQDPSKSLQEATA"
FT   gene            complement(197436..197618)
FT                   /locus_tag="Kfla_0189"
FT   CDS_pept        complement(197436..197618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29317"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29317.1"
FT                   /translation="MTAALELVGTNVLPDTLRATAVHGTVCFTGMLSDTLDEIAEGHQL
FT                   MEDGGAGGKLVVRIG"
FT   gene            complement(197615..197779)
FT                   /locus_tag="Kfla_0190"
FT   CDS_pept        complement(197615..197779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29318"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29318.1"
FT                   /translation="MRAVVLPGPVAAKDLMSRGPLPDPPAGWIRIKVDHPLVDDGDGAA
FT                   QVREICPPG"
FT   gene            197886..198743
FT                   /locus_tag="Kfla_0191"
FT   CDS_pept        197886..198743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0191"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: gbm:Gbem_3150 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29319"
FT                   /db_xref="GOA:D2PRY9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRY9"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADB29319.1"
FT                   /translation="MAKRPSVVAHRGASEISPEHTLAAYQRAVTAGADGLECDVRLTSD
FT                   GHLVCVHDRRIDRTSTGRGVLSTMSLEELDVFDWGSWKNPWAELDDESELAGPDLTKVL
FT                   TLETLLATVRDAGRPIELAIETKHPTRYAGLVERRLIETLDRFGWAHPKVGSESPARVM
FT                   SFSWLSLRRMRSMAPGVRTVLLMDRIPLRFRDGSLPTGVSYAGPSVELVAAHPEYVDRA
FT                   HKHGHQVHVWTVNTAEDVRYCHALGVDAIISDRPELAVATLAEHPDRPPLPAARSRRRT
FT                   GLPR"
FT   gene            198927..199343
FT                   /locus_tag="Kfla_0192"
FT   CDS_pept        198927..199343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0192"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: avn:Avin_48530 phosphate regulon histidine
FT                   protein kinase; PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29320"
FT                   /db_xref="GOA:D2PRZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29320.1"
FT                   /translation="MSSATLPADVSVVDVVLPHEVSAVADARRRLLGYLQRARVADNVR
FT                   DDAQLVLSELLSNAIRYAPPLPSGDVRAAWWLDKAGIHLEVTDGRGETEPQRISDAHPE
FT                   SLGGRGLAIVDVLTSAWAVRTSDRQRTVHAVVPL"
FT   gene            199394..200362
FT                   /locus_tag="Kfla_0193"
FT   CDS_pept        199394..200362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0193"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: hypothetical
FT                   protein LOC100209583"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29321"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ1"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADB29321.1"
FT                   /translation="MGKKSRNRAKNTTTVTLDPADLVDVGPREPCPCGSGKRFKQCHGK
FT                   DRAQAADAFVVRPFEGLPAECDLIAFREIVPAGTAEVTLAGEHQDRKVTLVTLLPMAMP
FT                   GLVRDDESIWIGLQTHASSGDPSRDVAHAITAALETEPGNPIQLGDLLKDGPRLQDLLD
FT                   TSKPIVAKVHEGFDFWVGENVEDPTGEVAAGLERANAAAAPTVRLESVEAAYWTQIGDR
FT                   RYLRWVLPYAEDELLDALARLHAAGNSALTDGSRLIGSFRALGVLAPVWELPADTEAAD
FT                   LEKPAAEFATALEKALAADAALTTEERAARAGLASRQLTIR"
FT   gene            complement(200718..201914)
FT                   /locus_tag="Kfla_0194"
FT   CDS_pept        complement(200718..201914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0194"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: asa:ASA_0222
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29322"
FT                   /db_xref="GOA:D2PRZ2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ2"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ADB29322.1"
FT                   /translation="MTEAYGVDSEVGPLRTVMLHRPGNELRRLTPRNNDKLLFDGIPWV
FT                   GRAQDEHDAFAQALRDRDVEVLYLGRLLTEALGDPEARATAVTGATEDLRLGDSLRDYL
FT                   RTALTALDPEQLAEALMAGVRNDEVRAGGLVTSLLADEDFLIDPLPNLLFTRDSSVWIR
FT                   DSVAVTSLAMPARVRETQLTELIYRFHPRFAGADKVYDHQLEHVEGGDVLALGPGVLAV
FT                   GVGERTTPAGVERLARRVFAKDLAHTVLAVPIAQQRATMHLDTVCTMVDVDAVLMYPNM
FT                   AEEMRALAVTTDGEQLHVAEPEPFLVAAAKALGIDTLRRIDTGLDPVTAEREQWDDGNN
FT                   TLALAPRVCIAYERTVETNARLEESGIEVIRISGSELGSGRGGPRCMSCPVLRDPLVL"
FT   gene            202116..202868
FT                   /locus_tag="Kfla_0195"
FT   CDS_pept        202116..202868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0195"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rsh:Rsph17029_0824 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29323"
FT                   /db_xref="GOA:D2PRZ3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB29323.1"
FT                   /translation="MSGNDQPSVEQQRAVACVIPAKDEAARIAATVDAVRKIVGVDLVV
FT                   VVDDGSTDGTSEEAERAGAVVVRHERNRGKAAAMETGAAEVARRDGARPRHLLFLDADL
FT                   TDTATGAEPLIAPVQAGQADMTIGTLPAQVRADGSKAGGHGFVVRLARDGIALATGWAP
FT                   EQPLSGQRCLTRAAFDAAVPLASGFGVETALSIDLGRKGFRILEVPIEVRHRATGTDWR
FT                   GQLHRGRQFLHVRRALAARSALPPRKAL"
FT   gene            202865..204427
FT                   /locus_tag="Kfla_0196"
FT   CDS_pept        202865..204427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_3288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29324"
FT                   /db_xref="GOA:D2PRZ4"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29324.1"
FT                   /translation="MSTDQSTGEQIARAERDGRRAVGLYLVSAALIVAVGLLGPSVVVL
FT                   TLTNRHAWLPSYWFDAKPNDWLVSVMIYVAILLGGYGVFLAARALKNGWAPQVRRLVAL
FT                   GIGTTAAITLVPPMASGDVLIYAAYGRIMSLGGNPYTTAPADTIRLGYDSVIAATERPW
FT                   QGARSVYGPIATWIQWFSSWVGGDSMQLTVWMLQLTVAVSLVVTGLLLLKLVGPNPVNR
FT                   RRVVMLGLANPLILWTVLAGAHNDAIAVMFAVVALVLFRRHVFAAGLMLGVAGCTKLSI
FT                   GLVGVAMLWSLRDDRRRALQFCAGGAIAMIGLYSVVGLQAFQQARSQTSFISTGTPHKV
FT                   IFSLFDLFLPGPLVRTVIGVAAWIGLVLVAILLSQVFPKSLVPRTHPEDRTPDAIRYTA
FT                   IYAVAWLLTAMYSLPWYDVIAWMALAAVAGSKVDKLMVIRTTMLAIAYVPGRDPNARQV
FT                   AASLSDSLEWFSARLRDTVAPAVELAVLIGLILWARRGGAQWWPYDWPRRKAKAKSEQT
FT                   VSQ"
FT   gene            204461..204778
FT                   /locus_tag="Kfla_0197"
FT   CDS_pept        204461..204778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0197"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   neu:NE0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29325"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB29325.1"
FT                   /translation="MHKLSGAGQYAAAEPNHFAEHLRTESLSVGTYSIPAGGVDDQAPH
FT                   REDEIYVVTSGRASIVTPGGAEPVGPGDVLFVPAGEPHHFAEVTEDLALLVFFAPPYSG
FT                   R"
FT   gene            complement(204843..206138)
FT                   /locus_tag="Kfla_0198"
FT   CDS_pept        complement(204843..206138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0198"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   dol:Dole_2215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29326"
FT                   /db_xref="GOA:D2PRZ6"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ6"
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /protein_id="ADB29326.1"
FT                   /translation="MRVAWIDCSAGASGDMLLGAFLDAGADPTVVNAAVSAVDPSLSVR
FT                   VEAAVRHQIAATKASVYVHDEPHPENDPNAAYAGTEHGEGVEGGHGHGVGAGHGHVHSG
FT                   SGGGGTRSWAEVRGVIEAAGLDDAVRERALDTFARLARAEAAAHGVQPDAVHFHEVGAL
FT                   DAIADIVGVAAASVSLELDRIVVSTIALGGGRQVRGQHGGIPVPGPAVLHLLTEAEAPV
FT                   VGGTAPYEMTTPTGAALLATLADEFGLMPPLRILQTGVGAGGRDPVEVPNILRVVIGES
FT                   VGAPATELVYETNVDDLDPRIWPQVLSRLLQAGAADAWLTPILMKKGRPAHTLSVLVSS
FT                   ANAEVVRAVILTETSAIGLREFPIRKHAADREFASVEVGGQSIHVKIARYGGQVVNVQP
FT                   EYEDVVTAANALGKPVKSVLAQAVAAGHDLWG"
FT   gene            complement(206135..206851)
FT                   /locus_tag="Kfla_0199"
FT   CDS_pept        complement(206135..206851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0199"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase; KEGG: ppd:Ppro_0625
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29327"
FT                   /db_xref="GOA:D2PRZ7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ7"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADB29327.1"
FT                   /translation="MTHLPDPGPQPGVHDLGYARLDTDRLERTGDAEVVYGAGKTPAQV
FT                   VELLRTLHATHPDRAVLATRLTPEAQQVVGAELPEAVVDPVGRTAMLGTPPPARGTVAV
FT                   VAAGTSDAPVAAEAATTLQVFGAGVDLITDVGVAGLHRLLGVRERLAVADCLIVVAGME
FT                   GALPSVVGGLVGVPLVAVPTSVGYGASFGGLAALLAMLNSCAPGVTVVNIDNGFGAAVF
FT                   AARVARRAAPAEVKSP"
FT   gene            206959..207732
FT                   /locus_tag="Kfla_0200"
FT   CDS_pept        206959..207732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29328"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29328.1"
FT                   /translation="MSSTLAGAFALVALFVAVLALVFAIQALRGQLRAAKETAKEPEVL
FT                   PPTPPLPEPKPGTVGAELHRLGHELAEARAELRRTLQHLAVVRYDAFGDMGGRLSWSVA
FT                   LLDDNGDGVVLTSINSRNDARSYAKEVRAFASDVKLSPEEEQALETLRTQAAAARAQAP
FT                   AAPAQASTQPAQAPAAAQANTPPAPATTAPVQAAAAPAQAKAAPPQAAAAPAPAPAGSA
FT                   PASAPAGSAPAPAPAPAASAPAAPAQPAAQEAAQR"
FT   sig_peptide     206959..207033
FT                   /locus_tag="Kfla_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.452 at
FT                   residue 25"
FT   gene            complement(207743..209332)
FT                   /locus_tag="Kfla_0201"
FT   CDS_pept        complement(207743..209332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0201"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region;
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   diacylglycerol kinase catalytic region; phosphoesterase
FT                   PA-phosphatase related; KEGG: mes:Meso_0252 putative lipid
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29329"
FT                   /db_xref="GOA:D2PRZ9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D2PRZ9"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADB29329.1"
FT                   /translation="MNHHPPSHLGRAVTVVLGALPFTVVTLLVFQNWPPLRRWDLSVSD
FT                   RAAAYGASRPGWVDLWQVMGAVILPWTSRVLILGVAIYLWHRRARLLTVWLVVSAGAEL
FT                   GLVQAVKHTFDRPRPDSMLVQIETFSYVSGHAAAAFVMAGALGVVLPSVRGWRRRYRVL
FT                   VMLPAIAAVLLASADRIFLNVHYVSDVVGGWALGLAILTATSIGFGLRPGLRRRRRRTS
FT                   PEIPGEPPPRAAVIVNPIKVGDGVAFRRKVDRALAVRGFDDPLWLETREDDAGNAMAKR
FT                   AIENESDLVLVAGGDGTVRVVTAALSRTGIPVGVIPAGTGNLLARNLHIPLDLDDALER
FT                   ILDGRDRRIDLVKVHGDGLDTDRFAVMAGLGLDAAIITGAPAQLKAQLGWTAYLVSAAR
FT                   NFNHPSVKVRIALDDEEPFERRVRTVVIGNVGMLQANIPLLPDARPDDGLLDVVVIAPR
FT                   RVTQWPVLFWRVMTRTKRTDMYLERRTGRKVEITAAADVQRQLDGDGIGPGRSLVAEVE
FT                   PGTLVVRVPKRR"
FT   gene            209438..210712
FT                   /locus_tag="Kfla_0202"
FT   CDS_pept        209438..210712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0202"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bpy:Bphyt_1044 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29330"
FT                   /db_xref="GOA:D2PS00"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS00"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADB29330.1"
FT                   /translation="MIDAKLLRDNPDVVRAALTKRGESPARVDEILVADGERRSSIAAF
FT                   EALRAEQKGLGKQVAQAKGDERAALLERTKALAAEVKAHEATANEAERRFDQLSRALPN
FT                   LVSDEAPVGGESDYVVVEEIGKPRDFAAEGFEPRDHLELGELLGAIDMERGAKVSGARF
FT                   YFLKGVGAQLQLGMLQLAINQAVEYGFTPMITPTLVKPEVMDGTGYLNAHDDVYRLQEP
FT                   ELYLVGTSEVSLAGYHMDEILDLSGGPVRYAGWSSCYRREAGSYGKDTRGIIRVHQFDK
FT                   VEMFSYCSLEDAEAEHQRLLGWEKEMLDKMELAYRVIDTATGDLGASAYRKFDCEAWVP
FT                   TQGAYRELTSTSNTTDYQARRLNIRHRDAEGRTRHVATLNGTLATTRWIVAILETHQLP
FT                   DGSVRVPAALRPYVGGREVLEPARG"
FT   gene            210709..211500
FT                   /locus_tag="Kfla_0203"
FT   CDS_pept        210709..211500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0203"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: tau:Tola_3064 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29331"
FT                   /db_xref="GOA:D2PS01"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS01"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADB29331.1"
FT                   /translation="MTDDWRPRAIALDIDGTLVDHDERISTAVVDAVRRAAAQVPVILA
FT                   TGRSWQSTRPIAELLGLPDGFVVVSNGAMTIGYPGGEVVDERTFDPSTVIASVREHAPN
FT                   ARMAVEEHDFGYRVTAPFPDGDLGDGTAIRVVSDEQLAPEPVTRLIIRDPEQSEADFVE
FT                   LAERLGLHGVSYFVGWTAWLDIAPEGVDKSTGLKVALAQFGLEADGLLAMGDGRNDIEM
FT                   LTYAGLGVAMGAAPDEVKAAADEVTKTVQDDGVAAVLNRWF"
FT   gene            complement(211644..212279)
FT                   /locus_tag="Kfla_0204"
FT   CDS_pept        complement(211644..212279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0204"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29332"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS02"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADB29332.1"
FT                   /translation="MTVHTANPPGARTTRAAVDTSSIMEGAMTGCTARSDIFQHRLMEE
FT                   PPPASATRRTRERYEQLVREAKAVCASCPLFTDCLFSAVAEHDVSGFVAGTTAAQRRSM
FT                   RNLLDVEVQADDFDQLAGARGTRRPVSHEEVLRLRTQYPSDSLESLAMRLGCSLSTVKR
FT                   HLRRARRGQSPASKRPRPRPEVSAVLDAFDAVVDQSGPAPRTRSTRVA"
FT   gene            212695..213549
FT                   /locus_tag="Kfla_0205"
FT   CDS_pept        212695..213549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0205"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; Haloacid dehalogenase domain protein hydrolase;
FT                   sucrose-6F-phosphate phosphohydrolase; KEGG: mlo:mll1014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29333"
FT                   /db_xref="GOA:D2PS03"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS03"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ADB29333.1"
FT                   /translation="MTCPDGKGDRGSRYGRRVSDRETPRLVATDLDGTLVRDDGTVSAR
FT                   TRAAVLAIQQAGAVFVMVTARPPRWLHDLADLVGAHGVAIVANGAILYDVGRRRAIRTR
FT                   LIDPAVGLEVARAIRDEVPDVEFAIERSDRYGQEPHYLNRWPRPENTLIAGIEELLAEP
FT                   AAKLLVRHRSLHSDELLARVAPLVGERVAASHSGGHGLVEIAASGVSKAAMLADFAAEQ
FT                   GISAAETIAFGDSLNDLPMLAWAGTSYGVANAHPEVLAVVDQVCRTNDEDGVATVLEEL
FT                   FNL"
FT   gene            complement(213553..214161)
FT                   /locus_tag="Kfla_0206"
FT   CDS_pept        complement(213553..214161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29334"
FT                   /db_xref="GOA:D2PS04"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29334.1"
FT                   /translation="MSESSNEGQEVPMAGTRTEDGKVLIVGPDGMAVEGPPRGEHDEQS
FT                   DGPRSVTELVEQPAKVMRVGNMIRQLLEEVKAAPLDEASRQRLKSIHAASIKELESGLA
FT                   PELVEELERLSLDFTDDSTPTEAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARQQLE
FT                   QMRRALPGGQQLTPEDSPFPGGPQATGRTDGPGSGGMYL"
FT   gene            complement(214236..214772)
FT                   /locus_tag="Kfla_0207"
FT   CDS_pept        complement(214236..214772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0207"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   bmj:BMULJ_05240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29335"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS05"
FT                   /inference="protein motif:PFAM:PF07336"
FT                   /protein_id="ADB29335.1"
FT                   /translation="MHLNPYGADAVLLAVNLATDPAHSPDELATRCEQSGVESRLVRDR
FT                   QVTAADLAAVRVALDEWLAVVDATDEHERVALVNAMLAKYTEHPRLTNHAGDGWHVHYR
FT                   PDDVPVGRLVATLISTGTALHLAGRGISRLGRCSTDGCDTVYADLSRSGRQRYCSPACS
FT                   NRDAVRRHRARAQRV"
FT   gene            complement(215017..217665)
FT                   /locus_tag="Kfla_0208"
FT   CDS_pept        complement(215017..217665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0208"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   afw:Anae109_1773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29336"
FT                   /db_xref="GOA:D2PS06"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS06"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADB29336.1"
FT                   /translation="MGTWGPPLRIARRTTRRALGRTLLVAALIGLPVFVATWFGVVYRT
FT                   ASPTGEMLAARELGSADARVDVSPYKAFGAFWAEPSLETGEPMPADGAEDPVRHPATFD
FT                   PRPLLPPGTQLARAFHESGMVDLRGPGANSTVAVVTGDGRSALTAGTYRLDSGRMPATD
FT                   GEVAVSPSLARHFGLLDGDQLRTGATITTSAGRQVAVVGLARTLIRPGTPTVFAVPNTA
FT                   LVPVATTSSVRYLADLPDTVDPVTLVRPLHGQGIRVLPRANVVDPPFGPQSTSQDSSAI
FT                   AVTALIIGFGVLEIVLLAGTAFAVGARRQTRELGLITATGGTARDVRRVVLAQGLFAGV
FT                   VGAGAGAGLAMVAVFTGEPLWERMTSTVFTGWQIPWLRVAVICLLGLGAGLAAAVVPAI
FT                   SAGRQAPMAALSGRFAATTASGRIRPVSVALLLAGITCALVGSGLIGAVYQQAKENATS
FT                   DLYQPTATPTGPIALVLLGITAVIAALVWMLPGLVAKVAGLARMLPLSGRLAVRDAARH
FT                   RHRTGPAAAAIMMAVAATSAAAFAVSNALAAEAEQYVPSARHGDALIRFGTGGPTAVTY
FT                   SPALVERVAKLLPVKDTYSLGTVSHYSAQRTGDYLPVLATKGSPDSASGVSGAMLLAVD
FT                   PAHLERFEGYGPRAAAELRAGRIVVPAADQVTNGKAALLQETGEPNPPTFGHPAAYVPG
FT                   TPNVGQFRTSSLISPAAAAKLGKVQVVQVHFELNREPTEDQLSAAAVALGQDDALLIER
FT                   GYQSPAKYWFAGILAAASVVTLLGVAISVSLSAAEGRADLATLAAVGAPPRRRRSLAAA
FT                   QAWMLGQIGCLLGVGVGALYGYTAHAAFGSPYFAVPWREIAGIVVLVPLLAGLLAWLLT
FT                   RSRLPMVSRLN"
FT   sig_peptide     complement(217558..217665)
FT                   /locus_tag="Kfla_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.693 at
FT                   residue 36"
FT   gene            complement(217665..218381)
FT                   /locus_tag="Kfla_0209"
FT   CDS_pept        complement(217665..218381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0209"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dvm:DvMF_0697 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29337"
FT                   /db_xref="GOA:D2PS07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS07"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29337.1"
FT                   /translation="MILDLRQLTRVHGTGEQAVHALRDVDLAVAAGELVAVMGPSGSGK
FT                   STLLTCAGGLDQPTRGEVLVDGTDITTLKRSAVAALRRRLIGYVFQDFNLIPALTAAEN
FT                   VALPLELDGVRARTARKHAEAALTEVAIGELADRFPDDMSGGQRQRVAIARAIVGDRRL
FT                   LLADEPTGALDSDTGEAVLQLLRDRCDQHGIAGILVTHDARHAAWADRVVYLRDGVLVG
FT                   QSGPLPDADVLLQGTH"
FT   gene            complement(218378..218965)
FT                   /locus_tag="Kfla_0210"
FT   CDS_pept        complement(218378..218965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0210"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: scl:sce6005 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29338"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS08"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADB29338.1"
FT                   /translation="MSIKHGLLALLQADAKYGYQLRAEFEAATGSTWPLNIGQVYTTLT
FT                   RLERDGLVQPATGAGDGDGRSRYEITAAGRDELVSWFETPVTRESRPRDELAIKLALAL
FT                   AVPGVNVAAVVQRQRLATMESLQELTRLKRNSRDGSISWLLVVESMIFAAEAEIRWLDH
FT                   CEAMLSRHRQSTARPVTAGVPEQDETEAEARR"
FT   gene            complement(219020..219365)
FT                   /pseudo
FT                   /locus_tag="Kfla_0211"
FT   gene            complement(219421..219993)
FT                   /locus_tag="Kfla_0212"
FT   CDS_pept        complement(219421..219993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0212"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   mrd:Mrad2831_1768 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29339"
FT                   /db_xref="GOA:D2PS09"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS09"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29339.1"
FT                   /translation="MPRNPERRTQLADAGLAVIAEAGARGLTHRAVDAAAGLPAGTASN
FT                   YFRTRDALLGALGERIFERLAPTGDRLAPLASREPSVDLVVDYVRYIVERLLGHPELPL
FT                   ALFELRLEAARRPELHEILTRTLRQGFDADVSFHLNAGLPGGAEEIRLLHFAIDGLVLD
FT                   QLTPGTGHPYDVDATVARLVRRLTREI"
FT   gene            220069..220482
FT                   /locus_tag="Kfla_0213"
FT   CDS_pept        220069..220482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0213"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rpa:RPA0902 glyoxalase/bleomycin
FT                   resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29340"
FT                   /db_xref="GOA:D2PS10"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS10"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB29340.1"
FT                   /translation="MQPAAFGATVVTARPAEVAAFYTQYFDLAVTVDLGWFVCLRRGES
FT                   DWELAICERGHSSVPAAVSATTESSNVFGFVVDDADKVAARLTDGSVELATEVVTEPWG
FT                   QRHFYVRDPEGTWLDVIQLVAPDPDWVAANTPS"
FT   gene            complement(220543..221520)
FT                   /locus_tag="Kfla_0214"
FT   CDS_pept        complement(220543..221520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0214"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29341"
FT                   /db_xref="GOA:D2PS11"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS11"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADB29341.1"
FT                   /translation="MRAVVCEGAGGVEVLTVGEIEDPKVAVDEVVIDVVAAGVNRADLL
FT                   QRQGHYPPPPGAPGTIGLEVSGRISAIGSEVEGWSVGDECCALLAGGGYAEKVVVPAPQ
FT                   VMPVPAGIDLVSAAALPEVVATVWSNVFMTAHLKHGETLLVHGGASGIGTMAIQLAVAH
FT                   GARVLCTVGSADKMEFCTRLGADVAINYKEAEWASVVKEATGQAGADVILDIMGAKYLP
FT                   DNVKSLAFDGRIVVIGLQGGVKGELDLGRLMARRGSITATGLRARSVEDKGRILAEVVG
FT                   HVWPLVEAKKVRPIVHGIFPLEQVAQAHEALEQSAQTGKVLLTL"
FT   gene            complement(221526..222455)
FT                   /locus_tag="Kfla_0215"
FT   CDS_pept        complement(221526..222455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0215"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bbt:BBta_5102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29342"
FT                   /db_xref="GOA:D2PS12"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS12"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADB29342.1"
FT                   /translation="MEHDIAALLHKAAPRSEIAEVLPRSGGQLATVFEVRRIAAAPLII
FT                   KLYSPEWAWKQAKEIHVYDLLAPHLGTAIPQVVHAEPEGETHAFTVMTMLTGVPLCETT
FT                   APDYQVVYKQLGELLTAIHRIPQPAYGYLTDEVLEPLPSNDAYMRRQFAKKLQEFEELG
FT                   GDRALHARLTEYVEQHSGLFASSSRPVLCHNDFHEGNVLVDPDTWQVQGIVDVENAIAA
FT                   DPLIDLAKTQYYSIKNDQAKLSGLLTGYGELPSDWVERTAVYRLYHALELWDWFRLIGV
FT                   IDPLESIAADLVSLLGTSRVAGRPDAVR"
FT   gene            complement(222495..223106)
FT                   /locus_tag="Kfla_0216"
FT   CDS_pept        complement(222495..223106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0216"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A-like protein"
FT                   /note="KEGG: shm:Shewmr7_3970 molybdenum cofactor
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29343"
FT                   /db_xref="GOA:D2PS13"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS13"
FT                   /inference="protein motif:COG:COG0746"
FT                   /protein_id="ADB29343.1"
FT                   /translation="MPSDPLTPHDHQPHPDSLMPFDALVLAGGASRRFGGVDKATLVLE
FT                   GVSLLDRVLTATIRAETTVVVGPIRPTARPVTWTQEHPASGGPVAGIAAGLGHGSAPVI
FT                   VLVSCDLPWLTGADVAALVDGIAGHDGHGLRDDGGREQPLAAAYRRTALERALAEIGDP
FT                   RDQSVRRLFAGFTMRWSEPTRAGSDVDTWADLDDPTTAAE"
FT   gene            complement(223106..223915)
FT                   /locus_tag="Kfla_0217"
FT   CDS_pept        complement(223106..223915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0217"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: esa:ESA_02702 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29344"
FT                   /db_xref="GOA:D2PS14"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS14"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADB29344.1"
FT                   /translation="MRHHGKVKIAVVQTASTDDKAANREAVVRWVAEAAAGRPDLVVLP
FT                   EAMMADFAVEGGSVGGLAEALDGEFVSTLRKCALEHGTAIVAGMFERSCDEARPYNTLL
FT                   AVGADGELLGAYRKIHLYDAFGYRESDQLTPGNVAPVVVRIGGVGFGLMTCYDLRFPEL
FT                   SRALVDAGAEVLVVPAAWVRGPLKEHHWATLLTARAIENTCYVAAAAQNGRKYSGLSQV
FT                   LDPQGVAVAAVGEADGFATAEISADRLAEIRQRNPSLQNRRFTVAPR"
FT   gene            223992..225110
FT                   /locus_tag="Kfla_0218"
FT   CDS_pept        223992..225110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0218"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   glo:Glov_3554 cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29345"
FT                   /db_xref="GOA:D2PS15"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS15"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADB29345.1"
FT                   /translation="MTVDGFDLDHHGDLEVGDGLVDLAVNVRAGTPPPWLVDEIAAGLT
FT                   DLAAYPRADAATAATAARHGCSPDQVLLTAGAAEAFVLVARAFRPRHAVVVHPQFTEPE
FT                   SALRSAGHLVDRVILRPENGFVLAPGAIPADADLVVIGNPTNPTSVLHPADTLRELARP
FT                   DRILVVDEAFMDAVPGEPESLVGAGIPGLVVIRSLTKTWGLAGLRVGYVVAAPPLIDQL
FT                   AAVQPHWPVSTPALAAAIACTTPRATTEAAQAAADFDAQRKHLLAGLLNCPEAELDTRA
FT                   GDQPHGSTAYGGEAVRVSRDGRVAVHGVPRAPFVLVRIDGAEQLRQQLRERGFAVRRGD
FT                   TFPGLGADWLRIAVRPEVVTDAFLKAWRDVLG"
FT   gene            225222..225701
FT                   /locus_tag="Kfla_0219"
FT   CDS_pept        225222..225701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0219"
FT                   /product="putative BatC protein"
FT                   /note="KEGG: mxa:MXAN_5661 putative BatC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29346"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS16"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5661"
FT                   /protein_id="ADB29346.1"
FT                   /translation="MGLNDDDMTTSAGNGEGLADGGATPGATDGGADGGADTGAGRGNQ
FT                   SGGYGQMSEEGTADGGAAPGVSDGGADGGAGGGSEGPADGGASPGTQDGGADSGAGGGS
FT                   EGTADGGASPGVSDGGADGGADSGAGNGEGPADGGADPNATDGGADGGAQNSGSW"
FT   gene            225698..226975
FT                   /locus_tag="Kfla_0220"
FT   CDS_pept        225698..226975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0220"
FT                   /product="Cupin 4 family protein"
FT                   /note="PFAM: Cupin 4 family protein; SMART: transcription
FT                   factor jumonji jmjC domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29347"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS17"
FT                   /inference="protein motif:PFAM:PF08007"
FT                   /protein_id="ADB29347.1"
FT                   /translation="MSAVPETGPQPDQRPALRRCVAGDPEEFASNYWGSRALLSPAAEL
FT                   AGGGGAPASEVSGFSDLFSLDAVDELLSRRGLRTPFLRIAKNGSVVGDNQFTGPGGVGA
FT                   EIGDQVQDDKVAALFASGHTVVLQALHRTWPPLVDFATQLSSEAGHPVQINAYITPAES
FT                   QGFSAHYDVHDVFVLQVAGEKHWTVHEPVHVDPLRNQPWTDHSKAVAEAASTEQPVVDA
FT                   VLRPGDALYVPRGFLHSAKALGGVSAHLTVGLHTMTRYLLVQELAALAANVPDLRSALP
FT                   LGFDPGDPHQLAPELEKVVALFAEHLQTATADDLTDRLRRRTWSGNRPAPLAPLAHAAT
FT                   IANLAVGDTLRLRPGLRHRLVPGDPVLLHLPDRTISFPANTAEAVTQACSGTPFAVGDL
FT                   PGLSSEDQLVLTRRLLKEAVLVASPT"
FT   gene            227287..228735
FT                   /locus_tag="Kfla_0221"
FT   CDS_pept        227287..228735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0221"
FT                   /product="Sucraseferredoxin family protein"
FT                   /note="PFAM: Sucraseferredoxin family protein; KEGG:
FT                   csa:Csal_1040 sucraseferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29348"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2PS18"
FT                   /inference="protein motif:PFAM:PF06999"
FT                   /protein_id="ADB29348.1"
FT                   /translation="MEPAQSASGSDVGPARSASATGSPAERARSASASAPADRYRPETG
FT                   CAASAEGRGDSLIASAPPAERWLLIEHNGAWPRAALTALRRTPPTASGEATNPTASGEA
FT                   TNPTADDPIRAEPAPDDLAAEVARLCTAARCRPVLIRRHGRAAGTEPRRWMLVDSRPGH
FT                   ESIRQGHLPTDEHLLKVLSGADPGTPTTDPIYLVCTHGRHDACCAVRGRPAAAALAAAY
FT                   PDRTWECSHIGGDRFAANLVFLPHSLFYGHVPPAEAVRLAQAYDEGHIVPAYYRGSGAH
FT                   LPAVQAAQHFARTAGHSLSVNALHPVHLTEPTPNHWRISLAANSAENRTSPTGSAEAIA
FT                   EADTAPVVDTAPEADAAAVVDTAPEADAAAVVDTAPEADAAAVAESPPPRASLLTSDAI
FT                   GAVETTSREATTPADGSTNSTDGSSRAAESRPGDGGGLQIVVEVRARLVTIDGQMTCAA
FT                   RPPGQVRQFTLEGPVRVEPRDSTE"
FT   gene            complement(229625..230233)
FT                   /locus_tag="Kfla_0222"
FT   CDS_pept        complement(229625..230233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29349"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT33"
FT                   /inference="similar to AA sequence:KEGG:mll0380"
FT                   /protein_id="ADB29349.1"
FT                   /translation="MLLEHRGRQPVVPESAYVAPSAVLCGAVVLGEGSRVLHGAVLTAE
FT                   DGEVRIGTNSVVMENALVRGRAAHPALIGDAVLVGPHCHVNGATVEDEAFLATGAALFP
FT                   GSVVGAGSELRINSVLHVNSRLTPGTVLPIGWIAAGDPAQLFSPDRHEELWAVQGALDF
FT                   PGTVYGVPRGTPMQEVMARQSTYYGSHREDRLLDDPRSS"
FT   gene            complement(230486..231703)
FT                   /locus_tag="Kfla_0223"
FT   CDS_pept        complement(230486..231703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0223"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mlo:mll5688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29350"
FT                   /db_xref="GOA:D2PT34"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT34"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29350.1"
FT                   /translation="MPSAATLGLPNVRGRIPLLAGLAIDSFGGGCAGPLLLLFFVRVAD
FT                   IPLGTAGLLLTVATLFSIAAPAVVGQVIDRVGPRNLVIGAQFAQGLAFAGFFFGRSTWL
FT                   LFLCALVTTTGQRVFWSSVFSLLSDVSDAGDRDRWFGLGGMMQAGGFGLGALAAGALLT
FT                   FDGDRPFLIAMALNAATFFVAGLLLLRIHAGHAARSAEDSGPAPLLRKDRPFLVLIGAN
FT                   TILALCTMLMGIGLPVYVSEALPAPKWLVGVLLAAVSVVLATGQTLVVRHTEKRRRTNV
FT                   MIVAGLLWAVWGVMMAGLLHLPAGLVVPVLLLGTAVFAAADVLHAATSNALAAAIAPER
FT                   GRGKYLSYWQYSFTFASVLVPAFFAQLFEVRREFPWLAISLLALVAAGTILVLDRVLPQ
FT                   ATTRRS"
FT   gene            231878..231966
FT                   /locus_tag="Kfla_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            231878..231966
FT                   /locus_tag="Kfla_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(232076..232558)
FT                   /locus_tag="Kfla_0224"
FT   CDS_pept        complement(232076..232558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0224"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: scl:sce8843 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29351"
FT                   /db_xref="GOA:D2PT35"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT35"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB29351.1"
FT                   /translation="MTRRGGDLALLLLAAFRTLADRATVELANRGYEDFRPVHDFALHS
FT                   ILGGADNASELGRAMAVTKQAAARTIGILEERDWVVREVDPNDRRKLRLRVTEQGMTLL
FT                   REGEAIFNELRDEWERQVGRDSIESLEHSLRSLVGENVIRLNSPGWSAQGITEQPA"
FT   sig_peptide     complement(232496..232558)
FT                   /locus_tag="Kfla_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.805 at
FT                   residue 21"
FT   gene            232642..233538
FT                   /locus_tag="Kfla_0225"
FT   CDS_pept        232642..233538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0225"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ara:Arad_7247
FT                   alpha/beta hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29352"
FT                   /db_xref="GOA:D2PT36"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT36"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB29352.1"
FT                   /translation="MPVVPSGATLPGVTHHLVALNGAELHYVSAGTSGSPIVLVHGWPE
FT                   TWWAFRKLIPLLAATHRVCALDLRGFGDSDNGDLEFGERVTAEDLHHLVEHLGEGPVHL
FT                   LCQDISGGVGFRFAATHPDDVVSFTAVESTLAGFGLEALADVNNFGSWHVGFLGAPGIA
FT                   GMLIPGHERELLAGWAYPLMNGTEGSILDADLDEFLRTYSRPHAWRGTEGLYGAIFTDK
FT                   GSTAALAATKPITVPVLAIDGVNHPFTEHSFRQVSSADFTAVHIKEVGHLIAQEAPDAL
FT                   AAALLDFTATIDKGLAG"
FT   gene            233735..234298
FT                   /locus_tag="Kfla_0226"
FT   CDS_pept        233735..234298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0226"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mlr0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29353"
FT                   /db_xref="GOA:D2PT37"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT37"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADB29353.1"
FT                   /translation="MRKLIYGMNLTLDGYIAAAGDDLGWSAPSDELFQWWLDQELAIGL
FT                   LMYGRKLWEEMSSNWPTADQQPGATPAQIEFARNWRDTPKVVFSSTIDKVDWNTRLVTG
FT                   DAAAEMTRLKAEDGEPMRVAGATLAGAAVRAGLVDEYEIVTHPVLVGGGTPFFTALDSW
FT                   VKLSLVETRTFPGGVVLTRYATRR"
FT   gene            234424..235047
FT                   /locus_tag="Kfla_0227"
FT   CDS_pept        234424..235047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29354"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29354.1"
FT                   /translation="MRSTLVNRLVRLATTGAMVAGGLVLIGAPSEAAPPKRTEGHVTGD
FT                   AWISFSLDPGNPLRRFVVDAHGNPYKVVGNKLVWGDARGTIRFNHPTPDGQGGMEDNWG
FT                   TIDVDYVMTAGPVAVVSGKSTGNIGFPAGQRLSISVYDDPRGRRFDRLGFSWGVVDPAC
FT                   VPLGLGPAPFTTYDSGAGYVVKSVPLPAVPAGTEAPDPQPACGS"
FT   sig_peptide     234424..234522
FT                   /locus_tag="Kfla_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            235339..235872
FT                   /locus_tag="Kfla_0228"
FT   CDS_pept        235339..235872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cation-transporting P-type ATpase with 11 or
FT                   more transmembrane domains; K01537 Ca2+-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29355"
FT                   /db_xref="GOA:D2PT39"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29355.1"
FT                   /translation="MLYVVIVLCCLAAALVVRALAGPERWHQKVRSQIRPDVAAPTESG
FT                   FRLLFWRNWAVAVIAVAIAVWGIDELQLSEEELHEAAVHAVATMDGTTDGVTQDRIRVA
FT                   VEDLVPADLRVREIKSQTSEGEVQSRYEITEASATDDDPDRMAVCVKVSSIERQTRSGV
FT                   FYSSTGTSPGPCTD"
FT   sig_peptide     235339..235404
FT                   /locus_tag="Kfla_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.901 at
FT                   residue 22"
FT   gene            235874..235972
FT                   /pseudo
FT                   /locus_tag="Kfla_0229"
FT   gene            complement(235966..236322)
FT                   /locus_tag="Kfla_0230"
FT   CDS_pept        complement(235966..236322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shl:Shal_2173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29356"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT40"
FT                   /inference="similar to AA sequence:KEGG:Shal_2173"
FT                   /protein_id="ADB29356.1"
FT                   /translation="MSLQWEQVIVHSVDPVTLGQWWATALGWVVVHASDDEFEIRPAPD
FT                   RLPGLDFVRIEETKKAKSRLHLDFRPDDQDAEVARLVAHGAQRVDIGQGEEASWVVLAD
FT                   PEGNEFCVLGQRPQ"
FT   gene            complement(236395..237111)
FT                   /locus_tag="Kfla_0231"
FT   CDS_pept        complement(236395..237111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0231"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mlo:mll2997 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29357"
FT                   /db_xref="GOA:D2PT41"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT41"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29357.1"
FT                   /translation="MTETKTALITGANKGIGFAIAAGLGAMGFTVAVGARDQVRREEAV
FT                   ERLRAAGVDAFGVALDVTSDDSVAAAAATIEQTTGRLDVLVNNAGISGRTDGGAQDPTT
FT                   LDLDVVRTVLETNVLGIVRVTNAMLPLLLRASSPRIVNMSSNMGSLTLQTGPVMAAYAP
FT                   SKSMLNSVTAQYARRLAETKVIVNAACPGYVATDFTGHAGVRTPEQGAAIAIRLATLPD
FT                   DGPRGGFFDDEGVVPW"
FT   sig_peptide     complement(237004..237111)
FT                   /locus_tag="Kfla_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.649 at
FT                   residue 36"
FT   gene            237207..238085
FT                   /locus_tag="Kfla_0232"
FT   CDS_pept        237207..238085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0232"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: ade:Adeh_2212 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29358"
FT                   /db_xref="GOA:D2PT42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT42"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADB29358.1"
FT                   /translation="MDDLETRELRYFVAVAEELHFGRAADRLGIAQPALSRAIRQLEHR
FT                   LGVRLLDRDRRGTALTDAGSVLLREARATLDAVAAAARRTRRAGDEKRPLVLVTKAGAS
FT                   HELLQRLLAEHASEPGAVPVEVLLCEVGEQAGLLRNGRADVAIMHRPFDDLAGFDTEDL
FT                   SVEGQIALLPAGHPLASRRQLTMAEVRDVPDLPIARWPRLDGSYPDGPGPEVHTQSQLA
FT                   QLVALGKTLLVIPASSRAWQWPDHVAVPVVDAPDVTTVIAWPPSSYSPAIASLVRSAGG
FT                   LRDTTPAAAGG"
FT   gene            238135..239130
FT                   /locus_tag="Kfla_0233"
FT   CDS_pept        238135..239130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0233"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hch:HCH_06029
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29359"
FT                   /db_xref="GOA:D2PT43"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT43"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29359.1"
FT                   /translation="MSSRFALALEGRKQIESWAAGAQVLSLLSTIQELGWPRFLAEPRE
FT                   LAELAQYSGLPPARLADVLAVLEEYGIAELEGTTVRLSPQYEALAADDAWIGLGELLDR
FT                   SEVMTRLVRTSVEDPGPLPLSEDDALVIARASGGRATDETRALFEQVFLPQLPELAELV
FT                   RTDRWLDVGCGVAGSTLTLGTLFPEMRSVAVELVPKVAAEAVRRAEAHGVADRVDIRCQ
FT                   DIRELQEVEQFGGAFWAQPFFPEATRAEALAVIRRALKPAGLLLMQETDPQPQPSSRPA
FT                   YAVRRLVNRGWGVPFGRTAEQLAVEGQAAGFELVRVAVTDFGRYVVLRRS"
FT   gene            239159..239785
FT                   /locus_tag="Kfla_0234"
FT   CDS_pept        239159..239785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0234"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bmn:BMA10247_2139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29360"
FT                   /db_xref="GOA:D2PT44"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT44"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29360.1"
FT                   /translation="MTATRDSYDALASAHADVVSSALDDRPLDHALFATFAELVRQGGN
FT                   GPVADVGCGPGRVTILLSRLGLDAFGIDLSPGMLELARRTYPELRFDEGSMLALDLPDA
FT                   SLGGVLAYYSIIHVPWDQRPQVFAEFHRVLTPGGVVMLVFQVGEEKVHRDEFLGEAISL
FT                   DFYRQQPHEVAELLRAAGFDLWMTAVREPQDAEKTPQGYVIARKP"
FT   gene            239796..240146
FT                   /locus_tag="Kfla_0235"
FT   CDS_pept        239796..240146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0235"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmw:Mmwyl1_0281
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29361"
FT                   /db_xref="GOA:D2PT45"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT45"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB29361.1"
FT                   /translation="MDAPRLTHVRVNVTDLGEAIEWYERLLGVEAAGHWPPEEPTYAHF
FT                   TLGPVQFAVGQYEPVPATGARFNFQVDDVDAWWARVGETADVLEPLFDTPYGTRKFTIR
FT                   DPDGNELGFVQA"
FT   gene            240785..241135
FT                   /locus_tag="Kfla_0236"
FT   CDS_pept        240785..241135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0236"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: pfs:PFLU5155 putative MerR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29362"
FT                   /db_xref="GOA:D2PT46"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT46"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADB29362.1"
FT                   /translation="MTPDVSTEVPMNVDPKPGPASFDDDDYPAFTMGRAAEMLGTTPGF
FT                   LRSLDEAKLITPQRSEGGHRRYSRYQLRIAARARELVDQGTALEAACRIIILEDQLAEA
FT                   LRINEEMRRQGK"
FT   gene            complement(241253..242023)
FT                   /locus_tag="Kfla_0237"
FT   CDS_pept        complement(241253..242023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0237"
FT                   /product="Ketosteroid isomerase-like protein"
FT                   /note="KEGG: rso:RS03879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29363"
FT                   /db_xref="GOA:D2PT47"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT47"
FT                   /inference="protein motif:COG:COG4319"
FT                   /protein_id="ADB29363.1"
FT                   /translation="MDEQEIRTLIERWADAVHTGNLAGVLADHSADVLMFDVPPPYEGL
FT                   RGLAAYERTWPGFFEWQAQGATFEIVSLDVTAGADVAFAVALLKCGMPDETAERRLRLT
FT                   IGLRKLDGRWTITHEHHSFPLEEIPAPVGESAVRELLDDWSVQTAGKDLDAMMAGIAPD
FT                   IVSYEHAGPLQYVGRSAVREVCQAGLDTSGSIELTQSDLTVLARNDLAVAWGIDHVTVE
FT                   SPDGPTESRSRATRIFRHGPNGWQLVHQHLSFPR"
FT   gene            complement(242092..243015)
FT                   /locus_tag="Kfla_0238"
FT   CDS_pept        complement(242092..243015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0238"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bid:Bind_2504 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29364"
FT                   /db_xref="GOA:D2PT48"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT48"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ADB29364.1"
FT                   /translation="MDGDAFGRLVGPLRGELHAHCYRMLGSSHDAEDAVQETLLRAWNN
FT                   LDRFEDRGTLRPWLYKIATNRCLTLIERRGRRELPTDLSAPQAETAWLEPYPNHQLAWT
FT                   DRLSPEARVVALESVELAFVASLQHLSPLQRAVLLLRDVLAFAAREVAEQLDTSVAAVN
FT                   SALQRARRVVGEVPSQQRTLAELGEEAQRDLARRYLAAWEARDVDAIVAMLTEDAKYSM
FT                   PPLPQWFAGRARIRGFLVDGPLREQWRFLPTRANGQLAFGTYRWQSGRYVASGLDVVML
FT                   RGASIAEVVSFLEADFAAYGLPAELF"
FT   gene            complement(243048..243803)
FT                   /locus_tag="Kfla_0239"
FT   CDS_pept        complement(243048..243803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0239"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG: predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29365"
FT                   /db_xref="GOA:D2PT49"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT49"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADB29365.1"
FT                   /translation="MLVFEDTFDRPELDTSVWSPHYLPHWSSRAATAAQYELDGSCLRL
FT                   VIPPEQGLWCADDHQPPLRVSGIQSGNYSGPVGSTVGQQPYRDGLVVREEQEAFWGWTP
FT                   QFGRIELHARAELSPRSMVSLWMVGLEDRPERCAEICVMEVFGKALEPGSAAVGMGLHS
FT                   FRDPAVPEDFEAVRLPIDVAEFHTYAVDWTAEQVSFSVDDEPVRRCARPPAYPMQLMLA
FT                   VFDFPDWSTGADDHLVPSFTVDHIRCYRS"
FT   gene            243886..244755
FT                   /locus_tag="Kfla_0240"
FT   CDS_pept        243886..244755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0240"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: scl:sce6834 ECF family RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29366"
FT                   /db_xref="GOA:D2PT50"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT50"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB29366.1"
FT                   /translation="MNQDDLARQFEQNRRHLRAVAYRMLGSLSEAEDAVQEAWLRLSRS
FT                   DSSEIANLGGWLTTVVSRVCLDMLRARKSRREDPYDTYVPDPVVSRLDPEEEAVQTDSV
FT                   GLAMLVVLETLKPAERLAFVLHDLFGVSFDEIAPIVDKTPAATRQLASRARRRVQGAPT
FT                   SDGNLGRQREVVEAFLAASRSGDFDGLLAVLDPDVVLRADAGAVPATGLATSRLVRGAK
FT                   TVVEQALLFGRLSPHAQVATVNGAPGLVTVVDGRLLGVMSPEIRDGRIVEINILADLSR
FT                   LESLPLPA"
FT   gene            complement(244703..245581)
FT                   /locus_tag="Kfla_0241"
FT   CDS_pept        complement(244703..245581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0241"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29367"
FT                   /db_xref="GOA:D2PT51"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT51"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADB29367.1"
FT                   /translation="MSQTHHVTSTGDTVTKTYTDRSRGEDQREWTALRVISTARPGLVP
FT                   VPLRLTGATLTMTRLPGTPLAGELTAQQLDGLETALRDLWSIPPASLAPVDHPALVARI
FT                   RADLQHSPTGETTAAGAGPPPEASRAGAVGECWRSGPRQDLLREARQVALDWLDGDEAA
FT                   ELARPANAVIGHGDPNLANYLWDGVRVRIVDFEDAGRSDLAYELGTLVEHLASRGTRWD
FT                   GFAERFGVDAARFRAARCLWASFWLTMVGPGGPAAERNPPGTGVRQAARVLELIRPGGE
FT                   ATPGGTGRRGC"
FT   gene            245674..246960
FT                   /locus_tag="Kfla_0242"
FT   CDS_pept        245674..246960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0242"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: pna:Pnap_2767 FAD
FT                   linked oxidase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29368"
FT                   /db_xref="GOA:D2PT52"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT52"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADB29368.1"
FT                   /translation="MSVQVIHPSGVGVVAGLLGNGFGGAIHRPGDAQYDEQRKALVPTL
FT                   DSRPLVVAEAFGRTDVQAAVRTAREHGLPIAVQATGHGTRMPADGGILLKTSAMTSLLI
FT                   DPERRIAKAGPGVRWGAVIDAAAEFGLAPLAGSSRDVGVTGYTLGGGLGWLARKYGFAA
FT                   DSVVRAEVVTADGRVVTTSADEHPDLFWALRGGTGNFGIVTSLEFRLYPVRSVYAGIVY
FT                   FDAAQAACILKTYRDWTATVPNELSTAIVLTRRPDGRRVVGLKVMYCGEAALAEHLLKP
FT                   VYAVAGPIVDGELATMPFAQAAMGGTPARYLDLVDALPDDLLDGLAALTGDAAPTVEIR
FT                   HWAGAMANPGPGAGPVAHRDAPYSLIIDQEVAELAPVLRRTGRTFVNFLADHSSTATAY
FT                   TPADHARLRAVKRAYDPENLFHLNPNIAP"
FT   gene            complement(247040..247999)
FT                   /locus_tag="Kfla_0243"
FT   CDS_pept        complement(247040..247999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0243"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="PFAM: SH3 type 3 domain protein; SMART: SH3 domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29369"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT53"
FT                   /inference="protein motif:PFAM:PF08239"
FT                   /protein_id="ADB29369.1"
FT                   /translation="MIGPGIVKVAIPGATVALLATGSAVAFPEQQQNTPTSEAPLASSP
FT                   LQLARETQTSRDAYRPSLNLKPSTPPAATAKPKAPPAAKHLKKQAPIPTPNSVKTRAAQ
FT                   VAKALPPKIVGSKFTTTDLNVWTAPQQKGTLLTVLAKGTKVSVTGEVDGQWAQIVRNGL
FT                   VRWVKAEYLAATKPVEKVEKAEETEEAADGVSSAACKSGSGVEDGLTADAIRVHRAVCA
FT                   AFPSVSSYGGVRSGDGGAHGSGRGLDIMVTGSLGDEIAAYVRSHAKELGVSEVIWEQRI
FT                   WTVQRGSEGWRGMEDRGGATANHFDHVHVSVYGNAGTV"
FT   sig_peptide     complement(247919..247999)
FT                   /locus_tag="Kfla_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            248345..248500
FT                   /locus_tag="Kfla_0244"
FT   CDS_pept        248345..248500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29370"
FT                   /db_xref="GOA:D2PT54"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29370.1"
FT                   /translation="MLILGLILLLLGFLLNIPVLWTIGIVLLVVGAVLFLLGSTGRAVG
FT                   GRRHWF"
FT   gene            248629..248976
FT                   /locus_tag="Kfla_0245"
FT   CDS_pept        248629..248976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0245"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: psa:PST_0149 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29371"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT55"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADB29371.1"
FT                   /translation="MKYLVLIYGTTDDTWTGSDDDIAAVRALTELKRDLTGTGELVSSE
FT                   GLSYPSSGRVVQVRDGVRVVTDGPFGEAKEQIAGYFMVDASDERAQEIAGQVSRIVGDR
FT                   VELRGTLLAAP"
FT   gene            complement(248987..250396)
FT                   /locus_tag="Kfla_0246"
FT   CDS_pept        complement(248987..250396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0246"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_A3935 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29372"
FT                   /db_xref="GOA:D2PT56"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT56"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29372.1"
FT                   /translation="MQNPPDPKRWFALALLCVTGFMIILDASIVLVAVPSIERDLTFST
FT                   GGVQWVPSGYALMFGGLLLLGGRVSDLLGRRRVFLAGLVGFAASSLLCGLAWSGDALVL
FT                   ARGLQGIAAAVLAPSALSIVMTTFAGGPERNKALGIWGATSGVGGTAGSLIGGPVTDGL
FT                   GWPWIFYINVPICVLVLVLAPLVLQDSRGPAQRTFDIAGAVTVTAGLIVLVYAVIEAPG
FT                   SSAGRTAALALLSAALFAAFVLIEQRSSAPLVPLRLFRSRALVGGNLIGIAFGLGVFGL
FT                   NILYTQYAQLVAGYSAIKYGLVSSVLAAAAVGGSMIGQHLVTRVGARPVAAVSLLLTGA
FT                   GVTVMSRLTVDTGYFELAFWGLTIYGAGLGAGTVAGSIAALGEVAGNDAGVASGLQNAC
FT                   FQIGGAVGIAVISAVAVANTNGSTPAALTAGYRVGFAACWAFVAVGLVGAALLVSRKKA
FT                   PQPVAAGQGAA"
FT   sig_peptide     complement(250298..250396)
FT                   /locus_tag="Kfla_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.359 at
FT                   residue 33"
FT   gene            complement(250400..250527)
FT                   /pseudo
FT                   /locus_tag="Kfla_0247"
FT   gene            250567..250932
FT                   /locus_tag="Kfla_0248"
FT   CDS_pept        250567..250932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0248"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: swd:Swoo_0824 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29373"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT57"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADB29373.1"
FT                   /translation="MKYMLLIYSNPESWASLSAEQRDDLTRAHQELATELTEQGLLVSS
FT                   AGLADPITTRTVSIGDDNSRTTTDGPYAEAKEHLAGFYLVECEDIDQAIGYAARMPDAQ
FT                   YVAVEVRPVMDTSGLEM"
FT   gene            250929..252164
FT                   /locus_tag="Kfla_0249"
FT   CDS_pept        250929..252164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0249"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: mxa:MXAN_5410 ECF subfamily RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29374"
FT                   /db_xref="GOA:D2PT58"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT58"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB29374.1"
FT                   /translation="MSDFELLLREQTPQVLSALVRHYGHFDLAEEAVQEALLAAAQQWP
FT                   REGVPDNPRGWLIRVGSRRLTDLLRSDTARRRREENAAALSAPEEFVAPGPDIEDLAGR
FT                   DDTLTLLFLCCHPALSPASQIALTLRAVGGLTTAQIAAAFLVPEATMAQRISRAKRSIK
FT                   QAGSSFEMPPEAERDARMGAVLHVLYLIFNEGYTASSGDNLHSAELTAEAIRLVRGVRR
FT                   LLPNDGEVAGLLALMLLTDARRPARTDADGALVPLAEQDRSKWNKDAIVEGEALVTDAL
FT                   SRTQLGPYQVQAAIAAVHGTAERAEDTDWPQIVALYQVLEQISDNPMVRLNHAVAVAMA
FT                   TGPKEGLALLEPLESDGRMKDHHRLEAVRAHLLEMSGDLAGARASYLLAARRTTSVPER
FT                   DYLQSKADRLGT"
FT   gene            252219..252914
FT                   /locus_tag="Kfla_0250"
FT   CDS_pept        252219..252914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29375"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29375.1"
FT                   /translation="MDLTKASLLREMLTGTELGSRTTSFAHSMRRYTTRRGGLLLFGPP
FT                   EDEPWHLTAHLDDELHRAGVEDVRPALVRWTPPPGAPPHLAIGLDRLRESGRGESLLVV
FT                   AEDRPADTLLERIDDVRRRGTTIFSIDNGDKELAGLAHESLVPELLVPAGFGSWANHSV
FT                   TEDAVRRTEGAVDDEIPDETLTALREAVAGFEMTQHLVSLAAADPEAGQANWRRSLRTF
FT                   IERLGGEPG"
FT   gene            complement(252883..253280)
FT                   /pseudo
FT                   /locus_tag="Kfla_0251"
FT   gene            253368..254063
FT                   /locus_tag="Kfla_0252"
FT   CDS_pept        253368..254063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0252"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpy:Bphyt_6660 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29376"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT60"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29376.1"
FT                   /translation="MPKTLAIVGAGPGLGAGVARAFGRRGYRVALIGRTRATLISLAEK
FT                   LAADGIQAEAFPADIHHREALRSALREAAAAFGPITVLEYGPSPTGEITTALGTTVESA
FT                   TQQFELHMLGAITAVGEVLPGMLARGDGAVLLTTGVSSTVPAPFLGNVGPAMAALKNWA
FT                   GALATEVRARGVYVGTLTIATGVVPGSPDGDPDLIGERYYELARRRDHFEQTVGDLGDF
FT                   RALVAQSSR"
FT   sig_peptide     253368..253433
FT                   /locus_tag="Kfla_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.926 at
FT                   residue 22"
FT   gene            complement(254048..254599)
FT                   /locus_tag="Kfla_0253"
FT   CDS_pept        complement(254048..254599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO4970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29377"
FT                   /db_xref="InterPro:IPR025334"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT61"
FT                   /inference="similar to AA sequence:KEGG:BRADO4970"
FT                   /protein_id="ADB29377.1"
FT                   /translation="MDKERFWGLVEAAREQVDDTVVDPDGVADALTKALSGLPAEEIVG
FT                   FGVRFELLLGEAYRWDLWGAAYLINGGLGDDGFDFFRGWLVAQGREIWEAALADPDSLA
FT                   DVIDEDLDDGFEGFDGEALLAVGAEAYATVAGSEKDFWSAVDAATPDAADVPAGEDFDF
FT                   DDKAEMHARFPRLAALYLDD"
FT   gene            complement(254657..255604)
FT                   /locus_tag="Kfla_0254"
FT   CDS_pept        complement(254657..255604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0254"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mrd:Mrad2831_0318
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29378"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT62"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB29378.1"
FT                   /translation="MTDLRIALGAMEFGMRIDEQTSFALLDQYVDGGGEWIDTANCYAF
FT                   WQDPSGHGGQSEELLGRWFAKRPGVRDRVKLATKVGCEPLWPGSFPEHTEGLSQKAVDA
FT                   AVETSLRRMGVDHIDLYWAHRDDLQTPLEETVAAFGKHAAAGTIGRIGLSNYALWRVER
FT                   ARAIAERLGVTGPTALQMRYTYLQPRPFVRDHAHDHRFGWITDEMLDYAEQNPEQDLFA
FT                   YSSLMSGGYERPDRPFHEAFDHPGSTRRLQALTEAAESLGVTRSEVVIAWLTGGSPSII
FT                   PIVGASTSAQLTTALTAARLTLPTTLRTELDEPW"
FT   gene            complement(255761..256888)
FT                   /locus_tag="Kfla_0255"
FT   CDS_pept        complement(255761..256888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0255"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: rso:RSc1014 transcriptional
FT                   regulatory DNA- binding repressor transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29379"
FT                   /db_xref="GOA:D2PT63"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT63"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADB29379.1"
FT                   /translation="MPAGASRTTAGELPETGTTGRRTRVAGKPAARNRSRGAAGVKDVA
FT                   AAAGVSLGTVSNVLNRPEMVSPATRAKVEAAMESLGFVRNESARQLRAGSSRIVAYLML
FT                   DAGNPFFTDVARGVEEAAREAGLSVFLCNSNEDAGREADYLDLLEQQRVQGVLITPIDP
FT                   HSSRIATLPLRGTPVVVVDRSLDDAQHCSVAVDDVLGGEVALTHLIELGHERVAFVGGP
FT                   NTIGQVTDRREGARNALEEAGLPAENLVELTTAALTVAEGRGAGQRLAGLPADRRPTAA
FT                   FCANDLLALGLLQQCVSLGLRVPEDLAIVGYDDIEFAAAAAVPLTSVRQPRQLLGKTAA
FT                   ELLLDESSNPDHEHQRVTFTPELVVRTSTRGKTSR"
FT   gene            257305..258810
FT                   /locus_tag="Kfla_0256"
FT   CDS_pept        257305..258810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0256"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bph:Bphy_3463 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29380"
FT                   /db_xref="GOA:D2PT64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT64"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29380.1"
FT                   /translation="MAADAPVLRLREISKSFGAVAAVQNVSFDLYGGEAHALVGENGAG
FT                   KSTLVKMLAGVHRPDSGTVELDGVPVELNAPADAKAAGIAVIYQEPTLFPDLSVAENIA
FT                   MGRQPLGRFKTVDRTAMLRQAEQLFTRLGVAIAPNRPARGLSIADQQLVEIAKALSADA
FT                   RVVIMDEPTAALTGVEVERLFSVARSLRDDGAALVFISHRFEEITALCERVTILRDGRH
FT                   VSTDLLADLSVDEMVRRMVGRDLDALFPKQDVTPGAVVLSVDGLRRDPVFTDVSFEVRA
FT                   GEIVALAGLVGSGRSEVVQSVFGVDPRDGGTVKVGGRTLKPGSPRAAMAAGVALVPEDR
FT                   RQQGLVMELSIERNVTLPRSRALSRLGFLTGGSERRSATEWTQRLKTKYGRLSDEVGTL
FT                   SGGNQQKVVLAKWLSMAPKLLIVDEPTRGIDVGTKAEVHRLMSSLAAEGVAVLMVSSEL
FT                   PEVLGMADRVLVMREGRLVAELDRAEATEESVMFAATGQEVSV"
FT   gene            258807..259832
FT                   /locus_tag="Kfla_0257"
FT   CDS_pept        258807..259832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0257"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bpy:Bphyt_5683 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29381"
FT                   /db_xref="GOA:D2PT65"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT65"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADB29381.1"
FT                   /translation="MTAVGLPGVSTRRSSLDLVLRARELGIVLALALLVAVTAISNPRF
FT                   LSAQSIRDILLGTAILAVLAVGQAVVVITRNIDLSVGSVLGLSAFTVGTLLRDNPGLPV
FT                   VVALLAGAAVGGACGTVNGVLVRYGNVPALVVTLGTLYVVRGITYFWAGGQQINADELP
FT                   SGFLDFGNATLLGVPFLVLIAVVVLVVTGLVLRNYRAGRELYAMGSSPQAAELAGIPVG
FT                   RRTVLAFLVSGALAGLAGVLFAARFGTIDAAAGTGYELNVVAAVVVGGVAVFGGSGSVW
FT                   GAALGALLLTTIGSALAVLEINQFWQQAIVGGLILLAIGADRLVAARVAATLKKRGSHV
FT                   S"
FT   gene            259822..260841
FT                   /locus_tag="Kfla_0258"
FT   CDS_pept        259822..260841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0258"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B1037 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29382"
FT                   /db_xref="GOA:D2PT66"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT66"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADB29382.1"
FT                   /translation="MSAETAAVTDHPTGLAGRFANWNVAIIAVTVLVIAVAAATVDNFG
FT                   TSQNFGFLVLDLLPIALVALPMTLVIVTGEIDLSVASTLGLCSAVMGSLWNANQPIETI
FT                   IPVCLLLGAVLGAVNGFFVTVLGLPSLAVTIGTLALYRGLAFVVLGDGAVADFPALYTN
FT                   WVTGTIGGTPLPNVLIVIVALAVVFGVILHATPIGRAVFAVGASEQAARFAGVRPGRLK
FT                   FWLYVVSGLVAGLAGVLWTLRYSSARADNGAGLELAVVAAVLLGGVSIFGGKGALPGVI
FT                   AGVVLLASLQNALRLSDVSNEALNVVTGVLLIASVLAPNLANAVRGAVQRRRHRTDLL"
FT   gene            260868..261959
FT                   /locus_tag="Kfla_0259"
FT   CDS_pept        260868..261959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0259"
FT                   /product="rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein"
FT                   /note="TIGRFAM: rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein; KEGG: bpy:Bphyt_5681 rhamnose ABC
FT                   transporter, periplasmic rhamnose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29383"
FT                   /db_xref="GOA:D2PT67"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="PDB:4KVF"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT67"
FT                   /inference="protein motif:TFAM:TIGR02637"
FT                   /protein_id="ADB29383.1"
FT                   /translation="MSFRLSRRTAVPLSTVAVLSLALTACGGGTTKESTANDATAAPSA
FT                   TTSAAADPNAPLKEGLKIAYLPKQLNNPYTDVEVGGGKVAVGEIKGEYKLVGPNDASAS
FT                   SQVSYINTLIQQQQDVIVVAANDPNAVCPSLNQARKADIKVVTFDSDAAKTCRDAFINQ
FT                   ATTQGIGESLVKMAKELAGGSGEIAVLSATPNATNQNSWIEVMKTELAKPENAKLKLVK
FT                   IAYGNDDDQKSFTEAQGLLQSYPNLKVIVSPTTVGIAAASRYVSASSYKGKVAITGLGL
FT                   PNQMRQYVKDGTVKKFALWNPADIGYLAAYAGAALKSGQITGAQGEKFKAGKLGEYTVG
FT                   AAGEIVLGPPTEFTAANIDQFNF"
FT   sig_peptide     260868..260951
FT                   /locus_tag="Kfla_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.717 at
FT                   residue 28"
FT   gene            261978..262313
FT                   /locus_tag="Kfla_0260"
FT   CDS_pept        261978..262313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0260"
FT                   /product="protein of unknown function DUF718"
FT                   /note="PFAM: protein of unknown function DUF718; KEGG:
FT                   kpe:KPK_5476 L-rhamnose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29384"
FT                   /db_xref="GOA:D2PT68"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT68"
FT                   /inference="protein motif:PFAM:PF05336"
FT                   /protein_id="ADB29384.1"
FT                   /translation="MNRYCFCLQVKPDRLDEYVERHRDVWPDMRAALHEAGWHNYSLFL
FT                   RDDGLLIGYVEAEDLEAAQKAMAATEVNARWQAEMQQFFAGSDGRPPDESFLLLREIFH
FT                   LTPPAED"
FT   gene            262318..263481
FT                   /locus_tag="Kfla_0261"
FT   CDS_pept        262318..263481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0261"
FT                   /product="L-rhamnose isomerase"
FT                   /note="TIGRFAM: L-rhamnose isomerase; PFAM: Xylose
FT                   isomerase domain protein TIM barrel; KEGG: smd:Smed_0222
FT                   L-rhamnose catabolism isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29385"
FT                   /db_xref="GOA:D2PT69"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR013457"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT69"
FT                   /inference="protein motif:TFAM:TIGR02635"
FT                   /protein_id="ADB29385.1"
FT                   /translation="MTTEAVKNALRRQEIELPSWAFGNSGTRFKVFSQPGVPRSPEEKI
FT                   ADAAVVHRYTGVAPSVALHIPWDKVDDYAALAAYAKEQGVRLGAINSNVFQDDDYKLGS
FT                   VTNPDPRVRRKATDHLLECVDIMDATGSRDLKLWFSDGTNYPGQDDIQDRQDRLATALK
FT                   EVYDRLGDDQRMLLEYKLFEPAFYTTDVPDWGTSYAHCLELGPKATVCIDTGHHAPGTN
FT                   IEFIVAFLLRVNKLGAFDFNSRFYADDDLMVGAADPFQLFRIMNEIVRGDALDPDRGIA
FT                   FMLDQCHNIEAKIPAIIRSVMNVQEATAKALLVDRDALRKAQADGDVLGANAALMDAYN
FT                   TDVRPLLADLRAEQGMDPDPVAAYRRSGYFEQISKDRADGRQAGWGA"
FT   gene            263478..265517
FT                   /locus_tag="Kfla_0262"
FT   CDS_pept        263478..265517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0262"
FT                   /product="rhamnulose-1-phosphate aldolase/alcohol
FT                   dehydrogenase"
FT                   /note="TIGRFAM: rhamnulose-1-phosphate aldolase/alcohol
FT                   dehydrogenase; PFAM: class II aldolase/adducin family
FT                   protein; KR domain protein; short-chain
FT                   dehydrogenase/reductase SDR; NAD-dependent
FT                   epimerase/dehydratase; KEGG: smd:Smed_0223 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29386"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013454"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT70"
FT                   /inference="protein motif:TFAM:TIGR02632"
FT                   /protein_id="ADB29386.1"
FT                   /translation="MTVTDTAAELVARSNRLGADPRNTNYAGGNTSAKGTATDPVTQQP
FT                   VDLVWVKGSGGDLGTLTAAGLAVLRQDRLNALVDVYPGVEREDEMVAAFDYCLHGKGGA
FT                   APSIDTAMHGLVDAPHVDHLHPDSGIALATAADGEKLTAECFGGRVVWVPWRRPGFQLG
FT                   LDIAQVKRDNPQAIGVILGGHGITAWGDTSAECEANSLEIIRTAERFLAERGKAEPFGA
FT                   VVPGFEALPTEQRRQRAAALAPVIRGLASTGNPQVGHFNDDDVVLEFTAREKLAELAAL
FT                   GTSCPDHFLRTKVRPLVLDLPPAAPLEEAVTRLKELHLQYREDYAAYYDRHAEPDSPPM
FT                   RGADPAVVLVPGVGMFSFGKDKQTARVAGEFYVNAINVMRGAEAVSSYAPIDEREKFRI
FT                   EYWALEEAKLQRMPKPKPLATRIAFVTGGGSGIGKAIAHRLAAEGACVVVADLDTAAAE
FT                   AVAKEIGGPDQAIAVGADVSSEAAVAAAFEQAVLAFGGVDLVVNNAGLSISKPLLETTE
FT                   KDWDLQHDVMAKGSFLVSRAAAKVLIDQAIGGDIVYISSKNAVFAGPNNVAYGAAKADQ
FT                   AHQVRLLAAELGGHGIRVNGVNPDGVVRGSGIFAKGWGAQRAAVYGVPESELGAFYAQR
FT                   TLLKREVLPEHVAAAVFALAGGDLSHTTGLHVPVDAGVAAAFLR"
FT   gene            265548..267011
FT                   /locus_tag="Kfla_0263"
FT   CDS_pept        265548..267011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0263"
FT                   /product="putative L-arabinose isomerase protein"
FT                   /note="KEGG: sme:SM_b21420 putative L-arabinose isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29387"
FT                   /db_xref="GOA:D2PT71"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT71"
FT                   /inference="similar to AA sequence:KEGG:SM_b21420"
FT                   /protein_id="ADB29387.1"
FT                   /translation="MWSTNPTRSVDGNGLLPWVEPRRTRIGLVAGGLGAYWPQFPELLP
FT                   QLQASARRVSERFAEFDCEVVDAGFISDAQEGAAAAEKLRLADCDLIVGFLTTYMTASM
FT                   LVPVAQRSGAPVLLLNLQPTEAMDHATFDTGAWLAYCGACPLPEMANAFERCGIDFRSV
FT                   SGYLEDERAWDRIGRWLRAAGVRAALRHGRHGLLGHLYPGMMDVITDPTLVSAQLGGHV
FT                   EILEIDDLRVRVEKVTPAETEARMKVAQDVFTLDESVVEHDFRWGATVSVALDRLVEDF
FT                   ELDSLAYYHRGLDGETHERVAAGMILGASLLTARGVPAAGEYELRTSLAMLMMHKLGGG
FT                   GSFTELQALNFHDNVVEMGHDGPAHLAISSAKPLLRGLGVYHGKRGWGVSVEFDVAHGP
FT                   VTALGLGQLRDGSFKMIASEGTVVPGPLLQIGNTTSRVDFGCDPGEWTDAWSASGVAHH
FT                   WALGTGHRVPELKATASLLHLPLEVVDPS"
FT   gene            267072..268520
FT                   /locus_tag="Kfla_0264"
FT   CDS_pept        267072..268520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0264"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: eca:ECA0440
FT                   rhamnulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29388"
FT                   /db_xref="GOA:D2PT72"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT72"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADB29388.1"
FT                   /translation="MSLRLAAVDLGASSGRVMVGRVGPDTLELSEVHRFSNGPVRVQGT
FT                   LHWDILRLYQETLAGLGEAARTGPLDGLGIDSWAVDYGLLDAEGRLLGNPVHYRDSRTD
FT                   GVMDGVLRKIPAEDLYAVTGLQQLPFNTIYQLVAERALDRATSLLLIPDLLSYWLTGVA
FT                   GAEATNASTTQLYDVRFRTWSADLAGRIGVPLELLPPLREPGQVIGPVLPEVAEETGLD
FT                   ATTPVIAVGSHDTASSVVAVPAAAGDRFAYISSGTWSLVGLELPEPVLTPAAQEANFTN
FT                   EGGVDGRTRFLKNVMGLWILQECLRVWGTDDLVQLLKGAADVPAFGVLVDPDHPSFLAP
FT                   GNMPARIAEFCAQSGQEPPTSRAVIVRCVLESLALAYRRTLRRAQQVAGREVDVVHVIG
FT                   GGSQNELLCQLTADACGVPVLAGPVEASALGNVLVQARALGEPLPDLDAMRALVRATHR
FT                   LRRYEPQGRPADWDAAESRVFGTR"
FT   gene            268525..268851
FT                   /locus_tag="Kfla_0265"
FT   CDS_pept        268525..268851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0265"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rsh:Rsph17029_3418 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29389"
FT                   /db_xref="GOA:D2PT73"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT73"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADB29389.1"
FT                   /translation="MTVLHNETRPRPELSDLARASEHCGFLRATHQCGLPRATPEPALP
FT                   REISHEDLKLLRLLATGLPMDAVARRLDLSERTVRRRTRAACDRLGFGTAIEAIVWAAH
FT                   RGLL"
FT   gene            269044..272241
FT                   /locus_tag="Kfla_0266"
FT   CDS_pept        269044..272241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0266"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: ccs:CCNA_01029 alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29390"
FT                   /db_xref="GOA:D2PT74"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT74"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ADB29390.1"
FT                   /translation="MSFRTRFGCLLAAVLLLTPLVPATGSPPATRETLQVRNLKTNNLT
FT                   NPLGVPGTPPRLSWQLDGDRRGITQSRYQIRVASTPAKTARPDIWDSGVVRSTDSIEVP
FT                   YGGPALTTGTAYHWTVRVWDDAGKASAWSPVATFETGPLRPGDWQGDWIGADNQPGPEW
FT                   TDTTIDADVTLVKDALGVFFRGRGGVGYMWQLNQLTPDKPLLRPHVRQPGGGYVLLGEI
FT                   PLAAGTDLKQRHHLRITVAGRTITTWLDGVQVDSRERSDHNAPGVVGFRTDGAEHGVVH
FT                   SLKVTNVAGEVLVDTAFPAGDQTFPDGTVRAEGGLQVKGTTDLWLPGKPIPVFRKAISL
FT                   PKAKKVASARIDAAAQGIYELTVNGRKAGDHQLAPGWTDYARRIQSQTYDVTKLLKSGA
FT                   NTLGAEVAPGWFTGNLAMFGPNKYGTDTAFIAQLRVTYTDGTADVFATDSSWQTAPGAV
FT                   RVADLLNGESYDARRTASEWVPAQVRPSATAKIVPQTDQPVRVTQELKARAIPSPTPGA
FT                   YLYDLGQNMVGIARLTLHGRPGQTVKIRYGEVLNPDGTLYTDNLRSAKATDHYTFATSR
FT                   PETYQPRFTFHGFRYVEVSGLPTAPPASAIVGVVLGTDAEQVNEFRTNSPLVNQLHSNI
FT                   VWGQRGNFLSIPTDTPARDERMGWTGDINVFARTAVYNLDSQAFLTKWLQDLRDTQRAD
FT                   GAYASVAPTVPNSFDGGMGNAGWADAGVNVPWTLWQAYGDTSVIRQHYASMTRYVDYLV
FT                   ASSNGLIRGGGDYGDWLNLDDPTPGELIGTSFVAKGARQLSQMAAAIGHTADAAKYQRV
FT                   YEDVRAAFAARFVAADGKVGSDSQTGYILAFTSDLVPADRIAAAGEHFAATILRRDTHL
FT                   STGFLGVDGLLPVLTKIGRTDLAYRLLQNTSYPSWGYEIGKGATTIWERWNSINPDGTF
FT                   NDVGMNSFNHYAYGAVGEWMYRTLAGLSAAEPGYRKALIAPTPGDGIDTAQLRHRTPYG
FT                   EVGSQWRRLADGRFTLEVEVPANTTATVRLPAAEARQITESGRALSRAVGVSGVVDEGT
FT                   TVALTVGSGNYRFAVRP"
FT   sig_peptide     269044..269121
FT                   /locus_tag="Kfla_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 26"
FT   gene            272388..273161
FT                   /locus_tag="Kfla_0267"
FT   CDS_pept        272388..273161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sek:SSPA1858 cell envelope integrity inner
FT                   membrane protein TolA"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29391"
FT                   /db_xref="GOA:D2PT75"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29391.1"
FT                   /translation="MDGNTVLWIVVAAVVVLILLALIAAAAKKAKQRRIEHDRQAAVEH
FT                   EQKARLSAVHAERQHAAADEVEARSRKAQAIADEKAAEARRLAAGATERREAAEQASSE
FT                   SSEHLTKAQELHPEAQRRDDDDSADRSPHAASWGTDAEHAEGADRHRRDVQGDDGLRRG
FT                   SPEAAGTAGSPGAPMRGATEDQLSAPGAREELGNRDAGQVGDRDAGGQVGDRDADGRLM
FT                   DDGRAQHAANDRPVDADPVVDPDGDGRTPRHSSQQ"
FT   sig_peptide     272388..272468
FT                   /locus_tag="Kfla_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.879 at
FT                   residue 27"
FT   gene            complement(273476..274144)
FT                   /locus_tag="Kfla_0268"
FT   CDS_pept        complement(273476..274144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0268"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: sfu:Sfum_2007 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29392"
FT                   /db_xref="GOA:D2PT76"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT76"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB29392.1"
FT                   /translation="MNRILIAEDEQRIASFVERGLRSNGFVTTVVADGETAYQEGVSGG
FT                   YDLLLLDLGLPRVDGFTVLRRLREARVTMPVVILTARDGVRDTVAGLEGGADDYIAKPF
FT                   AFEELLARVRLRLRSDGSGTADANILQVGDLSLDLRTRRASVDGRTVDLTAREFLLAEV
FT                   FCRHPDQVLSREQLLSQVWGFDFDPGSNVVDVYIRYLRRKLGPDRIQTIRGMGYRLRPG
FT                   "
FT   gene            complement(274141..275559)
FT                   /locus_tag="Kfla_0269"
FT   CDS_pept        complement(274141..275559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0269"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   sfu:Sfum_2006 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29393"
FT                   /db_xref="GOA:D2PT77"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT77"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB29393.1"
FT                   /translation="MLGVLALAVTAVVFLTWQVLSARSDAAADAELTHEATKFRAYAGS
FT                   PTAASLTTPEDLLDRWLQSNLPDTSEAFFTIVDGRAYHRSQGTPPARLDTDTAFVQRIG
FT                   SATTPQYGWVDSTAGKVRYAVIPVRVGTEPVRAQLVLLEFRDLLAQPLEDAAKALALIG
FT                   LVTLAMAAGACWIVTGRVLAPIRQVRATAEQIGASDLRRRIDVVGNDDVAQLARTFNTM
FT                   LDRLEFAFTAQREFVDNAGHELRTPITVIRGHLELMSDDPRDREQTRALILDELARMNR
FT                   MVDDLLVLAKSGRPDFLELEQVNLTELVVEAVAKARPLADRTWRVDESADASMLADGQR
FT                   LTQALMQLVSNAVRHTRPGDRISVGSRVIPADPDGPARVLLWVEDSGAGVCVADRERIF
FT                   DRFARGNDQGRTDGAGLGLAIVRSIARAHGGDARLADGGGPGARFELELPFGPAVEQSV
FT                   DEELGEIVESEEVR"
FT   sig_peptide     complement(275494..275559)
FT                   /locus_tag="Kfla_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.229 at
FT                   residue 22"
FT   gene            complement(275698..276027)
FT                   /locus_tag="Kfla_0270"
FT   CDS_pept        complement(275698..276027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical LOC100006405"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29394"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29394.1"
FT                   /translation="MRSPRLVYLAVVLVLAVGGFALTRYLADRSSPGLGETVVVPAGSG
FT                   VSVPPRSPGTPPATAPTTAPPTTAPTTPGADPVAPGSPRTAGENDDRDDDGIDDDLDDA
FT                   VQGDD"
FT   sig_peptide     complement(275962..276027)
FT                   /locus_tag="Kfla_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.453 at
FT                   residue 22"
FT   gene            complement(276093..277364)
FT                   /locus_tag="Kfla_0271"
FT   CDS_pept        complement(276093..277364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0271"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein; KEGG:
FT                   rsq:Rsph17025_2649 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29395"
FT                   /db_xref="GOA:D2PT79"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT79"
FT                   /inference="protein motif:TFAM:TIGR02079"
FT                   /protein_id="ADB29395.1"
FT                   /translation="MQGSETVARPTVGAAEVEAAVRRLDGVALRTPLQRNPRLSARTGA
FT                   EVWLKREDLQIGRSYKLRGAYNLIAQLDEAAKRAGVVCASAGNHGQGLAYSCHTLGVSG
FT                   RVYVPRTTPRQKRDRIAALGGAQIEVIVTGDTYDDAAAAALAEAAATGATLVPAFDDPR
FT                   TVAGQGTVAVELVEQLGRTPDVLVVPVGGGGLVAGVAAYLAERHPGVRIVGVEPAGAAS
FT                   MAAALAAGEPVTLPQLDSFVDGAAVRRVGDVTLPLVSAAGVEMISVPEGLVCSEMLELY
FT                   QTDGLIAEPAGALSAAALGHGVELKPGETVVCLLSGGNNDVSRYGEILERSLVHEGLKH
FT                   YFLVTFPQEPGALRQFLDGVLGPDDDITLFEYVKRNNRETGVALVGIEIGRPGDLAGLL
FT                   DRMDAAPLDIERIRPDSAEFRYLI"
FT   gene            277599..278465
FT                   /locus_tag="Kfla_0272"
FT   CDS_pept        277599..278465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_3748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29396"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29396.1"
FT                   /translation="MELIPFSLWGDALWCGQEVVRETAHEQAIRSLFPDPIPARGADLD
FT                   TDADLVPEPHNRFDPRSIAVRVQGKVVGYLPRDDAHRYHPVLSELVAQGLQPQVPCHLW
FT                   VSEWEPADWEGKGNHTKEFHASVAVALGQPHMLVPVNLPPPGSFHVLPPGSGIVVPGSE
FT                   IRPEVLAPFFRPEGECWAYATLHAADEDDGVHDRPRTVVEVRLDDEPVGRLSPRLSAEF
FT                   LPAIHYLADMRAETAARVAVRGDRFASEVILYAARSHDLPATWPDGLTRSPVASPTWHY
FT                   WAGKEAN"
FT   gene            complement(278587..279330)
FT                   /locus_tag="Kfla_0273"
FT   CDS_pept        complement(278587..279330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0273"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dol:Dole_3235 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29397"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT81"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB29397.1"
FT                   /translation="MTSLTVLGTAAPYPLPDRPCSGYLLQGGGAKVWMDAGPGSLAELL
FT                   RHTSLDQLDAIWVSHLHLDHVGDVLNAYYALAYGLLPPLVRPLPVYAPAGLGKRLAGFF
FT                   EQPDAGFVSNVLELRELRDGLTVELGGLQLVSGAVEHGCDAYGLRASAEGRTLAYSGDC
FT                   EPCPALDELAAGVDLLLCEADSGEASGGHHTPEQAGAVARRTGVRRLVVTHVGPSLTPD
FT                   AATARAAAVFGGPTACAEVGLTMPW"
FT   gene            complement(279327..280286)
FT                   /locus_tag="Kfla_0274"
FT   CDS_pept        complement(279327..280286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0274"
FT                   /product="Acetyl xylan esterase"
FT                   /note="PFAM: Acetyl xylan esterase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29398"
FT                   /db_xref="GOA:D2PT82"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT82"
FT                   /inference="protein motif:PFAM:PF05448"
FT                   /protein_id="ADB29398.1"
FT                   /translation="MLSFEMSAEELSVYQGTNPRPDDFDQFWDKALAELAGTDADASFV
FT                   DATDFPLTTATAQHLYFNGTGDYRVHAKVIRPQEPAGPAVLMFHGYGGEQPRWVDLLPY
FT                   AARGFTVAALDVREQVGFRTSSQEPNSFSLHNHLVHGLDGGPDSLLYKHVFLDTRRLAD
FT                   IIRGLPEVDGARVATTGWSQGGGLSLVCAALTPEIKYAASVYPFLTDYQRAWELNLDTN
FT                   PYNEITTWFKKRDPRHLREQEVFTTLGYIDLQHLAPRVQAEVTLFVGLEDQVCPPSTQY
FT                   AVYNKLTGVKELRTYPDLGHDDLPGAHDDIYQLIGAKL"
FT   gene            complement(280333..280791)
FT                   /locus_tag="Kfla_0275"
FT   CDS_pept        complement(280333..280791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29399"
FT                   /db_xref="GOA:D2PT83"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29399.1"
FT                   /translation="MRTTYRMRAGRFLGILAVGLILFGVAAIAWAVGLPDAVVGVFAVL
FT                   GGLVALAGLWVLARPPVLLKLGEDRIEVRGLKTEWTDVTEVGRVATTHGEAIALRTKHK
FT                   DGSILIPLRWLAPGRTEQLEQELRERLNTAHGYTIWDGTAGPADDRAE"
FT   sig_peptide     complement(280696..280791)
FT                   /locus_tag="Kfla_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 32"
FT   gene            complement(280847..282406)
FT                   /locus_tag="Kfla_0276"
FT   CDS_pept        complement(280847..282406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0276"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29400"
FT                   /db_xref="GOA:D2PT84"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT84"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADB29400.1"
FT                   /translation="MSRSTRAAGRRAAPRGNRSRHRAYRTRSVSKAIGLTLVSALIPGS
FT                   GFVMGGRTKLGAFVMTLSFGLLALAAYIGLTNRNAVLELAVDPRRLLIATAAVVVLGLL
FT                   WIWVVVASHKLLRPVSLTALGRLAGSAFVGLICFGIAVPTTVAAQTVMAQRDLVGSVFA
FT                   SEGNSKSATRPDVEDKKDPWADQPRLNILLLGADDGAGREGTRTDTVMVASIDTKSGDT
FT                   KLISLSRNWMRMPFPEDSPLHKLYPDGFYDPDLGNVEQPEYYLDAMYRNLPAAHPGVLG
FT                   PSDNEGADVLKVSAGAALGLDIDYYMQVNLKGFESIVDALGGITVNINYRVPIGGDYRG
FT                   AGSADDVLPKDYLEPGRNQKLNGHDALWFARGRYGLSDISRQERQRCTIHALVSSANPG
FT                   TLVTKYQQIASASKKLLQTDIPQEILPAFIELGLKVKNAKVSNIDLDKNKNFPSGRNPN
FT                   YEAMREIVQKAIAPKKTVASTPASPVTPRKPSTGKSTAPPKAPAGGTEDLSDACAYHPA
FT                   NP"
FT   sig_peptide     complement(282254..282406)
FT                   /locus_tag="Kfla_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.793 at
FT                   residue 51"
FT   gene            282673..282762
FT                   /locus_tag="Kfla_R0005"
FT                   /note="tRNA-Ser2"
FT   tRNA            282673..282762
FT                   /locus_tag="Kfla_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(282932..283825)
FT                   /locus_tag="Kfla_0277"
FT   CDS_pept        complement(282932..283825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0277"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   ppw:PputW619_1694 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29401"
FT                   /db_xref="GOA:D2PT85"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT85"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADB29401.1"
FT                   /translation="MKLGVMVPVGGSDGPDGQLPGWADTRRLAEAAEQSGLDSVWLADH
FT                   FFYRDPAGTTYGMHEAWTLLSALAVVTSRVELGTMVLCASFRDPGLVAKMAATLDEVSG
FT                   GRLILGVGAGWHDPEYEANGLPTDHRVGRFEEWLEIVARLVRGETVSMEGKYYTVVDNA
FT                   LVPAPQRRIPVLVAALRPRMLDLTAQWADAWNTAWFGAVDEKVRERLDDFDAALERNQR
FT                   PAGEVATTVGVTVRDPDQPAIPDGASNALAGTVEELAEALTEYAALGVDHLVVGLEPMT
FT                   PRSVERLAEAGRLAFG"
FT   gene            284053..284286
FT                   /locus_tag="Kfla_0278"
FT   CDS_pept        284053..284286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29402"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29402.1"
FT                   /translation="MAVTDSAIRPQTYDLRSILQLSLPAHVTAWVDGGWRPAWLISRLH
FT                   CGDGWIGLVQYTAVTGHEHTLRLPIDRLAPPN"
FT   gene            complement(284447..286324)
FT                   /locus_tag="Kfla_0279"
FT   CDS_pept        complement(284447..286324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0279"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   pzu:PHZ_c2232 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29403"
FT                   /db_xref="GOA:D2PT87"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT87"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADB29403.1"
FT                   /translation="MTTTASPAQTEEALSVESSTAPPAHLDLSDAPTEHAGLLAWVAEV
FT                   AALTQPDRIHWVDGSDAEYTRLTDELIAAGTLVRLNDKLKPNSFWARTDPSDVARVEQR
FT                   TFICSVDEADAGPTNNWMDPAEMKALMTDLYRGSMRGRTMYVVPFCMGPLTAEKPMFGV
FT                   EITDSAYVVASMRIMARTGADVLAKMGTDAPYVPCLHSVGAPLEPGQKDVSWPCNDEKY
FT                   IVQFPEERTIWSYGSGYGGNSLLGKKCYSLRIASAMARDEGWLAEHMLILKLISPEKKV
FT                   HYVAAAFPSACGKTNLAMLDPTLEGWQVETLGDDIAWMRFGEDGRLYAVNPEFGLFGVA
FT                   PGTGWKTNPNAMRTIEKGNSVFTNVALTDDGDVWWEGYSETPPNHLTDWKGRDWTPDSG
FT                   ELSSHPNSRFCTPIKQCPIIADEYDDPNGVPISAIIFGGRRATTVPLVTEARNWQHGVF
FT                   MGATLSSETTAAAVGEVGVVRRDPMAMLPFLGYNAGDYLNHWLTVGQQHDDALLPKIFY
FT                   VNWFRKDDAGTFVWPGFSENSRVLKWVIDRIEGQAAADETPIGYVPTPDALDVGGLNLT
FT                   PEALRVALDVDAEEWKAEIPLIEEWFAKLGDKVPAELKLELDGLRSRLG"
FT   gene            complement(287672..288220)
FT                   /locus_tag="Kfla_0280"
FT   CDS_pept        complement(287672..288220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0280"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: met:M446_1964
FT                   YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29404"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT88"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADB29404.1"
FT                   /translation="MEYFVYGRDRAGGYEIKVRLAEPHWTFMDGYADRLIARGPTLTED
FT                   SEEAETTGSLHIVELADVDAARAFAYDEPYYRAGAFESVLLYGFRRHQDRTMWDFTGAV
FT                   QGYGRFLVLTTDEPSPTPDSEHLILSGDLLALDTGQPIGRAALVEAPDAATAATVLAPT
FT                   DPRRTDVHHWRFGGRPTLQ"
FT   gene            288232..288492
FT                   /locus_tag="Kfla_0281"
FT   CDS_pept        288232..288492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29405"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29405.1"
FT                   /translation="MRDMATDYGEPIGRVLGDGFQIPPLLPGWTALDGIVLVKCLDDEG
FT                   HSSWAFRETEGLNVEEAIGALTVQLDMLRERSVDAFRTDED"
FT   gene            complement(288596..288979)
FT                   /locus_tag="Kfla_0282"
FT   CDS_pept        complement(288596..288979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29406"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29406.1"
FT                   /translation="MRYDPHALAEPADDLRYAANKLHGDEIVTAGGAAFRELKPAEWLG
FT                   RGEVEELIGRTPGVELLLVDDTVDMPKVCRVPGPARKAWRQRLSALCSSDDGEFDPQVG
FT                   WGLMAYRWATSGGREALVFRFEC"
FT   gene            complement(289029..289382)
FT                   /locus_tag="Kfla_0283"
FT   CDS_pept        complement(289029..289382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29407"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29407.1"
FT                   /translation="MEQLEADNPEVPGQPVEFRSLIADGEYVDEQGACWSMRGGELRWS
FT                   RIQHLADDPEVRVVHVYLSEVQKVATGEREGLLAKVRPYLQGGVGLDEHTDFRVAEFKD
FT                   DRHRSLLVVEESC"
FT   gene            complement(289472..290260)
FT                   /locus_tag="Kfla_0284"
FT   CDS_pept        complement(289472..290260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0284"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: probable delta(24)-sterol
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29408"
FT                   /db_xref="GOA:D2PT92"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT92"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29408.1"
FT                   /translation="MEDAELDVLLRNDRYPRSAAYSARWMVDNAMGPNPVWQAEALTDV
FT                   MSLEPGMRVLDLGCGTALSSVFLAKEFGVEVWATDLWIKPDDNLRRVIEAGVEDQVRPV
FT                   YAEAHALPYAEDFFDALVSIGAYHYFGTDDLYLGYCSRFVKPGGRIGVVQPGFVAEPGA
FT                   VPPPHLQPHWKWDFCAWHSAAWWRRHWEKTGLVTVEVADQLPHGWQDWLQWNEACDLDG
FT                   GEPGREEARMLHADGGRALGLTRMVARRNSQPLHSSLTAE"
FT   gene            290401..290808
FT                   /locus_tag="Kfla_0285"
FT   CDS_pept        290401..290808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0285"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rlt:Rleg2_2175 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29409"
FT                   /db_xref="GOA:D2PT93"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT93"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB29409.1"
FT                   /translation="MVARIPISVAVLVRDGLVLLVHRHPSRRWYPDCWSFSAGGHVEVG
FT                   ELPHQAVSRECLEELGVHVHDPLPIPLTVSDPTLDMHAFLVTRWEGEPVNAAPDEHDDL
FT                   RWFRPSDLAELKLAHPESLSSILSAVQLATG"
FT   gene            complement(291108..291183)
FT                   /locus_tag="Kfla_R0006"
FT                   /note="tRNA-Arg6"
FT   tRNA            complement(291108..291183)
FT                   /locus_tag="Kfla_R0006"
FT                   /product="tRNA-Arg"
FT   gene            291344..291898
FT                   /locus_tag="Kfla_0286"
FT   CDS_pept        291344..291898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcj:BCAS0321a hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29410"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT94"
FT                   /inference="similar to AA sequence:KEGG:BCAS0321a"
FT                   /protein_id="ADB29410.1"
FT                   /translation="MDIGELLGGRDLGDVKKAVGFVVENSDDFEKVLKLVRELPDDAVG
FT                   FIGRLPELLKTIGGGLAEAGEQAAKAAGALVGDDGEGGARKALSGSADTMHAAKDRLKD
FT                   AAGMLAGLAGELDKIPGIGDAAAKRLNDGSGQVGGVATEIESLAGNLQDLSGILASVGE
FT                   ALAGLGTKLSESGGTVKTLLG"
FT   gene            292289..292888
FT                   /locus_tag="Kfla_0287"
FT   CDS_pept        292289..292888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29411"
FT                   /db_xref="GOA:D2PT95"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29411.1"
FT                   /translation="MVRVGGVAGRVVRGTVIAAVVAVVVGLGIGFAAGEPVREDDILPA
FT                   RKLPADLCARLGDISGLLPKATEPVTFVQTGTTEVRCRAVVDESQQSTFTAATLDVRIT
FT                   PYAGRDGGAGELPFRPDQIARKAFDRQAGKVVPDRPYPTKIQRTGRTGGQDWLIGVVVL
FT                   RGDIVVHVDYAAYPVTAEKAEQAALVLADRAIWETK"
FT   gene            292885..294312
FT                   /locus_tag="Kfla_0288"
FT   CDS_pept        292885..294312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH21940 gene product from transcript GH21940-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29412"
FT                   /db_xref="GOA:D2PT96"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29412.1"
FT                   /translation="MNSTPEIPGYRLDQRLLAHPLAEIWRGRSSTGMEVVALVLSEAGA
FT                   GDPVIRERLGAASRGAAFGAGQDETPLWAANLTAGTPYAITQLIPGQTGAERLIDPLDG
FT                   LLGNDQESIAAVREQLAGYGAAAVPAVGLSEGAVGGESGLPRYADSPGIGQGQEFAPSA
FT                   DNGSGAASATGAGSASGGPGTTGAGSRAGAGSANGPGSAASAGGAGIVGGGASAGGAEG
FT                   AGAGAGAQPGPGQVGADGKDRPRSAKWIYAAAVVVVLVAFSLAYSVGAAVGSKIKEQEP
FT                   AAAPPAVVSPGPLPSPVLLPGIVKPPSAPWSRLQRFEGLVGSTYQLNASVEVVRGIGLP
FT                   FEFGVPEPPVLEERTAVESASTIYRRVLTAKTPQDSSLDVRIAVRPCADLPGCLAARAA
FT                   FDKEWTTAYKVPVPRTAKDNRTWYSLQAPGKPHAVMMSHAFSAQGRSWLVGVAATAGPG
FT                   REQWAEQVVNDIWRQTS"
FT   gene            complement(294365..295357)
FT                   /locus_tag="Kfla_0289"
FT   CDS_pept        complement(294365..295357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0289"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rle:RL2998 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29413"
FT                   /db_xref="GOA:D2PT97"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT97"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADB29413.1"
FT                   /translation="MTANRSLKRQVRARAAKTGESYTTALRHFRPTLRGDEMPKTLRLA
FT                   VAQTTYRDDPRDPALLRASGQEIRRLMRDAHAAGARIVHFTEGATCFPNKHLMSSTGPD
FT                   EVGPADWTRFRWDVLRDELTAITRLAGELGLWTVLGSVHPLTAPNRPHNSLYVISDRGK
FT                   VATRYDERTLSTTKRTWMYTAGTAPVTFEVDGFTFGCALGMDVHMHELFSAYEDQEVDC
FT                   LLVSTTGGVPVGPAEAAEAQGYAATHHFWVSFAVTAEHSLAVPSGVTGLDGSWTAQCPA
FT                   DGRPAVTLVELNPEDRSPGLRTWRRNTRRALADHLTAPADTRSTTRTSF"
FT   gene            295649..296653
FT                   /locus_tag="Kfla_0290"
FT   CDS_pept        295649..296653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0290"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sml:Smlt2638 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29414"
FT                   /db_xref="GOA:D2PT98"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:D2PT98"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADB29414.1"
FT                   /translation="MSIRIGYKASAEQFGPRDLVEYAVRAEELGLDSVTVSDHFLPWRH
FT                   EGGHAPFALAWMAAVGERTNRVLIGTSVLTPTFRYNPAVIAQAFATMGLLYPGRIMLGV
FT                   GTGEALNEIAVSGREWPEFKERFARLREAVDLIRDLWTKEGVSSDGPFYPTVDASIYDR
FT                   PETPVKVYVAAGGPLVAKYAGRAGDGFIATSGKGMELYTEKLLPAVKEGAEKAGKTFED
FT                   VDRMLEVKVSYDRDPEAALENTRFWAPLSLTPEQKHSVDSATEMERLADELPIEQVAKR
FT                   WIVASDPEQAVKQFRPYLEAGFNHFVVHGPGHDQERFLTQFTEDVVPLLRKLG"
FT   gene            296691..297578
FT                   /locus_tag="Kfla_0291"
FT   CDS_pept        296691..297578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0291"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   nmu:Nmul_A1284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29415"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D2PT99"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADB29415.1"
FT                   /translation="MERWTDGPYRIGISGWRYAPWRKAFYPDGLPQRAELEYAARRLNS
FT                   IELNGSFYSLQRPASYQRWCDQTPAGFVFAVKGPRFVTHMKKLAEVDAPLANFFASGVL
FT                   ALGDKLGPVLWQLPPNLGYDEDRLAAFFQLLPRTTGEAAELAKRHDERMEGRALLECAV
FT                   DVPIRHALEVRHASYERSEFVELLRAHDVALVCADTAGKWPMLDDVTSDFVYVRLHGAE
FT                   ELYVSGYDDDALDRWARRIKTWHSGRTPTDGQRVGSPAPRQRRNVYVYFDNDVKVRAPF
FT                   DAEGLARRLGVELG"
FT   gene            297611..298192
FT                   /locus_tag="Kfla_0292"
FT   CDS_pept        297611..298192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1054 GCN5-related N-
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29416"
FT                   /db_xref="GOA:D2PTA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29416.1"
FT                   /translation="MTFEVVRADDPRCAVLEAAGYTVVGESWAARLRDPAPALLDHAVR
FT                   RAVAAGVIVRELGPEYAVALHELETANERDYPYTPATHRVVGTVEVVRGLWSAGRVFGA
FT                   LDSDRLVGATHIRPDGETGFTSVLDGYRGRGIGQAVKAASILALLADGVRVFGTGGAAL
FT                   NGASLGANLALGYVVEERWRSYAPPVASTG"
FT   gene            complement(298203..298577)
FT                   /locus_tag="Kfla_0293"
FT   CDS_pept        complement(298203..298577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypb:YPTS_1388 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29417"
FT                   /db_xref="GOA:D2PTA1"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29417.1"
FT                   /translation="MAKGNRLSFFSLVIGGAAGFGLLWLTRRAWDTCRVEVNGVGNGPT
FT                   LLFVGLPVALVVNIVLFSVVWRVMKKGGGGKFLMPLLGALIAITIADLALFSWAGTPAT
FT                   LPAALCPANVPPWWPEWIPT"
FT   gene            complement(298647..299186)
FT                   /locus_tag="Kfla_0294"
FT   CDS_pept        complement(298647..299186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0294"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aav:Aave_2197 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29418"
FT                   /db_xref="GOA:D2PTA2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29418.1"
FT                   /translation="MGYDLAKLELRWWRVADAVRLTAAHEDPAMAGQGGIRDTASAVDW
FT                   IGRVADLDNGHVYAVADADDHPVGCVAVTNIDRHQVGWTWYWTIAAVRGQGVARDALRA
FT                   LVDWAHHDAGLYRLELGHRVDNPASCHVAAGAGFLREGLERERLAHDGARYDVERHARL
FT                   VSDPLEPPSRPVTVAT"
FT   gene            299351..300118
FT                   /locus_tag="Kfla_0295"
FT   CDS_pept        299351..300118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0295"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: csa:Csal_1758 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29419"
FT                   /db_xref="GOA:D2PTA3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29419.1"
FT                   /translation="MRFLDFSDQVVLVTGASSGIGAAAAVGFAQTGATVALHYHHNESG
FT                   AGHTLSAVNTAGGSGSVHQADLADPAAADALVGAVIARHGRIDVLVNNAGDLVKRTPVT
FT                   EIADEEWHRILDVNLTSVFAMSRRIVPVLRAQGGGAIVNVTSIAGRNGGGGGSVAYATS
FT                   KGAVSTFTRGLAKELAADGIRVNAIAPGIISTPFHDRHTGAEQMRALLGTVPMGRAGTP
FT                   HECVGTILFLASDAMSSYVTGQVIEVNGGQLMP"
FT   sig_peptide     299351..299440
FT                   /locus_tag="Kfla_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.545 at
FT                   residue 30"
FT   gene            complement(300084..301058)
FT                   /locus_tag="Kfla_0296"
FT   CDS_pept        complement(300084..301058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0296"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   sfu:Sfum_2624 methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29420"
FT                   /db_xref="GOA:D2PTA4"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA4"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADB29420.1"
FT                   /translation="MIRRKTGYLGWMELRDGGVGRAAWRLPYVAERVGGAGAARRVAQV
FT                   VGRLEGARRGGVHRVATRISPRLADRNPELVKISPDWAVDAIDVRRHGLRLQLDLRDNL
FT                   QAVLYYAGRYEPTTSRFLTAELRAGDVMLDIGANIGLHTLGVARRLRELSSGRVIAFEP
FT                   AEDSLAKLQEAAERNGLDELIDTVPAALGDRTQEAALHADSRYDVADTGVRSLSADGEV
FT                   VQQVTVVRLDDWARANDLNRLNLVKIDVEGAELDVLRGAAHTLTRLRPRAILVEDKLED
FT                   QRSRLYEVLDELGYRPTGDLLDHNRLFRRDRSLKASTGRHSLR"
FT   gene            complement(301076..301645)
FT                   /locus_tag="Kfla_0297"
FT   CDS_pept        complement(301076..301645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29421"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29421.1"
FT                   /translation="MLLLAGYVLTAPTRREPHRDHAVPDPYLTISACSMDAGIQPELID
FT                   WFTDRAEAERVLDPAGPLDLYAVGLSAHHAADLRAQYNGEADLAFALLDQNRSLPADAE
FT                   VLGHEIIGCEDHFSFHDWHCYDFAVEACAALDLRLNRHGLLDRLSDADRALRWVLARPA
FT                   SEALPPVPWTVVAVARCARPSTPGAV"
FT   gene            complement(301689..302306)
FT                   /locus_tag="Kfla_0298"
FT   CDS_pept        complement(301689..302306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0298"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bac:BamMC406_5804 FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29422"
FT                   /db_xref="GOA:D2PTA6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR023932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA6"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADB29422.1"
FT                   /translation="MTAPGGERTIAVVTAGLTTPSSTRLLADQLAAAVRDTLDGRGIPR
FT                   RVVTIELRDVAHDLTNNLLTGFPSESLREVLETVVKADALIAVTPTFSASYNGLFKMFF
FT                   DVLDDKALVGKPVLLGATGGTERHSLVLEYALRPLFAYLQAVVVPTAVYAASSDWGPHA
FT                   TALRARVERAATELVDLISHEPTKPPIDPFANPTPFEDLLKG"
FT   gene            complement(302303..303442)
FT                   /locus_tag="Kfla_0299"
FT   CDS_pept        complement(302303..303442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0299"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   pfo:Pfl01_0703 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29423"
FT                   /db_xref="GOA:D2PTA7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR023934"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA7"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADB29423.1"
FT                   /translation="MQFGVFTVGDVTEDPTTGTTVSEAERIKAMVTIALKAEEVGLDVF
FT                   ATGEHHNPPFVPSSPTTMLGYIAARTSKLILSTSTTLITTNDPVKIAEDYAMLQHLADG
FT                   RVDLMMGRGNTGPVYPWFGQDIRNGIQLAVENYALLRRLWREDVVDWEGNFRTPLQGFT
FT                   STPRPLDGVPPFVWHGSIRSPEIAEQAAYYGDGFFHNNIFWPASHTQQMIDLYRRRFEH
FT                   YGHGAADQAIVGLGGQVFMRKNSQDAVREFRPYFDNAPVYGHGPSLEDFTRETPLTVGS
FT                   PQEVIERTLTFREKFGDYQRQLFLMDHAGLPLKTVLEQLDLLGEEVVPVLRKEFATLKP
FT                   AHVPDAPTHASLKVAAERAHALESLSAPEPVATGEGAER"
FT   gene            complement(303636..303980)
FT                   /locus_tag="Kfla_0300"
FT   CDS_pept        complement(303636..303980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0300"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: sfu:Sfum_1616 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29424"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA8"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1616"
FT                   /protein_id="ADB29424.1"
FT                   /translation="MEDMRALSYGLGRQYFEEKDYRGAIRALRPVVEETPDDVGTRLLL
FT                   ARAYYHSALLKPAEEHLHEVLTREPTEYYAHLMMARTLERQSRHDEAVKHRRIAAALTG
FT                   NDELLQPHRV"
FT   gene            complement(304057..304926)
FT                   /locus_tag="Kfla_0301"
FT   CDS_pept        complement(304057..304926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0301"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: afw:Anae109_1564
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29425"
FT                   /db_xref="GOA:D2PTA9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTA9"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB29425.1"
FT                   /translation="MVTHKIRRIGDVEVSAIGLGAMPMSIEGRPDEDRSIATIHAALEA
FT                   GITLIDTADAYHLTATDVGHNESLIAQALASYGGDTSNVLVATKGGHLRPGDGSWTLNG
FT                   SPEYLKQAADASLKRLGVDAIGLYQFHRPDPNTPYAESVGAIRDLLDAGKIRLAGISNA
FT                   NPEQIKQASDILGGRLVSVQNQFSPAFRSSEPELELCDELGIAFLPWSPLGGISSASEL
FT                   GEKHPAFHQIASELGVSPQQLTLAWMLAKSEQVIPIPGSSRPETIRDSYAAVELELTPE
FT                   QVAALDAA"
FT   gene            complement(305031..306611)
FT                   /locus_tag="Kfla_0302"
FT   CDS_pept        complement(305031..306611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0302"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: rpd:RPD_4228 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29426"
FT                   /db_xref="GOA:D2PTB0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB0"
FT                   /inference="protein motif:PRIAM:3.1.3.1"
FT                   /protein_id="ADB29426.1"
FT                   /translation="MSLSRRRFLGYGGAGTAAVLLGTGAWDASTTYAAPSGSGNPFTLG
FT                   VASGDPRYDSVVLWTRLALDPFAVDGRGGMPAKPVRVEYEVARDERFRHVVRRSSVLAT
FT                   PELGHSVHPEIHGLQPDHEYYYRFRTGHEVSATGRTRTTPHPFSSPRELRFAFASCNAW
FT                   QDGFFTAYQHLAAEDLDLVVHLGDYLYESGVRTNRRGVVTDPRFHTETFDLARYRLQYS
FT                   LYKSEAPLQAAHAAHPWIHTIDDHEVENNWAGDLSQADTEPDQDPAVFRIRRAQAFQAM
FT                   YENMPLRHDQMPSGPDVRLHRRLPYGRLADITMLDTRQYRSDQPCGDGASATCNDRFDP
FT                   DNTMLGGKQKAWLLDGFRRSNARWQVLGNQAPMGQTDWNPGPETHVWLDPWDGYVAERN
FT                   EVLGAAQDAGVRNLVVITGDRHQNYALELKRDYADPASATVGTEFVGTSITSGGDGSDT
FT                   TDQGNQFLAANPHLKFFNSQRGYVRVSVDRFRWRSDFRVVPYVTTPGAPISTRATYLVE
FT                   DRTPHVHPA"
FT   sig_peptide     complement(306510..306611)
FT                   /locus_tag="Kfla_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.849 at
FT                   residue 34"
FT   gene            306871..307353
FT                   /locus_tag="Kfla_0303"
FT   CDS_pept        306871..307353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0303"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bid:Bind_1728 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29427"
FT                   /db_xref="GOA:D2PTB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29427.1"
FT                   /translation="MPTDERIRRARPDDIPTIVDLVYALADYERAPDACRLTAEQLRTA
FT                   LFGPAPAVFCHVAEHDGEVVGCALWFLNFSTWRGVHGIYLEDLFVRPAHRGSGLGKALL
FT                   TALAQECVQHGYERLEWSVLDWNTPAIDFYQSLGANPQAEWTTFRLTDAALAELGA"
FT   gene            307386..307826
FT                   /locus_tag="Kfla_0304"
FT   CDS_pept        307386..307826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29428"
FT                   /db_xref="GOA:D2PTB2"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29428.1"
FT                   /translation="MLSRVAQAGLWLVVGVGIVAALLDGAGARSWVPAVAVVVIAASGV
FT                   LAVRAYRVGATYGPDGIEVRGYFRTRRIQRNQVTQVTDFPAVRWKDTNGKPRWTPISAF
FT                   SGSSGQLRMIERHNAVCLALLQLWDEERHQKPTRTPRRTRRR"
FT   gene            complement(307858..309300)
FT                   /locus_tag="Kfla_0305"
FT   CDS_pept        complement(307858..309300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0305"
FT                   /product="diguanylate cyclase with PAS/PAC and GAF sensors"
FT                   /note="KEGG: lpf:lpl2061 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; GAF domain
FT                   protein; PAS fold domain protein; SMART: GGDEF domain
FT                   containing protein; GAF domain protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29429"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB29429.1"
FT                   /translation="MQNEPTVRMTAVRRLYEVSARMGAGRSLGETLQAVVDGVVDGLGF
FT                   GIAVLNLRQPDGKFEVIAVAGSPEAKEALLGTVSAADIFDAEFAIADVWGGLRFVPHER
FT                   LPEGEVVGWVPDVPVSADPNAWHPLDALFAPLCSSEGELVGMLSVDLPEDQRRPGPIHR
FT                   ELLEIFATQAGLAIDKARLTDQLLAEKVRLEASETTFRLVFEGAGNGMATIAFDGPEAG
FT                   RVLRVNDAFCRITGYTTDQLVGSALADYLEDEDAGQSRRELDQLTAGQGPYRFERTFRR
FT                   ADGHDIWLGGTAAIVGQGKDQPRILLIQIDDVTARKDAERELQHHAAHDALTGLANRRL
FT                   LQHRFNAVLQRSRQSGRRGVLLFCDLNHFKQVNDKYGHEAGDLALREIGTRLQAAVRQG
FT                   DTVARLGGDEFAVLAEEIDGTDLTALVRRIEDSINRPLTGIDVPVTASLGTAVVSPYTA
FT                   DLEELLRTADHAMYEAKQHSRR"
FT   gene            complement(309496..310254)
FT                   /locus_tag="Kfla_0306"
FT   CDS_pept        complement(309496..310254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0306"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: amc:MADE_00428 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29430"
FT                   /db_xref="GOA:D2PTB4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADB29430.1"
FT                   /translation="MTDRSIPADGIGMHLYTMREALADDYPGTLRRLAEIGYRTVGVSG
FT                   RFGHSAAEIRSYADAAGLRIVLEHVGYQRLTDDWEGALADVHTLGGRWIVVPSLPVELR
FT                   TPDGFREAAAAFNQAGEAARAAGLKLLFHNHGHDFAEVDGQVLFDILLAEVEPDLLGFE
FT                   LDLYWVVDGGKNPVDYFQQYPGRFPALHVKDMAADGSFEDVGMGRLDFPAIFDRADRGG
FT                   VEQWLVEHDAPVDPWASARTSYRSLAQLRF"
FT   gene            complement(310297..311112)
FT                   /locus_tag="Kfla_0307"
FT   CDS_pept        complement(310297..311112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0307"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: ara:Arad_8628 endonuclease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29431"
FT                   /db_xref="GOA:D2PTB5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB5"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADB29431.1"
FT                   /translation="MNRYSLNQATTKYWPLEDVVAASSKAELSWIGLWREPVQEYGVER
FT                   AAKLVADAGLQVSSLCRGGFFTATDEAERQAKLDDNRRAIDEAATLGTEVLVLVSGGLP
FT                   AGSRDLDGARSMVRDGLAELAPYAGERGVRLAIEALHPMFCSDRCVVSSLGGALDLAEQ
FT                   FPAEQVGVIVDAYHLWWDADVYRQIQRAGDRICSYQVSDWVVPLPADTLLGRGLMGDGS
FT                   IELRRLREACDAAGYTGPVEVEIFNQDLWDAPGQHVFDLALARYREHVA"
FT   gene            complement(311109..312326)
FT                   /locus_tag="Kfla_0308"
FT   CDS_pept        complement(311109..312326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0308"
FT                   /product="protein of unknown function DUF993"
FT                   /note="PFAM: protein of unknown function DUF993; KEGG:
FT                   sme:SMc04402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29432"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB6"
FT                   /inference="protein motif:PFAM:PF06187"
FT                   /protein_id="ADB29432.1"
FT                   /translation="MTLALKLPAVGGQRKGGEGTGGGSGPSPAVRGDLVEYRLVGKPVA
FT                   EGTYTPAVSRLAFAAAHVVADPLGDNAPGAPAAIDWEHTLQFRRHLWSLGLSVAEAMDT
FT                   AQRGMGLDWPATQELIRRSAAEAPDGRIAVGVGTDQLPAGEHTLDAVIAAYEEQLAVAE
FT                   QAGAQPILMASRALCAAANSPDDYRKVYDRLLAQSSRPVILHWLGAMFDPALDGYWGSD
FT                   SLDTAADVVVGLIADHTAKVDGIKVSLLDAAKEVALRNRLPEQVRLYTGDDFNYPELIR
FT                   GDGLRHSDALLGIFAAIAPAAAAALKALDDGDLGRYEQVFAPTVPLARQIFSAPTYYYK
FT                   TGIALLAWLNGHQPGFGMVGGLQTGRSLPHLAETFRLADQAGVLTRPDLAVDRFRRLLA
FT                   VHGVDA"
FT   gene            complement(312323..313486)
FT                   /locus_tag="Kfla_0309"
FT   CDS_pept        complement(312323..313486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0309"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   ara:Arad_4620 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29433"
FT                   /db_xref="GOA:D2PTB7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB7"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB29433.1"
FT                   /translation="MNERRVGIVMNGVTGRMGLRQHLERSIVAIREQGGIAAADGSMII
FT                   PEPILVGRNELKLRRIAEQYGLTRWTTDLSEALAEPDVEIYFDSQLTQLREKGVRAAVE
FT                   AGKAIYCEKPIAEGLDAAVDLARLVRDSGLKNGVVQDKLSLPGLRKLKRLVDGGFFGRI
FT                   LSVRGEFGYWVFEGDWQEAQRPAWNYKQAEGGGIVVDMFCHWRYVLDQIFAPVRSVYCQ
FT                   GAVHIPTRWDEQGTEYAATAEDAAYGVFELEGGIIAQLNSSWTTRVFRDELVEFQVDGT
FT                   EGSAVAGLRNCHAQHRSATPKPVWNPDLPVTEKFRDQWSVVPDNEVFDNGFKVQWEMFL
FT                   RHVVDDAPFTWDFVEGAKGVQLAELGLQSWREGRKLEVPALSIEAGS"
FT   gene            complement(313553..314338)
FT                   /locus_tag="Kfla_0310"
FT   CDS_pept        complement(313553..314338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0310"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; Cupin
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29434"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB8"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB29434.1"
FT                   /translation="MCALDGESTATEPAERPSRPDAALPGGIGVSLLTVYDVEAPDGLV
FT                   GGTPHVHLACSEGYYVIAGSGAVHTLNPKGFTETPLQPGTVVWFDPGTIHRLVNGGGLQ
FT                   ILTLMSNSGLPEAGDAVLTLPPEHLTDRETYLAATTLTGEGEARTPSAMRRRDLALEGF
FT                   AALRSAYDAEGPGALDAFYQAAIGIVRPQLPDWRRRWQQGARRLADETGAALDALEAGT
FT                   APHLQSAQLHQLPAPTELGRHGMCGRLDVYDLASGASHT"
FT   gene            314571..316097
FT                   /locus_tag="Kfla_0311"
FT   CDS_pept        314571..316097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0311"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   azc:AZC_1898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29435"
FT                   /db_xref="GOA:D2PTB9"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTB9"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ADB29435.1"
FT                   /translation="MVGGAGPVGNGPGKGVSVERVDESSKVAAGGGPTDEAMVERRQRG
FT                   RRAEDRRVVEEQRARDEQREVYSTLDLALRVGEVLLSSGAGTADTTATILGVTAAGGLR
FT                   GCEVDITFTSIAISYQAAPDVAPETHVRVVRYRGQDFSRLTDVDRLVRRFARGDVTREE
FT                   ASRELARIVSAGPPFPRWTSVLAWGVMAGGATLLLGGGWLITLVAFVTAIVIETNNRWF
FT                   NRQRLPAFYQQVAGAFVATAVALILYAVDAPVKPSLVVAAGIIMLLAGIALTGAVQDAI
FT                   TGYYVTAAARSLEAMLLTGGIIAGVSLGLTLGLKLGLPVAIEAQTIQLANLPVMVGASA
FT                   LMAVAFAYASYAPLRSLLPVGVVGAAGSLAFTLMARAEFGPAWSTAAGAFVVGLGGYSL
FT                   GRRCGVPPLVVVVSGTVPLLPGLTIYKGLFELLSLGNLIGVVSLATAVAIGVALASGVI
FT                   LGEYVAQPIRREARRLEDRLAGPRLVGPRRPVRPRQPRPRRNRRSGRITH"
FT   gene            complement(316108..317634)
FT                   /locus_tag="Kfla_0312"
FT   CDS_pept        complement(316108..317634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0312"
FT                   /product="carbohydrate-binding protein"
FT                   /note="KEGG: mxa:MXAN_4606 carbohydrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29436"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC0"
FT                   /inference="similar to AA sequence:KEGG:MXAN_4606"
FT                   /protein_id="ADB29436.1"
FT                   /translation="MLKRSALVLPLLLGAAVLPANPSTPAQATAVPSPAAKVAKLTGPE
FT                   SINDTERRFALKSTDLGILWDNGAGEILSAFGDSYGSGWTGPGGGVGDPATLDWRCNLL
FT                   LRSKDRHLADGMTFDSAAEDRPGHAGQFLDCKKVDRDEHTVIPTAGIAVGRRQYVQYMS
FT                   VNYWGPAGSWFTNHSGFAYSDDNGETWTKDPNARWTNTAVWNSNFQMTALVRDRGHVYM
FT                   IGTPNGRFGNAYLARVPEHQVLSKRAWRYWDGRTWSPKESAAVPVVAGPVSEVSVQWNA
FT                   HLGKWLMLYLDESRASVVLRSASALTGPWSGERVVAKGTDFPGLYGTYIHPWSSGQDLY
FT                   FTMSQWDPYNVFLMHTKLTDDGRPTNLVTDPGFEEQTGTSPSPPWQLNGRGGIDSADLA
FT                   HTGARNAYLRDSIGAHSLQQTVAVRPHHRYRLSAWVRTAENNRETVLGVRTLRGRTVAE
FT                   KPGGAHPQYTRVSVEFTSGRESLVQLYAGFFGPGQDVWYQLDDVVLEEIR"
FT   sig_peptide     complement(317548..317634)
FT                   /locus_tag="Kfla_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 29"
FT   gene            complement(317739..318977)
FT                   /locus_tag="Kfla_0313"
FT   CDS_pept        complement(317739..318977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0313"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   sfu:Sfum_3732 glycosyl transferase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29437"
FT                   /db_xref="GOA:D2PTC1"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC1"
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /protein_id="ADB29437.1"
FT                   /translation="MVGMGSRGDAQPMALLGAELTARGYDVEVALASDLAWIGTALGLR
FT                   TTDLGFSARDFLDSEQGRTWLAAGDVASYVRWLLAFKQEIAEELQARLVRLTDGADVVV
FT                   SGTATELECAVIAEARGVPYVAVHHVPLRSNSAFPHLLVSTEILSPEQNRQTYLDVDRA
FT                   NWPVFEPLLNAFRGQLGLPPTADNTATRLERADSLELQAYSRFLLPELADWSPRRPLTG
FT                   FITPTESQRAVLSGARGDRDLDAWLAAGDPPVYFGFGSMPVLDPPAALTLIEKVSATLG
FT                   VRALVGLRGATSSNPAVRVVWELDHEAVLPRCRAAVHHGGAGTTAVSLRAGLPTVVCAV
FT                   FADQPFWGALLHRRDLGSTLPFTGLAELPLLAALEPLLTSQARARAAAMSQQLHSENGS
FT                   AQAADAFEHALGE"
FT   gene            319287..320498
FT                   /locus_tag="Kfla_0314"
FT   CDS_pept        319287..320498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0314"
FT                   /product="34-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 34-dihydroxy-2-butanone 4-phosphate synthase;
FT                   Lumazine-binding protein; KEGG: dvm:DvMF_2680
FT                   3,4-dihydroxy-2-butanone 4- phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29438"
FT                   /db_xref="GOA:D2PTC2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC2"
FT                   /inference="protein motif:PFAM:PF00926"
FT                   /protein_id="ADB29438.1"
FT                   /translation="MFTGKIEHTAIVTAVEADALRVQIDPSAPLVEGGAVCLDGVRMTM
FT                   QSVAPGELVATVTDETRRRTTLDRVAAGARLHFELPVAAGDRIDGHLVQGHVEGVGKVL
FT                   RVDDEPAGRRVWIKPADRLLARLVAKSSVAVNGVSLTVAEVLKDRFTVVLVPNTLRRTT
FT                   LGDLAVGDRVNVESDLVTRMAREGHGPELLRAVARLPWTGHLSGEAGVQKVVAQLAAGG
FT                   GVVVWDPALEGEGDVVFAAERFRPEAMTFLLTQVCGHTTIPCAAEVLQRLEVPPMPGGG
FT                   DRQGTAMHVPVDLASSPGTGVSAADRAATIRRLAAPDAVPSDFLRPGHVFPLAARPGLL
FT                   AERKGHTEATVALCVAAGLAPVGVCCEVMRPDGVMAQAAELEQFAMRWELPMIDVDDLV
FT                   RWLS"
FT   gene            320495..321187
FT                   /locus_tag="Kfla_0315"
FT   CDS_pept        320495..321187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0315"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mlo:mll3908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29439"
FT                   /db_xref="GOA:D2PTC3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29439.1"
FT                   /translation="MKGADLYDDPDFLAGYRELRRSGLGLNEVLEIPAVDALLPPVGGL
FT                   RVADLGCGEGSLAVRLAESGAQVVAVDASAAMLANARPHPGVRYIRCDLAELELPADSI
FT                   DLVVSSLALHYVEDFSGLVRRVAAWLVPGGQFVFSVEHPVVTAPVKQADLVVDDYADEG
FT                   QRQRQWFVDGVVKYHRTIGSTLEALLSAGFTVQAVREPQPTAEQVRRSPHLVLHRRRPP
FT                   LLVVSARG"
FT   gene            321483..321890
FT                   /locus_tag="Kfla_0316"
FT   CDS_pept        321483..321890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0316"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; KEGG: avi:Avi_5607 cAMP-dependent
FT                   protein kinase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29440"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC4"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADB29440.1"
FT                   /translation="MALGRTSPRDLPLFADLSGREIKDIFRAGEEVSVPAGWSLILEQT
FT                   PPDAAYLILAGTAAVRVKGEEIAELGPGDIAGEVAVRQNRLRTATVTAKSRLQLLHFTR
FT                   EKFDELTRRLPTFRDAVDATIAERRGPQPDA"
FT   gene            321868..322971
FT                   /locus_tag="Kfla_0317"
FT   CDS_pept        321868..322971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0317"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: met:M446_0921 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29441"
FT                   /db_xref="GOA:D2PTC5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC5"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ADB29441.1"
FT                   /translation="MAPSPTPDPSAGTADGGAAGPAGVFAADARSDAAARDGDSGGRPG
FT                   GAPDLDALAKEFERALLGGERKFTRRQVSERAGISTERAERMWRALGFATVPDDELAFT
FT                   DDDVEALRLVAALEDDNFIDPAIESSLARKLGQTQSRLASWQSAMFLEFLAGAKLPADE
FT                   AIEVAGLLLPAMERLQTYVWRRHLAAAAGRAVAGSDELARGIRCVGFADIVSYTRLTRR
FT                   LSEAGLGELIERFEGMAADVVALNGGRVIKSIGDEVLFVTDTAAQGAAVALALQDEVAA
FT                   TEGLPELRIGLAYGSILIRLGDVYGETVNLAARLTSECKPGRVLADRELAAALDGHSAY
FT                   RLRRLRRVSVRGYHHLTPYALQRAAER"
FT   gene            323014..323736
FT                   /locus_tag="Kfla_0318"
FT   CDS_pept        323014..323736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0318"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pzu:PHZ_c1781 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29442"
FT                   /db_xref="GOA:D2PTC6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29442.1"
FT                   /translation="MRELLTPAELVEAAEGDLIPVWAGQGRLGADVRAWYAEGAVAVAA
FT                   PDLSRRDRLAVAGPVDALAPLVEQVLEIVGPGFRPFGEEPLIRGLTERVPGLSFRAAFG
FT                   WMETDAAPAETTTARWLPDDRGVAELLDEASPTSYAWPGSTGVRRWAAIADDRDALVSV
FT                   AADAWSAPEVGFLAGVATRPVARGRGLSRQVCAFVTAELVKQHGRAALMVDAENAAAIA
FT                   VYQRLGYRYRPVAAAHHA"
FT   gene            complement(323743..325080)
FT                   /locus_tag="Kfla_0319"
FT   CDS_pept        complement(323743..325080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29443"
FT                   /db_xref="GOA:D2PTC7"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29443.1"
FT                   /translation="MNSTLTGAIAIYLAQVRAELSDLPPGELEDVLEDVAGHLTEVAAE
FT                   FQQEPTADELRERLGSPREYAGELRAAAGYPPPGRPKKPTSTAADRALHWGIVAGTVGP
FT                   FFVLIGLLTGASDGLAFFGAIGLIVLFGAAYIGLRALGANPPRSVLDTPRGARAAEYLR
FT                   GVIDQIPPNVRHELVAVGQPVWWVARGMAGGGGFFALFGAGAVAVVGALAGAGVSIWVG
FT                   RRTQQDRRWLWYVVPLNVVAALAVPAVFAAAFTGQSNGLFSFSGYDDGSSSSSYAPTGL
FT                   TLDGESISNIYPFDEQGRPVSVRLYAQDGKPLNLPLADCVALYGEGGAGTWESTEAVSN
FT                   LFPQPVIDHTLSTESPGWEECRDTTRAPFVPPPAPATPIRPLRTPSAGPGATTTPSTTP
FT                   STTPSTTPSGPSQTPPGPSVPPSATPSGKPTTPATPGVTLTVAPTR"
FT   gene            complement(325077..325409)
FT                   /locus_tag="Kfla_0320"
FT   CDS_pept        complement(325077..325409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0320"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cvi:CV_3776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29444"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC8"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADB29444.1"
FT                   /translation="MDPSQLLKGVLDLAVLAVLRDGDGYGYDVLRRLRAAGLEDVADAS
FT                   VYGTLRRLFAAGALTSYVQPSEEGPHRKYYGLNQTGHNLLAESTKTWNHFAGTMAGLLA
FT                   QKEEAA"
FT   gene            325589..326518
FT                   /locus_tag="Kfla_0321"
FT   CDS_pept        325589..326518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0321"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: dal:Dalk_4205 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29445"
FT                   /db_xref="GOA:D2PTC9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTC9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADB29445.1"
FT                   /translation="MTDVYAEFVAAVAESLDGSGTTDDPATGVTLARRAHLSRFHFDRV
FT                   ISAAAGESPAAFRRRLLLERAAYRLLAEQVGVLEIAVDAGYSSHEAFTRAFTRAYGMSP
FT                   RTWRREPSRVFFLAAPSGVHFQPPAGLRLPARKEVKGMDVLVRMVEHHVWLTGELIDRG
FT                   SRLDAAALDRPIELSIEGIDDDVTIRYLLDRLVWQQEMWLASVEDRPFQVPECGREVRT
FT                   PIPDLRSRHAVAGERFVALINQLNEQGRFDESFVDTTCEPPRVFTYGGMVAHVLTFAAH
FT                   RRSLLVGAFHSAGVRDLGFGDPMQFVAG"
FT   gene            complement(326677..328635)
FT                   /locus_tag="Kfla_0322"
FT   CDS_pept        complement(326677..328635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0322"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   domain protein; KEGG: bpm:BURPS1710b_A1100
FT                   x-prolyl-dipeptidyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29446"
FT                   /db_xref="GOA:D2PTD0"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD0"
FT                   /inference="protein motif:PRIAM:3.4.14.11"
FT                   /protein_id="ADB29446.1"
FT                   /translation="MTTVRSRVTVLVSSAVLCLGTATTATAAPVPDSPGAPPAEASAAA
FT                   LAPSLTGGLPPHVDPRTKSTRPVYDYAGAIRESVFVDTRMDTDSDGTDDVIAVDIVRPR
FT                   ETEATGVRVPVIMDASPYFGCCGRGNEGERKTYDAAGVVQKMPLYYDNYFVPRGYAVVG
FT                   VDILGTNRSTGCGDVGGRDEVDSVVAVIDWLNGRNTARTRDGRPVEAGWTTGAVGMIGK
FT                   SYDGTLANAVAATGVRGLKTIVPISAISSWYDYTRSGGVPYSVDYLPWLGEYVGHDTPA
FT                   CNEVRADLAERDDDETGDYTAFWAERDYVKDAAKVKASVFVAHGLSDYNVQSNHFAQWW
FT                   DALAENGVPRKIWLGLEDHVDPFEFRRDAWVDELHQWFDYWLQDLRNTVMREPQASVEV
FT                   APDVWRDYATWPAVAKTVGVPLAEGKLGAYGKGTVTVTDDPSLTEDAIVSTPSEVIAGR
FT                   QMFLSAPLPASIRVSGTPSVTLRVKTDSSTTPVTARLVEYGKAQRYAGVRRTSTSTCEG
FT                   ASTEYDDSCYFTVEKYTKETDHGIVSRGWVDAAHSNSLSRPKPLPPGKWTTVTVPLRAQ
FT                   DEVIPKGRVLGLAVTLSDTEWTTPNDTGATIDIDLAHSKLNLPVTAGKVPAPAKTQPLN
FT                   VDITTPTERPDLHDPLG"
FT   sig_peptide     complement(328552..328635)
FT                   /locus_tag="Kfla_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            328777..329790
FT                   /locus_tag="Kfla_0323"
FT   CDS_pept        328777..329790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0323"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: spe:Spro_1562 DNA-binding
FT                   transcriptional regulator GalS"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29447"
FT                   /db_xref="GOA:D2PTD1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADB29447.1"
FT                   /translation="MNLRAPVTLLDVAQRAGVSVATASRVLNGGDRVPRPELQERVRAA
FT                   AAELGYTPNAQAQALAKSSTNVVGILVHDIEDPYFAAIANGVMRAADERHLLVMMASTF
FT                   RDADREIAYLSSLRAQRARAAVMIGSRRTDAEQLARTATEIEAFLGSGAGLALVSQAGM
FT                   PAHTIEPDNRAGAAELARALVGQGLRKFGILAGPDALATARDRRDGFVAGLAETGLEPV
FT                   AVRAGEFTRDGGHAAALELLDNKLDLDCLFAVNDVMAVGAMSALRERGVDVPGQLSVAG
FT                   FDDIATLRDVWPGLTTVRLPLEQMGRRALELAIEGGEPRTETFPAEVVLRESTPQR"
FT   gene            329805..330719
FT                   /locus_tag="Kfla_0324"
FT   CDS_pept        329805..330719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0324"
FT                   /product="naphthoate synthase"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: scl:sce5310 naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29448"
FT                   /db_xref="GOA:D2PTD2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD2"
FT                   /inference="protein motif:TFAM:TIGR01929"
FT                   /protein_id="ADB29448.1"
FT                   /translation="MTEPAHVSDLFDPSAWKAVDGFDLTDITYHRAVDAGVVRIAFNRP
FT                   EVRNAFRPQTVDELYRVLDHARMSTDVGCVLLTGNGPSPRDGGWAFCSGGDQRIRGKDG
FT                   YKYAEGATADTIDPAKAGRLHILEVQRLIRFMPKVVVCVVPGWAAGGGHSLHVVADLTL
FT                   ASAEHARFKQTDADVASFDGGFGSAYLARQVGQKFAREIFFLGDEYSAEDACRMGMVNK
FT                   VVPHAELEQVALDWGRRICAKSPTAQRMLKYAFNLIDDGLVGQQLFAGEATRLAYGTDE
FT                   AAEGRDSFLEKRPADWSPYPYAF"
FT   gene            complement(330743..331384)
FT                   /locus_tag="Kfla_0325"
FT   CDS_pept        complement(330743..331384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0325"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="KEGG: mch:Mchl_1827 uracil
FT                   phosphoribosyltransferase; TIGRFAM: uracil
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29449"
FT                   /db_xref="GOA:D2PTD3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD3"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADB29449.1"
FT                   /translation="MQILVVDHPLVAHKLTALRDERTDSPTFRRLTEELVTLLAYEATR
FT                   DVRTGPITVRTPVAEAEGIKLTSPKPLVVPILRAGLGMLEGMTRLLPTAEVGFLGMIRN
FT                   EETLSASTYAERLPEDLSGRQCYVLDPMLATGGTLAAAIQFLVDRGADHITAICLLAAP
FT                   EGVERIERELVDLQIPCNLVIAGMDSHLNEKGYIVPGLGDAGDRLYGVAQ"
FT   gene            331547..331717
FT                   /locus_tag="Kfla_0326"
FT   CDS_pept        331547..331717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29450"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29450.1"
FT                   /translation="MTENTGKSPQQLERLRRRAAFLRELEEAKALRDRIAPRRARVRRI
FT                   RAAMRRATYHH"
FT   gene            331885..332361
FT                   /locus_tag="Kfla_0327"
FT   CDS_pept        331885..332361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29451"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29451.1"
FT                   /translation="MTTTELDFALAAYREDGVWTVTPLPLRGEPDLSSVVSALRRYPGD
FT                   AGVIGMISVDEDFFIVLRVVGGRARLLLSDVTAATEWPLAKQVIDELDIPLAEDDDEQV
FT                   PAGDLAIVADLGMSAMDLGALIDDVDLYPEEMLEEIADALGFGTEFHEAIEAVG"
FT   gene            332390..332824
FT                   /locus_tag="Kfla_0328"
FT   CDS_pept        332390..332824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0328"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   scl:sce2586 putative zinc-binding hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29452"
FT                   /db_xref="GOA:D2PTD6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADB29452.1"
FT                   /translation="MELALAEAEHARGSADVPIGAVVVDAGGEVIGRGHNEREATGDPT
FT                   AHAEVLAIRAAARHVGEWRLTGCTLVVTLEPCTMCAGAIVLSRLDRLVFAAYDEKAGAV
FT                   GSLWDVVRDRRLNHRPEVVGGVLADEAGARLRDFFIGHRS"
FT   gene            332838..332928
FT                   /locus_tag="Kfla_R0007"
FT                   /note="tRNA-Ser3"
FT   tRNA            332838..332928
FT                   /locus_tag="Kfla_R0007"
FT                   /product="tRNA-Ser"
FT   gene            333122..334630
FT                   /locus_tag="Kfla_0329"
FT   CDS_pept        333122..334630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0329"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-C domain
FT                   protein; KEGG: afw:Anae109_0927 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29453"
FT                   /db_xref="GOA:D2PTD7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD7"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADB29453.1"
FT                   /translation="MDVHELDRILLAGAAVLLVAIVAVRLSGRLGLPSLLIYLGMGLVL
FT                   GESAIGIQFEDAQLAHALGFAALVIILTEGGLTTRWNEVRPVMPLGVVLATLGVTVSVG
FT                   VVACVAHYVLGLDWQLAVLLGAVTSPTDAAAVFSVLRRVPIRPRLRGALEAESGLNDAP
FT                   TVLLVTLVSTGAIVEDGLLHFIGLVVYELVVGALFGFVIGWVSVGLLRRVALGSAGLYP
FT                   LAIVSLAFVSYAGGTVLLHVSGFAAVYVTSLILGRAELPHRIATKSFVDGIAWLAQIGL
FT                   FVMLGLLASPGRIGLDDVGVALVIGIAVTVVGRFAAVALSATPFRMPWNEQTFIAWAGL
FT                   RGAVPIVLATIPLSEHVPQADRVFDVVFVLVLLFTLLQGPSLPWLARRLKVLDDNAAHE
FT                   VDIDVAPLETLGADMLQVQIPSESRLAGVEIGELRLPRGVSVSLIIRSQDSFVPERRTV
FT                   LRAGDAMLVVAPSPLRDQTIRRLRAVSRAGRLAGWFGERGREQV"
FT   gene            complement(334819..335382)
FT                   /locus_tag="Kfla_0330"
FT   CDS_pept        complement(334819..335382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29454"
FT                   /db_xref="GOA:D2PTD8"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29454.1"
FT                   /translation="MTAIHPQPRPHSRFHWRTPITLVVLLAILVGGFWWGWNSLTNSSA
FT                   EQTCVEQKLPNNRMVPKQVVVNVYNGGARAGTAKQIAAELRKRGFNVGKVANEPKGDKV
FT                   DVVEIRGTAPDAPEFKLIAGQLNQKAHPAPDNRPDHTVDVVLGIGFTKLNTKGLPSVAV
FT                   PPNSIHCLPSIRPTQAIPSGQNPN"
FT   sig_peptide     complement(335245..335382)
FT                   /locus_tag="Kfla_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.276 at
FT                   residue 46"
FT   gene            complement(335408..335701)
FT                   /locus_tag="Kfla_0331"
FT   CDS_pept        complement(335408..335701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29455"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29455.1"
FT                   /translation="MIFKRVGEERPYPDHGYKAKDWSVLPPRQIRLDELVTTKGTLDLN
FT                   ALLDEDSTFYGDLFAHVVEYKGELYLEDGLHRALRAALQQRLVLHARVLVVD"
FT   gene            335832..336533
FT                   /locus_tag="Kfla_0332"
FT   CDS_pept        335832..336533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0332"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding domain 1 protein; KEGG: cak:Caul_0871
FT                   lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29456"
FT                   /db_xref="GOA:D2PTE0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE0"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADB29456.1"
FT                   /translation="MKVLTKLVAGAATVVVAVAGTTLPAEALTISQNKAAQARLNKLGC
FT                   NSGPVDGKVGQMTKAATIRFQAANKMTQNGSLAGTTYSRLLAASAKRCDVRAVPASGGG
FT                   KRIVISQSQNYLWLIDAAGKVVRQGGMIDNPAYLRPGTYTTGSKCGRPARVKRNTDGGS
FT                   LYLNNFVRFAPCGIGFHQIPTYKSSGAQIHADWLLGTNLKASHGCIRVQKAMSDTIWAF
FT                   TTSTTKVVVVR"
FT   sig_peptide     335832..335915
FT                   /locus_tag="Kfla_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.833 at
FT                   residue 28"
FT   gene            336636..338168
FT                   /locus_tag="Kfla_0333"
FT   CDS_pept        336636..338168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0333"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; SMART: AAA ATPase; KEGG: pzu:PHZ_c3496
FT                   conserved predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29457"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE1"
FT                   /inference="protein motif:PFAM:PF05872"
FT                   /protein_id="ADB29457.1"
FT                   /translation="MAETPDVVETVKQGYAFEGAAIELGALLVDGTPDPSAAVRIPLSM
FT                   VNRHGLVAGATGTGKTKTLQLMAEQLSAAGVAVFAADIKGDLSGISQPGEGSEKLLSRT
FT                   KTIGQDWVGTGFPTEFYALGGQGSGVPVRATITSFGPVLLSKVLGLNDVQESSLGLIFH
FT                   YADKRGLTLLDLKDLRAVITHLTSDEGKGDLKELGGLSAATAGVILRSLIGFADQGAEA
FT                   FFGEPEFDTADLLQQRDGKGVISLLELPNLQDRPALFSTFLMWLLADLFHDLPEVGDVD
FT                   KPKLVFFFDEAHLLFDDASKAFLDSIAQTVRLIRSKGVGVFFVTQTPKDVPDDVLAQLG
FT                   SRVQHQLRAHTPNDAKALKATVSTFPNSSYELAEVLTQLGIGEAIVTVMNEKGAPTPVA
FT                   WTRLRAPQSLMAPASAEQLAATVAASPNTAKYTEVVDRESAYEKLAAKVQAGAAQAEAE
FT                   AQPQRSEPTPRAPKQDKSMVEKVIGSSAFKQFARSAGREIVRGLFGAARRKR"
FT   gene            338415..339815
FT                   /locus_tag="Kfla_0334"
FT   CDS_pept        338415..339815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0334"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: bbr:BB3576 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29458"
FT                   /db_xref="GOA:D2PTE2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB29458.1"
FT                   /translation="MVAQSRRAVWNWALWTLTVPAFGLVVLVDLLAIGYGVRAFAELPS
FT                   WRGLDLVFALTVSALVAVEGARRVENRRNRGGALHKDLAPAWMIAAALVLHPALAILVA
FT                   VLLRIWWRIRAGKCIPYRWAFSTAVHVLGVGAAHAVFTGAREMTGDASFGLVAAMAAAA
FT                   FAYVATETLLCGLAISLIVPGSGRRDTIGGKDDLWVDATAATFGCLLAAAALVSPWFAF
FT                   LAVPISLTAQRALLLGQLESEVQTDPKTKLGRVDWWRQRTEEMLRTARTQREPMAVLLI
FT                   DIDHFKQVNDRHGHLVGDEALRAVATILRSAIRAKDVIGRFGGEEFVIALPDTDGTDAA
FT                   VTADRLRSAVAASPLAAMCAGVLDDPELDPDTFHLTVSVGVAVYPSDGHTVDELLRRAD
FT                   RAMYAAKAAGRDRVRLAADAAPTGLAHLTLPPAPAMPAVPPLRPAIPADPVGQLSSVER
FT                   VGPTVRPR"
FT   gene            339888..340433
FT                   /locus_tag="Kfla_0335"
FT   CDS_pept        339888..340433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0335"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: hha:Hhal_0437 fis
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29459"
FT                   /db_xref="GOA:D2PTE3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE3"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADB29459.1"
FT                   /translation="MGRSERRDEDFTAFVLARSARLVHIARMLCGDPELAEDLVQTALE
FT                   KAYLRWDRIELGDPFSYVRQAVVNQHISWARRRLWRERPSGHAAELDQHLEQRLGGGAP
FT                   DQAANVDRRLAIAAALATLTARERAVVVLRYVEDLSEAQTASILGVAVGTVKSAASRAL
FT                   QKLRAAPHLSGSYVGERT"
FT   gene            340430..341140
FT                   /locus_tag="Kfla_0336"
FT   CDS_pept        340430..341140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29460"
FT                   /db_xref="GOA:D2PTE4"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29460.1"
FT                   /translation="MNDDELITLLRSAPEPAGPLDPSKVIAGAYRRRRLRVAAGGVVAC
FT                   AAVVAVAATGVVLGGGPARELPIAPPVASTPSPVLTPSARYTFRNTERPIATVPVTGEA
FT                   PIAGHLFFATRGTRWAVISRAPGASPYEPFGWRKTVGNPNLADARQPGVQSVGAVQTSV
FT                   FRGERVSTVVYTRGSEAWYGQVNRLAGIPGWIAVWADLKAASQAPGERVSVFAYSADGT
FT                   LLARYGDAPEPLLR"
FT   gene            341209..341877
FT                   /locus_tag="Kfla_0337"
FT   CDS_pept        341209..341877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dia:Dtpsy_1322 P-type conjugative transfer
FT                   protein TrbL"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29461"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29461.1"
FT                   /translation="MRRRSNRIQLLTTGVAAAAVAGVAIAATAFTGGTGGTAAADTQVA
FT                   AAGSAAAVAAAPSKKESKATKYTFQNKRPAVGTLAPGQQVKLGHHLSFTTRGTRWAVIS
FT                   RVPGEPQYEPFGWRRTVGNTNLGDGRALGLQSVGPVHSSVFRNERVSTVVYTLGGKAWY
FT                   AKVYRLAGIPGWVQSSVVMSGAKQPRPDAKGPGVSVFAYDAGGRLLGRFGNAVGDPLNG
FT                   "
FT   sig_peptide     341209..341331
FT                   /locus_tag="Kfla_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.405 at
FT                   residue 41"
FT   gene            complement(341930..343147)
FT                   /locus_tag="Kfla_0338"
FT   CDS_pept        complement(341930..343147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0338"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_2571 LasA protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29462"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29462.1"
FT                   /translation="MRITRRSAAALCVAAALAAVPLTATVLPSTAAGTDPVTVAARPAE
FT                   GSTNVRADGRRIVLGDAAATTGSAEIRQRSGIANLDPVRFPAPTSAVVVDYTTGTPDRS
FT                   TAEVDVRALVKDRWSEWTPAKAGTPTALPGASDLVQLRIIVSAPPQGGSPWVSDVRVQP
FT                   TDQASPSAMTIQAAPLKSRVFATREGLVGGTTANGHVIVNRDHFVALPSRRGLANNGSG
FT                   NYSVKVCTTAGTIRCAFEPVWDVGPWNTKDDYWNPSSIREMWKDLPQGRPQAQAAYQTG
FT                   YNGGKDQFGRTVANPAGIDLADGTFWDALALSNNAWVDVTYLWTGDGGRGTVSISSGYL
FT                   NVRSTPSSTGAIVGMAGKAAQVPVECQTTGQSVSGSQGTSNVWLRVHTGMYVAKAWISA
FT                   GTFGAC"
FT   sig_peptide     complement(343052..343147)
FT                   /locus_tag="Kfla_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.662 at
FT                   residue 32"
FT   gene            343334..343852
FT                   /locus_tag="Kfla_0339"
FT   CDS_pept        343334..343852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0339"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: mch:Mchl_5735 RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29463"
FT                   /db_xref="GOA:D2PTE7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE7"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADB29463.1"
FT                   /translation="MSRAGDADFERFVRAQSTPLLRFAEMLCGDRHTAEDLVQQALMRS
FT                   YPKWHRLDGDRLRYVRRVLVNRFLSQARRRWSNEVPSDPVDNGWDDRAVADFAAEVQTR
FT                   EAVLAALAGLTVRERAVVALRYSQDLSEAETADLLGMAPGTVKSTASRALAKLRLAPDL
FT                   IETPVGGTR"
FT   gene            343849..344583
FT                   /locus_tag="Kfla_0340"
FT   CDS_pept        343849..344583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29464"
FT                   /db_xref="GOA:D2PTE8"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29464.1"
FT                   /translation="MSDEQRVRSALEYDLDPWQPDPADLMRRGRRFAWIRRGLAAVGVA
FT                   GLAGTVATVSAAVGGPTEVRNLLAGGGKPSVPVALPTGTPTPIPSVDRTCRPQVPTVTA
FT                   EVSASVKVPAELPKGKPSLPTANPTAAPLPGKPTRLPVPTAKPSVPTAKPPVPPCVTEH
FT                   VPTLPPATVPTTKPSAPGKPSVPKPTLPGKPTLPPLPTAKPTLPGKPTLPPLPTAKPTL
FT                   PTALPSLPSLPTQRPTVLPTHR"
FT   gene            complement(344677..345198)
FT                   /locus_tag="Kfla_0341"
FT   CDS_pept        complement(344677..345198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0341"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: protein of unknown function DUF664"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29465"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D2PTE9"
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /protein_id="ADB29465.1"
FT                   /translation="MPPDQRLGDAVELHLAWLDFYRETVERKLTGLSEEELRSSRLPSG
FT                   WTPLELLKHLVFVERRWLRWGFLAEDVDEPWGDNGPDGRWGLDGDDTLPNLLAELRSGG
FT                   ERTRKIVSGVDGDGSGEVLATVAAEGGRFGADDVKPTLGWILFHVLQEYARHTGQLDVV
FT                   RELADGVTGE"
FT   gene            complement(345199..345987)
FT                   /locus_tag="Kfla_0342"
FT   CDS_pept        complement(345199..345987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0342"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: pmy:Pmen_4350 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29466"
FT                   /db_xref="GOA:D2PUE8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUE8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB29466.1"
FT                   /translation="MIAEETFQRPVGELLRSWRERRRLSQLDLANQVEVSTRHVSFVET
FT                   GRSKPSREMVLRLAEHLDVPLRDRNQLLLAGGYAPVYSEASLHSPVMLAIRETLRRLLK
FT                   AHEPFPALVVDRWWNVVEANAGIALFTEDVAPELLAAPINALRLTLHPDGLAPRISNLA
FT                   EVRVSVLSSLQRQVTGTADPDLQDLYDELRGYGADGERAELPVTAEVVVPMKLRRGDRE
FT                   LSLLTTIATFGTPLDVTVSELMIEQFFPADEATADYLKEL"
FT   gene            346106..346528
FT                   /locus_tag="Kfla_0343"
FT   CDS_pept        346106..346528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29467"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUE9"
FT                   /inference="similar to AA sequence:KEGG:Reut_A2665"
FT                   /protein_id="ADB29467.1"
FT                   /translation="MSTDSTPATTAHDPAATGAEGNAAALADRYFALWNETDSDRRATA
FT                   ITTTWASDGAFVDPSFEATGHQELNALIAGAQQLFPGHRFTRTGEIDHHHNHLRWTWEL
FT                   AAEGRAPIAGGTDIVTLTPAGQIQQVIGFLDFAPAH"
FT   gene            complement(346663..347565)
FT                   /locus_tag="Kfla_0344"
FT   CDS_pept        complement(346663..347565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0344"
FT                   /product="aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /note="PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; KEGG: bvi:Bcep1808_3633
FT                   aminoglycoside/hydroxyurea antibiotic resistance kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29468"
FT                   /db_xref="GOA:D2PUF0"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF0"
FT                   /inference="protein motif:PFAM:PF04655"
FT                   /protein_id="ADB29468.1"
FT                   /translation="MIELPESFLAMPRWWKEGGEWLAGLPGAVEEQCARWGLRITGEVA
FT                   HGSNAVVVPVVRDGVELALRMSPPGDEVAAQVRALRWWNGRGTVRLYDADAGRGAMLLE
FT                   RLGESLAERPVGESMQVLGRLMRRLAVPAPADALSTADIVATRSAELERDWQALGRPFD
FT                   ESYLIAALRVAGSLAVTDSQASVDGDLHADQVLRDIQPLDAVPGRRREPWLVVDPVLLR
FT                   GDVEFDLARILWTRLDEMGDDAEILQHFATAVGAAGLDRRRARDWIVFRTVDYWLWGLT
FT                   AGLTEDPVRCHRLLDAFLP"
FT   gene            347710..348492
FT                   /locus_tag="Kfla_0345"
FT   CDS_pept        347710..348492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0345"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   pla:Plav_2291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29469"
FT                   /db_xref="GOA:D2PUF1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29469.1"
FT                   /translation="MSSLRFDPEVSRHIETVYTTPDVVEQRRVVRIALALRPGDRVLDV
FT                   GVGPGLLAAEMAAEVGPDGRVCGVDVSDSMLAIAATRAKVPGGPEVELHAASVDRLPYG
FT                   SGDFDVVVSTQVFEYVDDVAGALAEVRRVLRPAGRVVLLDTDWDSIVWRSSDDARMRRV
FT                   LTAFEEHLQDPHLPRTLGDALAKAGFTRTHLQVIPLLNAGFDYRTYSAGLIDIVSAFVP
FT                   GRAGVTEAEAQAWADDLRSQGDSYFFSLNRYLFVASAL"
FT   gene            complement(348481..348969)
FT                   /locus_tag="Kfla_0346"
FT   CDS_pept        complement(348481..348969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29470"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29470.1"
FT                   /translation="MSPQVYRAPLRSRRDEVPAGLAVDRALSEGVCGFGGALIPPPPDL
FT                   DAAVEGLTSTYDERAGRSLRRFADVPDGAFVWTREPDGLYHLGRLTGPWRYDDSPAAAA
FT                   ADLVHVRPCEWLERAFAETDVPAGTAYTFSRGGRNFQRIRDPQVEDATAALWGFPSEG"
FT   gene            349310..349441
FT                   /locus_tag="Kfla_0347"
FT   CDS_pept        349310..349441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29471"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29471.1"
FT                   /translation="MADVSEGLVGDELTEDELDELEALGAAEDADRILAAVRGEVDA"
FT   gene            349434..350198
FT                   /locus_tag="Kfla_0348"
FT   CDS_pept        349434..350198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29472"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29472.1"
FT                   /translation="MPEARITWRGKQLNRRTVAMLQAAEKLAGRQFRIVQGSYNKGGVA
FT                   ASAGTHDGGGAVDLDATGLTAAQRKAVVLAMRQVGFAAWLRTPAQGNWPYHVHAIAVGD
FT                   KDLSRGAAHQVAEYRRCKNGLADRGRDDGPPGYYGMTWEIHLKHHPVTGPVAQPPPNTS
FT                   ISLGAMAYARAHDSMSGVWGADRAQVLAWAAHPKVAAIGRHEVRPPAGVPWRVHFQQMT
FT                   RKIQRRFGLPVTGVFDAGTASVMRRYGYTIIA"
FT   gene            complement(350392..350703)
FT                   /locus_tag="Kfla_0349"
FT   CDS_pept        complement(350392..350703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29473"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29473.1"
FT                   /translation="MTTRPTLLGYVRADALSCAEELAAATDSLVAFASAEGFTLGTVYT
FT                   ERDAAESAAFHALLDEVKRSDVRAVVVPTLQHLGAVGSRGAMQHLEFHQAQVWPAGAR"
FT   gene            complement(350700..350888)
FT                   /locus_tag="Kfla_0350"
FT   CDS_pept        complement(350700..350888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29474"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29474.1"
FT                   /translation="MTESLEIPAEQRRVRVWFGAHPIADHTATPDQAAQYEEAMRRRFA
FT                   SLRVTNEPALVTSGPVR"
FT   gene            complement(351355..352752)
FT                   /locus_tag="Kfla_0351"
FT   CDS_pept        complement(351355..352752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0351"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ara:Arad_0712 transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29475"
FT                   /db_xref="GOA:D2PUF7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29475.1"
FT                   /translation="MSTTNAPDRLTGRAWAVLLVLCGAIFLEGIDISMMGVALPSIRAE
FT                   LGLTTSELQWVVSAYVLGYGGFVLLGGRAADLLGRRRMFVGWLTVFLVFSGLGGLATEG
FT                   WMLIVARFITGVAAGFMTPAGLSIITTSYPEGRQRTKALLVYAGIAAAGFSLGMVVGGL
FT                   LTSIDWRWVFFAPVVLAAVLLPAALVLLPREDSTSAEDAPRTARRFDVPGALILTAAML
FT                   LLVATVVRAPDVPKGQTLITLAGGLLLLTAFVQVERRSPAPLIRLGILRNAPLVRANLG
FT                   AILLVGSFVGFQFIAVLYLQELRHWSELETGLALMVLGIDAVLAPTLTPWLVNRFGVGR
FT                   VILGGFAVAVAAYALFLPLGADRTYLAMLPTFLLLGLAFALAYGPLTIAATNGVAEEEQ
FT                   GLASGVLTTSFQFGSALGLAAVAAVLAAFDELTHTGLRTALLVPLVAAVLGLLAGAPEL
FT                   ARRTARV"
FT   gene            352822..353241
FT                   /locus_tag="Kfla_0352"
FT   CDS_pept        352822..353241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0352"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   ara:Arad_0713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29476"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF8"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADB29476.1"
FT                   /translation="MEEGTSKEPSHSCCTEDAFQWDTREDCDVRQILDRIGDKWSLLVI
FT                   ALLDNRTMRFTELKKTIDGISQRMLTVTLRQLERDGLVRRTVHPVVPPRVDYELTPLGV
FT                   TLHDTIQSLVSWTEIHQSEIAAARAHYDARDSVSS"
FT   gene            complement(353263..354372)
FT                   /locus_tag="Kfla_0353"
FT   CDS_pept        complement(353263..354372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0353"
FT                   /product="Ankyrin"
FT                   /note="SMART: Ankyrin; KEGG: sml:Smlt2895 putative ankyrin
FT                   repeat- containing exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29477"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUF9"
FT                   /inference="protein motif:SMART:SM00248"
FT                   /protein_id="ADB29477.1"
FT                   /translation="MPTTDSLDRQLIAAAWKNDVATARRLIAAGADVNAVDDTVQSAFL
FT                   IAASEGYLDLLELTLQHGADVRRLDSYRGTALIRAAERGHAAVVAQLLRAGTAVDHVNR
FT                   LGWTALHEAVLLGDGSPRYVDTVRLLVAAGADRHRPAERDGTTPLQGARTRGQTAAVAV
FT                   LSTAPPSRTEAAAALLTAAEAGDANRVAAALAAKAPLEHKDGQGRTALLLASLHDRVDV
FT                   ARLLVGLGADPDAQDERQDSAWLVTGVTGSVAMLETLLPAKPDLKLRNRFGGVSVIPAS
FT                   ERGHVDYVRRVVRTGIDVNHVNDLGWTALLEAVILGQGTERWQQIVRILLAAGADPSLP
FT                   DRDGVTPLRHATTRGHDQLAAILRAAGAR"
FT   gene            complement(354531..355499)
FT                   /locus_tag="Kfla_0354"
FT   CDS_pept        complement(354531..355499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0354"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: aav:Aave_4523 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29478"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG0"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADB29478.1"
FT                   /translation="MSVRSLSATLALSAVLLGAGMPTASARPASYELPGDPVVSGAGGS
FT                   KYEGIGYDARTQRFYVSETTGGEIHRGSLRSPAAAEWLAGDGTDGRWTARGITVDAHGR
FT                   VYVAGGPNGIDHPGAPDLWVYDRSGRLLAALRTGVPNAFLNDVVIGPDGAAYFTNSNAA
FT                   QVFRVAERDGRWAVRTWADASGTIPTQAGFNLGGIVVSADRRALVVAQGNVGKLWRFDL
FT                   RTGAVSAVGTGGADLVNADGLVRQGDLLWVVRNFSRTLTTLRLSADGRTATLVAATPTD
FT                   PDRVFTTAKLAQGRLLLVDSKFDEPVGLPPYQVVALTPPGR"
FT   sig_peptide     complement(355419..355499)
FT                   /locus_tag="Kfla_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 27"
FT   gene            355656..356897
FT                   /locus_tag="Kfla_0355"
FT   CDS_pept        355656..356897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0355"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: reu:Reut_A3418 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29479"
FT                   /db_xref="GOA:D2PUG1"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG1"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADB29479.1"
FT                   /translation="MIRSVGPRAYHRLQMTTSRSRPTAPTWAAGILGRANGLVTLLHAT
FT                   LVVLVAASAVRYLSGHGFGDRAPWVLAGAATLLATYAAHRVLPSQVWLALLIAVWFGLV
FT                   LLAPSFAWCAVPLSFVALRVLPFRPACAVVAGMVVTTVVTWTRMSDRLDPTIVLGPVCV
FT                   AVLAVGAYRALERDALARQALLDDLHAAQGDLADAQHRAGVLAERTRLSREIHDSVAQG
FT                   LSSINLLLQAADREWDSRPAAAREHAAQAAATARDGLDEVRRVVRDLAPAELASGPGDP
FT                   ALPAVLRQTCERLAAHSAVEIRVQVHGTPVRLDPEIETALLRTARGALANVLEHAAATT
FT                   AVVTLTYQPDAVALDVRDDGRGLPERPPPADPDRGRGLAGIRSRLRELGGTLVLESEPG
FT                   EGTALAASVPLERS"
FT   gene            356894..357526
FT                   /locus_tag="Kfla_0356"
FT   CDS_pept        356894..357526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0356"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: msu:MS0278 CitB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29480"
FT                   /db_xref="GOA:D2PUG2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB29480.1"
FT                   /translation="MIRVALVDDHPVVRAGMRALVDGQDDLTVVGEASDAHSAEQLVAA
FT                   VRPDVVLMDLNLGRGPGGVEATARLRALPEPPQVLVLTTYDTEADIMSAIDAGASGYLL
FT                   KDAPPDDLFRAIRGTARGEVVLAPAVAARLVKRAGSPGPVLTEREVEILGLLATGQSNR
FT                   ELAKRLFVSEATVKSHLSHIYTKLGVDTRAAAVARAIEQHIIRPSAQ"
FT   gene            complement(357621..358835)
FT                   /locus_tag="Kfla_0357"
FT   CDS_pept        complement(357621..358835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0357"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppd:Ppro_2206 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29481"
FT                   /db_xref="GOA:D2PUG3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29481.1"
FT                   /translation="MSVWANRDFRLLWTSNAVSGAGSWLLVVAVPVHVFQLTGSAAATG
FT                   LTLALEALPALLLGPWAGVLLDRWDLSRAMWIADLVSAAAVGLILFADRPERLWLIYLA
FT                   VLVENVASTVFRPAARALLPAVVGTGRELAAANALTAFTGSVNRLAAPPLGALLLAGPG
FT                   ITFVLTVDIVSYLLSAATIAAIRRRPDRALRQALHPLEGLRYAVRSRPLRGLLTGNGIF
FT                   LTANAGLTALLVPLTVERLDAPGHTVGYLISGLGVGYLVGAAVSVKALSWLGIRELIAA
FT                   TQLATAAAFFALANAPNVPWAIGAAVLIGLPGSVLLITTETTVQRVTRPTMLAQVGALF
FT                   FAVDALATVIGAVVAPAAVLVAGLPLTLNLLAAVAVLAAPVTLLVLPGHPAELTRKPAP
FT                   ERFSR"
FT   gene            358902..359600
FT                   /locus_tag="Kfla_0358"
FT   CDS_pept        358902..359600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0358"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: rpd:RPD_3963
FT                   flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29482"
FT                   /db_xref="GOA:D2PUG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB29482.1"
FT                   /translation="MELGPEFRARRKAAGRTIASVAVDAGLSVPYIANLENGRGNPTLA
FT                   TLDRLATALGTHLRVELENLPTHADTTNPDTAPATGTGTNAAADASGGGAYAANAPTVD
FT                   EPSHAVAAANRANADRVGDAATAGGAGIRANADRVGNAATAGGAGNGANAAGAAVDAAS
FT                   AVDPCAALLAASPRTAQVIDRLAVASNRPRSAIQGDLLTTLQALAVILPTTPTPTDLDR
FT                   LLDLLLLSTT"
FT   gene            360064..360840
FT                   /locus_tag="Kfla_0359"
FT   CDS_pept        360064..360840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0359"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bgl:bglu_1g16940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29483"
FT                   /db_xref="GOA:D2PUG5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:4IUS"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29483.1"
FT                   /translation="MGIAARIASAQLQGLVRSRRQVVAGPLVGLLHDEDVWFLSRAVAA
FT                   EPGVPFDPAEVPWALETIRKAFAAEGRWLSAELVEEANPGLAYVLVEHGMTIVSRPPLL
FT                   AVEPGDLLVPEFPAGVTAAVVASAEEQEAANAIAGDAYETDDVASPFQPEPADGGAVLI
FT                   RMDGVPVATAAWTAIADGVTEVAGVGTLHSHRRQGLGALATAYATQQAFEVGGATLAWL
FT                   TPGDDGADRIYRRLGYEPKATAVHLGDPGGHLADLR"
FT   gene            complement(361175..361756)
FT                   /locus_tag="Kfla_0360"
FT   CDS_pept        complement(361175..361756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29484"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29484.1"
FT                   /translation="MSREAIRQRYLEINGDHPMTAEDDAYVTRQFRVLDELCAEQGRDA
FT                   DEVRRLMLAEKLPMPGYLRSDGAEMVPADLFALADQAEDLRAWFVAQWADVAEGTEEWG
FT                   AYLSGQYVCLHSVTPATIQRKGQLIEAIKSATDPAELKSLVDELDALEPEFTAYDRLRF
FT                   GGPVSRDVYITPFRSATSAVSATTSSVTAN"
FT   gene            complement(361950..364397)
FT                   /locus_tag="Kfla_0361"
FT   CDS_pept        complement(361950..364397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0361"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: mno:Mnod_4188 RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29485"
FT                   /db_xref="GOA:D2PUG7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG7"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADB29485.1"
FT                   /translation="MVLQSIEQRIADELEVGVGQVRAAVGLLDEGSTVPFIARYRKEVT
FT                   GELDDAQLRALEERLRYLRELEERRQTVLESIESQGKLDDALKASILAAETKSRLEDIY
FT                   LPFKPKRRTKAMIAREAGLEPLADGLLADPSYEPLAAAAVFVNPDAGVADPQAALDGAR
FT                   AILVERFAEDADLIGELRERLWSQGRLASKVREGKETEGAKFSDYFDFDEPFTKMPSHR
FT                   ILAMFRGEKEDVLSLTVEPLPAGVEVDGPTEYETTIARKVGIENQGRPGDRWLVETVRW
FT                   AWRTKILVHLGIDLRMRLRQTAEDEAVRVFAANLRDLLLAAPAGTRATMGLDPGFRTGV
FT                   KVAVVDATGKVVATGVIYPHVPQNQWDKSIAQLAALCAAHQVDLIAIGNGTASRETDKL
FT                   AAELIAKHPELKLTKAVVSEAGASVYSASAFASQELPGMDVSLRGAVSIARRLQDPLAE
FT                   LVKIDPKSIGVGQYQHDLPENSLSRSLDAVVEDCVNAVGVDLNTASAPLLTRVSGITPG
FT                   LAENIVQHRDQNGPFATRTALKEVPRLGPKAFEQAAGFLRIPGGDDPLDSSSVHPEAYP
FT                   VVRRILDKTGSDLKSLIGNTAALRSVKAADFVDETFGLPTVTDILAELEKPGRDPRPAF
FT                   KTATFAEGVDKIADLKPGMRLEGQVTNVAAFGAFIDIGVHQDGLAHVSALSKNYVKDPR
FT                   EVVKPGDIVKVKVLEVDIPRQRISLTLRLDDEIGAPTSGRSGGGQSRGAAGQGQGGGRG
FT                   SGGRGPGSQGRGPGGQGGRGPGGQGGGRGPGGQGGRGGAKQGTPMDEGSLADAFRKAGF
FT                   TVR"
FT   gene            complement(364663..366144)
FT                   /locus_tag="Kfla_0362"
FT   CDS_pept        complement(364663..366144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0362"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_A3935 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29486"
FT                   /db_xref="GOA:D2PUG8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB29486.1"
FT                   /translation="MYATTESLATTPAAQGSGRSRWLALYTLCAGMLMIVLDVTVVNVA
FT                   LPAIQDDLGFTSSSLAWVVNAYLIAFGGLLLLAGRLGDLLGRRNIFVAGLAVFTAASVW
FT                   CGFAGSQEMLVAARFLQGVGGALTSAVILGMIVTLFPEPREQAKAIGVYAFVASAGGSI
FT                   GLLAGGVLTQAISWHWIFFINLPIGIATAWLAIRLIDKDRGLGMSRGTDVPGAVLITAA
FT                   LMVGVFTIVSPAAELGWTAPRTMALSLLTLTLLGSFILRESTAATPLVPLRIFRSRTLT
FT                   GANLVQALSSSGMFGIFFLGSLYLQRVLGYDALEIGLAFLPTTLVMGVLSVRYSEQLVT
FT                   RFGPRRPLIAGLVLIVIGLVLFTQAPVGGNYVVHVLPVLILLGLGGGICFPALMGLAMA
FT                   DVEPEDAGLASGLIGTTAEVGAALGLAVLATLSATRTEDLAGAGKPALDALTSGYHLSF
FT                   AVAAAIVAAAVVICCTVMRPAAQPAPDTEVVPDAA"
FT   gene            complement(366202..366831)
FT                   /locus_tag="Kfla_0363"
FT   CDS_pept        complement(366202..366831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0363"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29487"
FT                   /db_xref="GOA:D2PUG9"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUG9"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADB29487.1"
FT                   /translation="MSEGTSRTNVVMSKLSTAGDLLMLQLAFLVLSVGIVTLFPAAFAL
FT                   QRVLPYAIGQEHPSLLRRFWGEFRWAFRHFWLAGLGLYFGGVALAFGLLFWASTGGPIR
FT                   IFALAVLIPLTGMIIGLYLSALAVLPDTAEDATPRSLFRAANLFLLRRSLAVAGGVIGL
FT                   ATWFLLVGRLPTLFVIGSGLVPALLAYWISRTTTNRPQKSSPDVSI"
FT   gene            366923..367996
FT                   /locus_tag="Kfla_0364"
FT   CDS_pept        366923..367996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0364"
FT                   /product="regulatory protein DeoR"
FT                   /note="PFAM: regulatory protein DeoR; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein DeoR; KEGG: pfo:Pfl01_1922 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29488"
FT                   /db_xref="GOA:D2PUH0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH0"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADB29488.1"
FT                   /translation="MLVPERHELILRSLRRRGRLRVGELAAELGVSAITVRRDLAELDS
FT                   AGLLRRVHGGAVGTSPAGVSQAGPQLTVGLVVPSSTFYYTDVIRGAEAMADRYGARLVL
FT                   GVSGYDVQVEQKRIDKILALDVAGLLIATALGDERAAEVGRRLDDIDVPVVLMERAFGF
FT                   PDVDHEYDHVRTDHAYGALLALRHLVSLGHRRIGISLDASATAHWLRQGVARAADTLGV
FT                   DLFVSPVVLPARGEDAHSIAQLDAFLAECEAYGARAVVVHSDEHAARLVERAMERGLRV
FT                   PDDLAVIAYNDETAALAVVPLTAVCPPKFQLGETACELLLRRLRAGSDRRGVTQHLSLL
FT                   PELRVRESCGAVLADRI"
FT   gene            368107..369384
FT                   /locus_tag="Kfla_0365"
FT   CDS_pept        368107..369384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0365"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mlr3639 trehalose/maltose binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29489"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB29489.1"
FT                   /translation="MRRGAGLVVLAAAVGLAASACGNGVIDKSTDGVPPAEATGTLRVL
FT                   IPSFPASTKGREAFAKVVQEFQKTYPAMKVEPDFATYNNLNEKMSTSIAAGISYDVMVT
FT                   GVGWIQPFASKRIFLDLAQYGVTPEVIEQRSLEALIQPATYDGRLYAYPLLADARAVAL
FT                   RKSAFREAGLDPDRPPASLAELEVAAEKLTKRDGSGTITRPGFDFLAGASSYRQTYTTL
FT                   LASTGTPLYVDGEPNYSNEKGLETLNWIKSMVNKVQPYGQQNASQQPLVLSGEAAMGIV
FT                   GGAVDCSDKGIGQKNCDDLRFFRFDSGQEIEYVGGDLASIGSRSRHKDAAWAFIQALTQ
FT                   PSTLDEMAKLNKKLPAYRDAINSPQAKSNPLSAFVAEGLPHAVNENSPPTNWLEMRGNF
FT                   DIQLTQAILGQKDPAKVLANLAGQSR"
FT   sig_peptide     368107..368169
FT                   /locus_tag="Kfla_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.743 at
FT                   residue 21"
FT   gene            369381..370322
FT                   /locus_tag="Kfla_0366"
FT   CDS_pept        369381..370322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0366"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce3058 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29490"
FT                   /db_xref="GOA:D2PUH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29490.1"
FT                   /translation="MSATLERPTAVAEPRKVAPGKDSRALIRSQVRAGWVLLAPALAHS
FT                   AIFIVIPVIAVLVLSLTDYSFGDSWSWVGLANYRDLVRDVDFQASLVNTVLYAVVVIPI
FT                   SMAISLLIAVGLNQKIRGLGFFRTAFYIPTVTATVAIATIWLWIYNPGSGLANGFLSLF
FT                   GFAPNRWLTDPSTALGSLMVVGIWQGLGTKIIIYLAALQGVSRSLLESADLDGAGRWQR
FT                   FVHVTWPALGPVQFFVLITSIVGTFQVFDLVYVMTRGGPGTETRVLVLDIYQNAFQDLK
FT                   LGYASAETVIMMLVIALFIGAGRLLQKADSHD"
FT   gene            370315..371217
FT                   /locus_tag="Kfla_0367"
FT   CDS_pept        370315..371217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0367"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_6092
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29491"
FT                   /db_xref="GOA:D2PUH3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29491.1"
FT                   /translation="MTSVPLPAAAAGKPSSLRIGRILLYAALTVGAILMILPFVWMVLT
FT                   AFKNELEIAKFSWLPGELRWRNFVEAMQSGPFLRYFRNSLLIAVGETAFTLAVCTTAGY
FT                   ALAKLPIRGSKALLNYFILLLLVPFQIILVPLFLIVKSIPLFGGNNILGQGGIGWLNSW
FT                   WGLIIPLGAAPLFTFLARQFFVSLPSELAQAARVDGLGEFGIFWRIMTPLIKPALITIC
FT                   VFQIEAAWNGFLWPLMITTSDSLRPLQLGLAIFAQNPAEVQWPYLMAGTALATLPMIVM
FT                   FVLAQKRFVEGMANVGIKG"
FT   gene            371692..372513
FT                   /locus_tag="Kfla_0368"
FT   CDS_pept        371692..372513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0368"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   scl:sce4785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29492"
FT                   /db_xref="GOA:D2PUH4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADB29492.1"
FT                   /translation="MRYRVLTLNVQNDVGDPRRFRLINEELRRLSPDLVALQEVCYPAG
FT                   SNDQLAELLEGTGLTHRTHQRDVLPDLPELFRHDGTAIATRHPHRVAEVLEHRGTGVRG
FT                   DPHWWTLAVTVDLGPVGEVLAITPTTPWQLDHEYARERQALDIAALDARHRTALPTVLA
FT                   GDFNATPDSASIRFLSGHQSLDGTSVHFHDAWTTRGEGPGHTWTTANPLAREEIATLIG
FT                   QSPHHRRLDYIFVGSRHAHPDTQATIDTVDLVGVNPPLSDHYGLVADLTLL"
FT   gene            372611..373267
FT                   /locus_tag="Kfla_0369"
FT   CDS_pept        372611..373267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0369"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mrd:Mrad2831_2427 beta-lactamase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29493"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH5"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB29493.1"
FT                   /translation="MRQLTDGVHQLLGRPPHFINAYLVDDVLVDAGTPAAARRILRELR
FT                   DRQVAAHVVTHAHPDHFGSSHAVCEALGIPLWTGAADAEAIETATPVVGPGRIPALMAK
FT                   SKMPPAHPVTRRLVQGDQVGSFTVLDVPGHSPGHIALWREADRTLLCGDVFFRLPRLSE
FT                   PWKFLTVDVQRNYDSMRRLAELRPELVLFGHGRPLRDPDRLARVAEALPASRTRF"
FT   gene            373268..376117
FT                   /locus_tag="Kfla_0370"
FT   CDS_pept        373268..376117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0370"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rfr:Rfer_2227 XRE family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29494"
FT                   /db_xref="GOA:D2PUH6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH6"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADB29494.1"
FT                   /translation="MGSTLERPGELSRIAAALDAAGQGNGRVVVIEGEAGIGKTRLVGE
FT                   ARALAKQRGFVRMQAIGDELESALAWGVVRQMVERSIARYAGEVRAAILAGPAGRALDA
FT                   LDKATPNAGDAEVARTMHALWWVAVDLASPRPLLISVDDAQWSDLPSLRFLSYLSKRVA
FT                   DLPIALVVATRPPSDRLGPLAELTVSRHVERLLPRPLSREAIGTLTAEHLASAPHPAVG
FT                   TGEAPAEKVVDAVLEASGGNPFLAESLLDELSVLHRSVTDPATADAVRGLASSAVSRTT
FT                   LARLSPDALALASAVAILGARADLWAAGSIAGLADAPLSAAIDGLVAANVVTTSSAQVS
FT                   FLHPVIRESVRSMLGPIEKAALHARAAETLSAAGAPAARVAAHLIHTPADSSAQTVEVL
FT                   CEAAASSAAAGDTATAISYLTRALEGAPGNSSLQGQLGLTLLRGGDAPQARHHLLAAAA
FT                   ASAVPERAALLAAAATATSLIDGPLAAANELVHTLADWPGPPFAPDRLTLEARLGILRS
FT                   YLPTERKKASEHLRRFADLPGETPDERTLLALLAQRGRYEVSPAADVRRTAERALRHGA
FT                   LFKDSAGHSDTLVGWLLAMMSLVAADGVTLAREEIAGARDWVRRHGSPIEFAMVANVAD
FT                   FVAWRCGDLPAVEADADGVLAAVEPEDLTPQVVALRATAVHFGGYAALERGDVAAAQAL
FT                   LADFETQCQDAPRVIAMMWLHELRARIALEQDHPAAALEHAYRLRDEMAAAELDPLAVP
FT                   WRTPAAWALLRLGSEEEARQLAADQLELARRWGAASDLGTALRLTAKVDVGQGARRVAT
FT                   LAEAVAVLEKSPAQLELAKALVELGEALRVVGRRTEAREALARGGELAAVCGSAVIRQR
FT                   AAEALQALGDRPRTLISTGQDSLTASERRVAGLAVSGRTNRDIAHELFVSPKTVENHLG
FT                   RIYVKLGITGRRELARALT"
FT   gene            complement(376195..377115)
FT                   /locus_tag="Kfla_0371"
FT   CDS_pept        complement(376195..377115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29495"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29495.1"
FT                   /translation="MKRHRLSVLAGLTAATALFPAAGAYAAPAELPIAPLCAEQKDVAG
FT                   PQYAVNLCDVTDADQFRTHLAAEGSSHCGPTSLYNAMYYLGEHKGLPMRITPNGQLLTE
FT                   YDPGKPEDYDEVTAWIGWLGYKAGMGPNGGGSSTGENRAAFDAATVGAKAAGWTVNRGG
FT                   IGTDNTPEFGLEIAKRLRQAPVQLWYGRYVLNADNTHSRTGGHAVTVVAAKGDVGSGKV
FT                   ELTLHDPARADDHKTPGYKDTQSEVRGEKVTLYRVAINVKSVSDDGVTTIKQRTYWRLF
FT                   GEQYQGSTMGYVEAINWFEAAPPVG"
FT   sig_peptide     complement(377035..377115)
FT                   /locus_tag="Kfla_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            377424..378251
FT                   /locus_tag="Kfla_0372"
FT   CDS_pept        377424..378251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0372"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding;
FT                   KEGG: prw:PsycPRwf_2197 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29496"
FT                   /db_xref="GOA:D2PUH8"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH8"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ADB29496.1"
FT                   /translation="MLNDFTQQIITEFRANQGRVGGPFDGARLLLLTTTGARSGRPHTA
FT                   VLGYYPDTEDRLLVVGSAGGGPKHPDWFHNLRADPRVTVETGVFTYEAEATVLQGAERD
FT                   ETFARLAEADPGWAEYQRRTTRTIPVVALTQVAGGPPNASSFGEALILIHAAFRRELAL
FT                   IRKEVATSAASGSVGLGAQLRINCLTLCRGLHFHHTVESDGLFPSLLDRYPELTDTISA
FT                   LQADHDKIALLLEEFQLLLSTGSPAAILPEIDRLIEELTDHLDREEAQLIPLM"
FT   gene            378378..378893
FT                   /locus_tag="Kfla_0373"
FT   CDS_pept        378378..378893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xca:xccb100_4121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29497"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29497.1"
FT                   /translation="MNVSVSRATVLRGAAVAAAAAAIPGTAYAARPEHPNVKLIRGYYE
FT                   AYAAGDLAALRNRYFAPGIRWTIPGHHPLAGTKEGVEEVLAFFAQLARAGFRADPLFLA
FT                   ADGDWVVDLHRGWSTTPEGLDLTWALAFRIADRRIVEAVNYPSDQHAADAFFWRTYPLA
FT                   PIPTRLQQ"
FT   sig_peptide     378378..378467
FT                   /locus_tag="Kfla_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            379054..380310
FT                   /locus_tag="Kfla_0374"
FT   CDS_pept        379054..380310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0374"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   scl:sce8970 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29498"
FT                   /db_xref="GOA:D2PUI0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI0"
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /protein_id="ADB29498.1"
FT                   /translation="MRVLLSTYGSRGDVEPVVALGVQLQALGVEAVVCAPPDEEFAELL
FT                   AGAGVPLVPVGQSARALTKSAPPPSSIPERAAELIASQFAVLPAAAQGCDALVATGMIP
FT                   TVAGALSIAEKLGIRSVSVTFQQLTLPSPHHRPLAYAGRSFPPDVTDNQALWDLDAESN
FT                   NVLFGEALNGNRASIGLPPVPNVRDYVVGDRPWLASDPVLDPWLEPADLDVVQTGAWIL
FT                   PDERPLPDDLEDFLGAGGPPVFVGFGSMPLHAATDAARVAIEAVRAQGRRVIIRRGWAD
FT                   LGLIDDQDDCFAVGEINQQQLFTRVAAVVHHGGAGTTTTATRAGTPQVVVPQAADQPYW
FT                   AGRVADLGIGVAHDGPIPTVESLSVALETALTPETGARATTVAASVRTDGAAVAARYLV
FT                   ELINGTSDDRRALASDWRS"
FT   gene            380312..382480
FT                   /locus_tag="Kfla_0375"
FT   CDS_pept        380312..382480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0375"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: aeh:Mlg_1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29499"
FT                   /db_xref="GOA:D2PUI1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI1"
FT                   /inference="protein motif:COG:COG3973"
FT                   /protein_id="ADB29499.1"
FT                   /translation="MASVSSSAFALPGNLAAKADPRLIAADEQHFAAIATSLEQSIADL
FT                   SDRLDAARKTPGGAGQEALDRDLEIHRLTARLRTLRRFGLDLCLGHMVGADDPDPVYVG
FT                   RLGLTDSDGRRLLIDWRSPAAEPFFGATHANPMGLASRRRYRWTRGRISDYWDEVFSSD
FT                   GFEGHAAALDDQSAFIASLGSNRSDRMRDVLGTIQADQDAIIRAGSRGALVVDGGPGTG
FT                   KTVVALHRTAYLLYSDPRLGHSRGGVLFVGPHQPYLAYVSDVLPSLGEEGVQICTLRDL
FT                   LPEGASAPAEADPEVARLKSSADMVAAIEPAVRLYEEPPTKPMTVETHWSDIWLTAADW
FT                   AEAFGSADPSTPHNEARDQVLEELLTILMDKHADEYEDDDVSPEMLRRSLLGNEDLMDA
FT                   FGKAWPLIDPTDLVGDLWSVPAYLRMCAPWLTPDEVRTLQRSDPQAWTVADLPLLDAAR
FT                   QRLGDPEASRRKRRQAAAAAVERERMADVIDHIIEADDDNEGWVPMLRGKDIQESLIDV
FT                   AALPAADPDLLAGPFAHIVVDEAQELTDAEWQMLLLRCPSRSFTIVGDRAQARHGFTES
FT                   WQERLERVGLDRVNLASLSINYRTPAEVMTEAEPVIRAVLPDANVPTSIRTSGIPVSHG
FT                   AVADLDAILAGWQAEHPEGVACIIATEPIGHPSGPRVRTLTPELSKGLEFDLVVLVDPE
FT                   SFGDGIEGAVDRYVAMTRATQRLVILNS"
FT   sig_peptide     380312..380371
FT                   /locus_tag="Kfla_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.516 at
FT                   residue 20"
FT   gene            complement(382542..383225)
FT                   /locus_tag="Kfla_0376"
FT   CDS_pept        complement(382542..383225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0376"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: bbr:BB3851
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29500"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI2"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADB29500.1"
FT                   /translation="MPTSRSYRDSCGIARALDVVGERWALLVVRELLLEPQRFSELRHA
FT                   LPNISSNLLADRLRELEHRGVIRRRPAATERAQAYELTEWGRKLEPMLAALGEWGIDAP
FT                   EPPAPAALSASSVLIFLRGAARPDPAAEPTTCRLELDGRVWTVRMASGRVAVEPGEPAT
FT                   AAASLRADPKTFSALLTDPATLPTARDDGSATVVGDVSAIDRLLRSVSEPWSAGEQRPA
FT                   EVRSL"
FT   gene            383369..384583
FT                   /locus_tag="Kfla_0377"
FT   CDS_pept        383369..384583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0377"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sml:Smlt4538 putative major facilitator superfamily
FT                   transmembrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29501"
FT                   /db_xref="GOA:D2PUI3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29501.1"
FT                   /translation="MRQTSTRSGALSRSGTNLALASLFVGMFVLGSGELLVVGLLHLIA
FT                   VDLQVSIPAAGVLVTAYALGLAAGGPVLTALTIKVNKRTILIGAIALVVVLTLIPVLTG
FT                   SFGLFVAVRAAIGALHGLFVAVGFVLAMSIVPPERMGRAISVVVSGLFVSTALGVPLGT
FT                   LVGQLLGWRGSFTAVAVLGVVALVATLMLIPSMPSSGGGAASQARYAFAPRVLAALVVN
FT                   VVAFAAVFSALTYIVPFLQDVTGISGALISLFLLAYGAATATGSFAGGRFADQDAARTL
FT                   IVGAIGVAASLLVLYLAGSIAVLVALALLTFGLFAMGMVPSMQYRVVSLAGPGGQLASS
FT                   LPASAANVGIAFGAYAGGVAIGAFTASAAVITGLVIAVVAIPIAWAASFLKPPTTATAL
FT                   TSDPA"
FT   sig_peptide     383369..383467
FT                   /locus_tag="Kfla_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.345 at
FT                   residue 33"
FT   gene            384608..385417
FT                   /locus_tag="Kfla_0378"
FT   CDS_pept        384608..385417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0378"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rle:RL2727 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29502"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29502.1"
FT                   /translation="MTGLLLENKNAVIYGGAGAIGSAVARVFAREGAKVFLAGRTQDKL
FT                   DAVAGDIAAAGGTVETAQVDVFDQEAVEKHASAVAASAGGIDIALNAVSVMHDQGTVLA
FT                   DLSVEEFMRPIDGFLRTLFITTKAVAQHMGSDRPGVILTLSEPGAKLAIGGILGHGVSA
FT                   AGKEAFARLLAAELAPANVRVVNLRPHAIADAPAAGSYTKDLFQPSAAASGQSVQEFLD
FT                   GGLAQGTLLKRLPTLAEIAETAAFLASDRAGVMTGTVANLSGGALVD"
FT   gene            385524..385883
FT                   /locus_tag="Kfla_0379"
FT   CDS_pept        385524..385883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29503"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29503.1"
FT                   /translation="MRKTAMLGVAAVGTMVVQLTGVGSAFAAPAADPAPVTSKSAVSAA
FT                   DDGYWCEQSGINTENVVATCYNQTDQARYAHFHVDCWGLGDNDADQTKWVGPWGSVSFA
FT                   HYCWSHAQSIEAYFQ"
FT   sig_peptide     385524..385607
FT                   /locus_tag="Kfla_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(385895..387826)
FT                   /locus_tag="Kfla_0380"
FT   CDS_pept        complement(385895..387826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0380"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain protein; KEGG:
FT                   bcm:Bcenmc03_7016 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29504"
FT                   /db_xref="GOA:D2PUI6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADB29504.1"
FT                   /translation="MAYSRSTGGLGEPGGPTEELEIALLGPLRVRLGGHDLAIPAGRLQ
FT                   AVLAMLAMEPGRAVSNGRLARAVWGEDLPVNVRKSVQTHIVRLRRLLGRSRIRTEPGGG
FT                   YLLDVRPAQVDAVRFGELLAAVPLEPDPGGQRRLLAEALQLWRGAPFEGVGSQWLDEVE
FT                   STRMVELYVSAREHWVDLDLAAGRHDAAVAELREVTARYPLREALWSRLLLALRLSGRQ
FT                   AEALACYEEVRVLLADQLGVDPGPELKRQYSELLHSGQPAPAPDSGSSAAAEDNTPAPD
FT                   HPPAAVPRQLPAARGVFVGRGRELRVMDELFDSAADEPAEPEMIVLHGLGGIGKTALAL
FT                   HWVHSVRERFPDGQLFIDLQGYGPGEPVDPASALHSLLVGVGLPEAQIPDDVEARSSML
FT                   RTMLADRQALLVLDNALNADQVRPLIPGPGSLSVVTSRNELHGLAVREGADRIALDELT
FT                   SAESKALLRARLATQDVGDNLLAELANLCGHVPLALSIAAERSGSAPEAQITALIDELR
FT                   TRHHPLAALAVGDESGDLRAVFARSYQALGPRAAQAFRVLGRHLGSQFGLPAAAALLGT
FT                   TPYDAVPVLESLADQHLLSRVDGRRFEFHDLVRAYAVELAHHDGPPTARDRAARNVLPL
FT                   ATRSPATY"
FT   gene            388374..389849
FT                   /locus_tag="Kfla_0381"
FT   CDS_pept        388374..389849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ent:Ent638_0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29505"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29505.1"
FT                   /translation="MVYSQFPIDEVSVSDLRLDVSNYRFPIDQPSEHAAMNYLFAASDV
FT                   MEVVRLILPDGYVDNELPLVVEEDGGFVILEGNRRLSALRALLDPSLVPSHQTEIEHLL
FT                   RRYPLEAADLPEKIRVMRFPDREAAAPVLARLHIGENKRRWNLDEQAKFVFAQLTDGIT
FT                   VRALKEQLPAIKDVVRLIRMGNVRQMLGEISFGDPALEEYAVSSKLPMSAFEYAYRNSA
FT                   IQSAIGIAFDDEGNLTSRPSTDAHVAALARLLRGFKAGELNTRRGLKVGTDDFRRLIDE
FT                   MRGTSAQAQDEPPAAAATSDASNAGDAGSGGTRPGGSGPAAAPGRPSGEPGSAAAAGDQ
FT                   TSRRGPNSPETKKTLDFAGIDEEPLPLPLKHRVRELRRIEVAQFPAAAAMLMRSVLESA
FT                   IKEHYGVKGGPAATGMLSDVMVRITSDYNQDKQFANAISTINRKGRGASTVPGSGEWFN
FT                   MVSHSVNIDVNGRQVHEAWRVVFPLVRFLLKRP"
FT   gene            complement(389824..390726)
FT                   /locus_tag="Kfla_0382"
FT   CDS_pept        complement(389824..390726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0382"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: hap:HAPS_0629 site-specific DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29506"
FT                   /db_xref="GOA:D2PUI8"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI8"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ADB29506.1"
FT                   /translation="MERVKVVASRRYGTLSPLRYPGGKSALAGLFADVIAALALPTPCY
FT                   VEPYAGGAGAGIALLRNELVDHLVINDLDPAVHAFWHSVVHKNEAFVELVETTPLTIDE
FT                   WSAQREIYRAADESDLLALGFAFFYLNRTNRSGVLRGGVIGGLAQTGTYKIDARFNRST
FT                   LSERISAIGRLSDKITVSNTDGRAVILAHANDTNAFMYIDPPYVKAGSQLYLNSFEHRD
FT                   HTALAKVVNGIKGAHWLMTYDTSPLIERLYAKSFQRRYALNYSARHPGQADELMIASRY
FT                   VADVIRQTELATTDASIGT"
FT   gene            complement(390836..391513)
FT                   /locus_tag="Kfla_0383"
FT   CDS_pept        complement(390836..391513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0383"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: pau:PA14_23210 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29507"
FT                   /db_xref="GOA:D2PUI9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUI9"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADB29507.1"
FT                   /translation="MTTDPLRQLFDSADAVLFDFDGPICSVFDGYPAQRITAELRELAG
FT                   TLPHDLDEALRKPAGPHELLLAAATDQRLATRLERALQEAEIKAVETARPTPGAAESLA
FT                   ACKSSGKLVAIVSNNYTEAVVRYLVRTGLADRVAHVEGRDPSDPTLMKPSPHLLDRATV
FT                   ALGIRTAACVFIGDQASDMEAGRAAGTRIIGYANKPGKSEALTHSGASAVVDSMFAIAA
FT                   AIR"
FT   gene            complement(391510..392364)
FT                   /locus_tag="Kfla_0384"
FT   CDS_pept        complement(391510..392364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0384"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: rlt:Rleg2_4817 GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29508"
FT                   /db_xref="GOA:D2PUJ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ0"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB29508.1"
FT                   /translation="MEQQLDPSDPRPPFKQVANALRAAILTKKVKAGEKLPSQNELATQ
FT                   YGVARMTIQQALRILRDEGLIVSRVGSGVYVREQADQAVGLRPHIEKAFEQDEVRIDFA
FT                   GLTGETLLGALEEPIDRIRRGRLTPQSITIRMLLPDLNQPIAVPSRAGETPGDDPRVRA
FT                   RVAGIAHRSAGEIIQSVRELGELGLVPKTEVEARVVVGLPMMFKLYALNDEEIFFGFYP
FT                   VVEREVEIEGEHVSIFDAVGKDTVLFHHSTSDNDQATGSQYVEQARRWFESLWGTLGQV
FT                   REL"
FT   gene            392561..392809
FT                   /locus_tag="Kfla_0385"
FT   CDS_pept        392561..392809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29509"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29509.1"
FT                   /translation="MSIIHLSAVSGEEPTAADLAGIEAEWPLIAAELDLLDAQIAFINA
FT                   GPHASELETRRIRRAERRVLEVGRELADRVPETEGAA"
FT   gene            392806..393027
FT                   /locus_tag="Kfla_0386"
FT   CDS_pept        392806..393027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29510"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29510.1"
FT                   /translation="MTAQAVEMPLPDLTRVDLGWWKVAGYDLVQVVSPRTALGTAWIVW
FT                   RGDHVLHTTDTLPHAGQWVMTQVGGGVR"
FT   gene            393024..393920
FT                   /locus_tag="Kfla_0387"
FT   CDS_pept        393024..393920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GA25820 gene product from transcript GA25820-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29511"
FT                   /db_xref="GOA:D2PUJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29511.1"
FT                   /translation="MSTLTKAPSTAPAVAKSNGVERLRTAAAEASQVRALSTHPDVVAL
FT                   RVESVRTQVDRCMWVGIVLGLAFTMVNVQAFAAQGAALWSLPWFAAWLLDPMVSLVLIA
FT                   VLRAEQITARYQVSDHTKWIGRTKRFAFAATYAMNTWHSFVHLDVAGIVLHSVPPLLVF
FT                   CAAETAPVLRDRLTEAVLRAERTAALADPAGASHHLDTTPAAAEPPATIESREKPAKTG
FT                   RKLLADYVTEALAAIEPGTAADAITPAWARHTTGCSTGLAAKVAAAVRDELTSSQTANH
FT                   TSADDTDAPGETARVAA"
FT   gene            393940..396204
FT                   /locus_tag="Kfla_0388"
FT   CDS_pept        393940..396204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0388"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG:
FT                   hpp:HPP12_0354 cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29512"
FT                   /db_xref="GOA:D2PUJ4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ4"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADB29512.1"
FT                   /translation="MDNVHKLHPDHDQDRDATEDRPQDVAPGIVSEPSERVDATDTTAA
FT                   DAEVVEGEILTEEESAELDRRLASRGALVRRAVTTTQVVARASKTVATHDRTKTAGKVL
FT                   LREGFTVVQGVESWAKRAWDASTMGVYRRQIKAAEAVGDREELKQWTDRKEAATDRRHK
FT                   RLMDLPKLAWGVLKVTVAMTIGVPFLVLLIAILTKATGHGSFTSVWLGFFALIGFLIAA
FT                   GAVIWSGVSIAAPFLVVLAAWREGKRRAEPPAWLVTTADAEWDAAIDETTIAKALEALR
FT                   IPAITQYLKAGLKLQFITPARVDGRGTHAIVRLPAGVTAEKIARRRGDLATGLHRAAKE
FT                   VWPTTGSEAGILDLWIADKGALAEGAGEYPLLAGGLVDVFKGVPAGKTLRGDALLALIM
FT                   ERNTMTGGMPGQGKSSAARAIMAGCALDPTAELRIWVPDTNFDFEVFKPRCANYIMGAD
FT                   DDSMKAIRDQLVNVHEEVQRRGELLIRYEQPAVTRELANAGVGLHPLICLLEEAHVAIT
FT                   DDTYGKEISKLLVEIVKLGRKRGIHMIVSTQAPTRDSMPRDVTRNCSNGIAFAVGDHVA
FT                   NDALLGQGAYAAGHRATELIPGTDKGTAVVKGFTGERSEILQWYYLDVAKGNDQVTPLI
FT                   KRSLEAIAKLGRTIPDSKSVQIEARDLLSDLDEVLGDDPRPIADVPALLKRHAPSWTPY
FT                   QSLTGKALRELLDREHGIKVPSTGNRYPLDPATVRDAIVRREQATADGDDSGDDAGTLA
FT                   S"
FT   gene            396450..396767
FT                   /locus_tag="Kfla_0389"
FT   CDS_pept        396450..396767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29513"
FT                   /db_xref="GOA:D2PUJ5"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29513.1"
FT                   /translation="MMTDPVHAVLLGGSGLVLAGLAAAADAADALSRPEQVAVLVIAAL
FT                   ILSGLYLLACTLWPYANCPRCAGSGKSRSPSGKSFRNCPRCKGTGRRERFGRRLLNRGD
FT                   R"
FT   sig_peptide     396450..396524
FT                   /locus_tag="Kfla_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.454 at
FT                   residue 25"
FT   gene            396767..397189
FT                   /locus_tag="Kfla_0390"
FT   CDS_pept        396767..397189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6889 exonuclease, RNase T and DNA
FT                   polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29514"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29514.1"
FT                   /translation="MCAALAGLSLHPAKAEWIELWNGKQALGWDYYGTPMFRFRWAPAG
FT                   LATRRQLRAMRMSPGGQEPYALLVWRNGKRWAWLYRLDLAKPSRVPSPAQLNALDRAMQ
FT                   ARRTCGLCGTVTVYCIPTSDGRCLDCIDAASYPTAA"
FT   gene            397209..398081
FT                   /locus_tag="Kfla_0391"
FT   CDS_pept        397209..398081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0391"
FT                   /product="Bifunctional DNA primase/polymerase"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase; KEGG:
FT                   mno:Mnod_4088 bifunctional DNA primase/polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29515"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ7"
FT                   /inference="protein motif:PFAM:PF09250"
FT                   /protein_id="ADB29515.1"
FT                   /translation="MNDLLTAALAAAARGWPVFMLGRSKRPVANCDDCRDNPHDPATCG
FT                   HLTCHGFYAATTDPERVAQIVAAVPDGQLAVRTGAVAGLVVVDVDPAHGGNDSLAELVT
FT                   HQLVPRTLWVRTGSGGAHLYYRHPGREIASRPMPGRAGIDVKADGGYVVLPPSMHHRTH
FT                   LPYQWGSGPADPTEMPPALITACLPATPAESATRTAGPIRTTRAGGISNPEGLLTSTLN
FT                   AVRNAPEGKRRTTLYGAARGVARMVAAGAISHADAIAALTAVGQQVDQTARDIRAAISG
FT                   GFHDEGIAA"
FT   gene            398078..399430
FT                   /locus_tag="Kfla_0392"
FT   CDS_pept        398078..399430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29516"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ8"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_0362"
FT                   /protein_id="ADB29516.1"
FT                   /translation="MTTPDPIDAHRIDGAELLDEVAATITRYVVLPSDAALTAVVLWIA
FT                   ATHAVPAWNCAPRLVIRAPEKRCGKSRLLDMADGMVHRPLMTTNASPSAVYRSIGLTPS
FT                   DPPTLLIDEADTIFGPKAGDNEDLRGLLNAGHQRGRPTLRYDAGSRSVERIETFAMAAL
FT                   AGIGTMPDTIEDRAAVIRMRRRAAGETVQPYRVRRDGPVLADLRDRLHAWVTAHLDELT
FT                   SAAPSMPLEDRAADTWEPLIALADLAGGDWPQAARQAALTLLAELQDSTEVSLSVRLLS
FT                   DCRTAFGAASALPSTVLVQRLRADEESPWQEGPGVGGLTVRRLAALLREFDITPKNHRW
FT                   EDGTQSKGYTRDDFTDAWARYCPEPAEIGSSQPTVANRPNRPNAGHAGDGSVLRDGSNR
FT                   PNDPSVPALTWAGTVGTDGTDHPPKPAQPTCIRCRRPLSEDDGSHTHPNCA"
FT   gene            399427..399696
FT                   /locus_tag="Kfla_0393"
FT   CDS_pept        399427..399696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0393"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29517"
FT                   /db_xref="GOA:D2PUJ9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUJ9"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADB29517.1"
FT                   /translation="MSERDGLTEGDLFPMSIAEASITNTAPLLLTVEQAAQQLGIGRTT
FT                   VFALLKSGELESIPLGRLRRIPAECITEYIDRLRAAARDNRQAA"
FT   gene            399709..401004
FT                   /locus_tag="Kfla_0394"
FT   CDS_pept        399709..401004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0394"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mlo:mlr0475
FT                   bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29518"
FT                   /db_xref="GOA:D2PUK0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK0"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADB29518.1"
FT                   /translation="MSDEKAKRHKNPDGRSSIYFGSDGYWHGRVSMGVKDDGTPDRAHV
FT                   KRRRKEDVVARVKELEKQRDSGKIRRAGPKNWTVAQWLTHWLTITRPTLRDGAYDAYEV
FT                   AVRVHLIPGLGAHKLNKLLPEHLERFYAKMQANGSSAGTAHQAHRTIRRALGEAEKRGA
FT                   LTADNPAELAIPPRLDLDEEDEIEPYTVDEIKAILAEANKHRNSARWAIALALGLRQGE
FT                   ALGLKWSDIDIKTGVLRVRRSLNRPKYKHGCADDPCGRKPGFCPKRQKARPDSAPTKSR
FT                   AGRRTIGLPAELTKILQAHWQEQAAERTLARQLWKDEGWVFAKRTGEALSPNMDYREWK
FT                   AMLAAAGIRDGRLHDARHTAATVLLLLGVPERAVMDVMGWSSSSMVKRYQHVTAPVRMD
FT                   IAERVGGLLWSAMEAGEEDDPGEAAGGVHVPA"
FT   gene            complement(401154..402416)
FT                   /locus_tag="Kfla_0395"
FT   CDS_pept        complement(401154..402416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29519"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29519.1"
FT                   /translation="MGGIISREPSWNLDQARSDYISRFIKPTQTLSRAKKEQIIAAASS
FT                   EGLREQIAFLHANAPASLAPYIERVLVATPSHTTTIQAEAIAYGATSRVVILSQPARVM
FT                   LGFLGTAIASFLDDFRKFMGIELKRSPKKILPTADAIAHMEDTGKQFAHRHHDFLLGEA
FT                   KRLVSDLVRSPKDLPRLAGRWVKLPHPNTMHLYFADRAAEFVLAHELSHHLLNHPAKAA
FT                   SNSSAPARRYLTQRFAEIDHEFPTDISKSHLHEFEADALALFLLLGDGADATASYGRAI
FT                   DAVAAAFSALLAFDLMEELTAAQPSSNPLGLEPRNTHPMMRDRAIALLDLTGLAAPDHP
FT                   DGTEFNWHLGRTVSRRVEGHALQLWACRAFMSEVLTSRLWLPRETVRGELSPMLAGAPD
FT                   TLPRISMQLDGPRDQANWSLR"
FT   gene            complement(402843..402930)
FT                   /locus_tag="Kfla_R0008"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(402843..402930)
FT                   /locus_tag="Kfla_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(403006..404217)
FT                   /locus_tag="Kfla_0396"
FT   CDS_pept        complement(403006..404217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0396"
FT                   /product="alpha-L-arabinofuranosidase B"
FT                   /note="PFAM: alpha-L-arabinofuranosidase B; KEGG: similar
FT                   to predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29520"
FT                   /db_xref="GOA:D2PUK2"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036195"
FT                   /db_xref="InterPro:IPR038964"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK2"
FT                   /inference="protein motif:PFAM:PF05270"
FT                   /protein_id="ADB29520.1"
FT                   /translation="MSGEQPVVGAFANAPGMVTVTWDHSGDGVHWFVIELETPYTFWVA
FT                   DIGKRAWSVTGLDPSHTYRYRVCAVYDFDRACSEFGSVTTMPPVSGPASPPATVDAQPL
FT                   PRDVCSLQAINFPGLLARHRNFAGLLTPVETDLDRADATFVVRKGLTGAAGTVSFEASN
FT                   HPGHFLRHANFKVGLHKNDNSDLFRADATFKRHGGDEVVGIVSFESVNFPEHYLRHQNS
FT                   ELVISKHDGSDQVWLDAQWLRIPPPPKGAPPGTVSFHSVNFPGHYVRHRNSLGEISRVS
FT                   SDLDRNDATFVVRPGLWRNGPFPQGVSLESRNFPGHYLRHQDFRVKLHKDDGTELFRKD
FT                   ATFAFVSGYGDLASKGYGTLKPVHSPHRDFYVRHQNFELWIAETDGSSLFGLDATWQPT
FT                   APLA"
FT   gene            404459..405451
FT                   /locus_tag="Kfla_0397"
FT   CDS_pept        404459..405451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0397"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; GCN5-related N-
FT                   acetyltransferase; SMART: nuclear protein SET; KEGG:
FT                   mno:Mnod_5899 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29521"
FT                   /db_xref="GOA:D2PUK3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK3"
FT                   /inference="protein motif:PFAM:PF00856"
FT                   /protein_id="ADB29521.1"
FT                   /translation="MEIRPVAPEDVEAVQALIESDPGYTERITGHPPGPADAQSLLMMR
FT                   PDGLPEQAKVVLGVFEGNELVAVADLLRGYPDDGFAFIGLLQVHGDRQGCGTGSTAYGL
FT                   VERYVFEHWAEVRRLRLAVVEMNAERAAPFWRRQGFEPTGEVKPHQYDKLTSTVQLYEK
FT                   ALCWGHPRLAVRDSPIAGKGLFAAGPIAVGEVIAVLAGRKVSTAELEELLEHPPVDTIT
FT                   VADDLHLVLPTDPRPVIAYGNHSCDPTTWWVDAVTLSARRDIAPGEEVTSDYGTSTGIA
FT                   DWRMKCSCGSPLCRGVVTGTDWRRPELQERYGDHWIPLLLQRQRAAQHA"
FT   gene            complement(405461..406279)
FT                   /locus_tag="Kfla_0398"
FT   CDS_pept        complement(405461..406279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0398"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: mpo:Mpop_3958 luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29522"
FT                   /db_xref="GOA:D2PUK4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK4"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ADB29522.1"
FT                   /translation="MTKLSFGPFGITTGLTSSPESLEAARIAEELGYPAIWLSGGPMTD
FT                   LQTIHDLVEATSTIKFVSGILAVDTYTPEEVSALYKTLESAHPGRFTVGLGGAHGPKPL
FT                   ATLNQFLDQLDGVPVEHQLLAALGPRMLKLARERTSGAYPFLVTPEYTAEARATLGTDK
FT                   LLSVSHLTVVETDAERARAIAREPISFFTTLPGYAASLRRMGFSDSDLSELPDHMVDAL
FT                   TAWGTPDQIADKLREHLTAGADHVAINILTGVTGPQPIDQWRTLAPVLLS"
FT   gene            406543..406634
FT                   /gene="ffs"
FT                   /locus_tag="Kfla_R0009"
FT   ncRNA           406543..406634
FT                   /gene="ffs"
FT                   /locus_tag="Kfla_R0009"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            406727..407542
FT                   /locus_tag="Kfla_0399"
FT   CDS_pept        406727..407542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0399"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD synthase; KEGG:
FT                   bgl:bglu_2g04180 NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29523"
FT                   /db_xref="GOA:D2PUK5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK5"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADB29523.1"
FT                   /translation="MSEDRRYLQELIIAELGVTPSFDADVEIQRRVAFLADQLRRTGAT
FT                   SYVLGISGGVDSTVAGRLCQLAVERVRADGGSATFVAMRLPYGVQHDEEDAQRALDFIR
FT                   PDETLTVDIKDSTDAMVDAMKHVGLGDRVEFHAGNVKARERMIAQYAVAGVRGGLVVGT
FT                   DHAAEAVMGFYTKWGDGACDVTPLSGLTKRRVRAIGERLGASPEITGKVPTADLESDRP
FT                   GIPDETVLGVSYDQIDSFLEGHDVDDQAAETIIATHRRTSHKRAMPIGL"
FT   gene            complement(407603..408505)
FT                   /locus_tag="Kfla_0400"
FT   CDS_pept        complement(407603..408505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0400"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rpb:RPB_1894
FT                   proline iminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29524"
FT                   /db_xref="GOA:D2PUK6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB29524.1"
FT                   /translation="MLTEIRGTRLYVDPRGAADAPPLLYIHGGPGAGSYDFLAYQGDRL
FT                   AERLRVIGVDQRGVQQSDPIDEPATEEDVIADFEALRDQLRVDHWAVLGHSYGGRLALR
FT                   YAVTRPETVSKVIFENPPWDMVLATRTLVEAAGPLLSELGLENEAKRLLAHQGPATSET
FT                   WDERIALLHQLGDRRMEVYLGPTSHGLRLPSNDLPEEVQERAGYFAETITRAPSFNESL
FT                   LPYLAQLTQPALLIKGEYDPVTSSEEIARFQADAPNATYRQVDGVGHFVHAEQPAEYAE
FT                   LVTAFVLGSAAALQQPVRD"
FT   gene            408607..409779
FT                   /locus_tag="Kfla_0401"
FT   CDS_pept        408607..409779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0401"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: vei:Veis_2517
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29525"
FT                   /db_xref="GOA:D2PUK7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB29525.1"
FT                   /translation="MVDFSLTEEEQAIRATTREFVRRELMPLENDVLRREREGLPGVEP
FT                   DVVQALRAKAKSFGFWGLSTPEQYGGMNLSAVDQALITSELGRTFVPFSFGGEADNILY
FT                   ECNEEQRKEYLLPTISGERRSCFAITEPGAGSDTRAIRTTARRDGDDWIIRGEKTFITG
FT                   GNEADFAIVIAVTDPEKGSKGGFTAFLVDRERGWTSDRIVTMGQAVPATLNFDDVRVPG
FT                   DHVLGEIGQGYELAMRWIMKGRFIIPARGIGACERLLELAIEHATSRETFGRPIADNQA
FT                   IQWMIADSEVEMEAARWLVLYAAWAVDQGRHPQHDSAIAKLYGTNTVNRIADRVLQIHG
FT                   GMGYTKELPIERWFREVRLWRIFEGTDEMQRLIISRGLLRGYRKPGAHFH"
FT   gene            complement(409832..410230)
FT                   /locus_tag="Kfla_0402"
FT   CDS_pept        complement(409832..410230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29526"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29526.1"
FT                   /translation="MEQATSQIPASPDAIRHALLDALSLPEWNEAFLSIDGPARPTVGT
FT                   PYALRVRPGFTGTLVYTVIEPDRVEMEWDVPGFHETGSWTLGPTGRVTHAFAQTGPLAT
FT                   VLRPAYRGIAAVRLDRLANRLAQLTRAA"
FT   gene            complement(410233..410700)
FT                   /locus_tag="Kfla_0403"
FT   CDS_pept        complement(410233..410700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0403"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; Penicillinase
FT                   repressor; SMART: regulatory protein MarR; KEGG:
FT                   afw:Anae109_4143 MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29527"
FT                   /db_xref="GOA:D2PUK9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUK9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB29527.1"
FT                   /translation="MKQAEELRYLVLAIQREGNRLLAADLRPLGITPSQAEVLRVLRDH
FT                   GPLTLSALGGLLVCETGSSPSRLVDRLVAQGLVRREIDEHDRRYLALSLTPRGRQLCRR
FT                   IVTAEDRLHRHLSALVADQHLDETISTLRAVAEAFPAGEALARRRDTVKEK"
FT   gene            410839..412452
FT                   /locus_tag="Kfla_0404"
FT   CDS_pept        410839..412452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0404"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   hypothetical protein; K00666 fatty-acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29528"
FT                   /db_xref="GOA:D2PUL0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB29528.1"
FT                   /translation="MQDFQLSLDTIFRRAEQFFPDKTVHTGGPAPTTTTYAEWAARTRR
FT                   LGGVLDTLGISADGRVGTFAWNSGRHLELYFAAPCTGRVLHTLNIRLFPDQVVYIANHA
FT                   EDEVIFVDRSLLGLFLPLLDRLPLVRHVVVMDDLPPGAAGVEIPADDRFHDYEQLLAAA
FT                   EPVEFHVENENQAAAMCYTSGTTGNPKGVVYSHRSTWLHSIGVLTNAGLGLHETDTVMP
FT                   VVPMFHANAWGLAHAAPMAGASLVFPGPDMSPQGILKLLTEQEVTLSAGVPTIWQGLLP
FT                   LLDGVELPKLRRIPCGGSAVPLALSEAFRQKLGKPILQAWGMTETSPVATASHVPMRDQ
FT                   GLPEDDQAKLRARQGLPLPGVEVRIVEPGSTTPLPWNDEATGELQVRGPWIAAEYYRLD
FT                   DDVRLNTEDGWMKTGDVAAIDQYGSVRLVDRTKDLVKSGGEWISSVELENLLMAHPAVK
FT                   EAAVIGVPHPKWDERPLACVVLQEGETVTGEEILAYLEPLVAKWWLPDAVEFIEEVPKT
FT                   SVGKFSKKDLRTRFAQYHLE"
FT   gene            412527..413402
FT                   /locus_tag="Kfla_0405"
FT   CDS_pept        412527..413402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0405"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: abo:ABO_0913
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29529"
FT                   /db_xref="GOA:D2PUL1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL1"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ADB29529.1"
FT                   /translation="MRGIILAGGSGTRLHPITMAASKQLLPVYDKPMIYYPLSTLMLAN
FT                   IREVLVITTPDDAPQFQRLLGDGSQFGMEITYAVQPSPDGLAQAFLIGESFIQDQPVAL
FT                   ALGDNIFYGPGLGVHLQTFNEVDGGVVFAYRVADPTAYGVVEFDAEGRALSIEEKPAEP
FT                   KSNYAVPGLYFYSSDVVEIAKQIKPSARGELEISSVNEVYLDAKRLQVEVLPRGTAWLD
FT                   TGTFDSLMAAGEFVRAVEMRQGQKIGCPEEIAWRRGFIDDAGLQARADTLAKSGYGAYL
FT                   LGLLDEERGF"
FT   gene            413937..415346
FT                   /locus_tag="Kfla_0406"
FT   CDS_pept        413937..415346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0406"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="SMART: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: plu:plu0734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29530"
FT                   /db_xref="GOA:D2PUL2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL2"
FT                   /inference="protein motif:SMART:SM00644"
FT                   /protein_id="ADB29530.1"
FT                   /translation="MAAITWLADVLRGAGLQVIEEGDWRRRAVAGSFAPIGVLWHHTAA
FT                   TSSPENPAPALATVIAGRPELEGPLCHALVDYNGVFHVIAAGRANHAGETRPSGPIPAG
FT                   DGNALLVGWEIDYDGQDQVMTPQQYTGSVRATAAVLRQLGRDASYARGHLETSTTGKID
FT                   PHGVDLDRMRADVAAQLAGGGTATAAFHARWTDGTWTPFRPLGMAVKDVAVAGTPDGRA
FT                   QVAVIGVDDVVYHRLRNSDGTWTEFGFLTGFGGPAKGRRVSIAGMEDGTSQVVITGTDG
FT                   ASYHSVRRTDGTWTPFGPLGMVAKDVAIAGMPDGLAQVAVIGTDDVVYHRVRDSDGTWT
FT                   KFGALAGFGGPAKGKSVSIAGLEDGTSQVVITGTDGASYHSVRRTDGTWTPFRPLGMVA
FT                   KDVAITGMPDGRAQVAVIGIDDVVYHRVRDSDGTWTKFEALAGFGGPAKGRAVSIAGSS
FT                   DRTSEVVINAV"
FT   gene            415518..418859
FT                   /locus_tag="Kfla_0407"
FT   CDS_pept        415518..418859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0407"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ade:Adeh_3637 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29531"
FT                   /db_xref="GOA:D2PUL3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL3"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADB29531.1"
FT                   /translation="MSVGGARVAVVEAPLALYRRYRPETFAEVIGQDHVTAPLRNALSN
FT                   NRVNHAYLFSGPRGCGKTTSARILARAINCEKGPIAQPCGVCKSCTDLARGGPGSIDVI
FT                   EIDAASHGGVDDARDLRERAFFAPVESRYKIYIIDEAHMVTTQGFNALLKLVEEPPPHL
FT                   KFIFATTEPDKVIGTIRSRTHHYPFRLVPPKVLGDYMATLCEAEGVAIAPAALPLVVRA
FT                   GAGSVRDSLSVLDQLIGGAGPEGVTYELAVALLGFTPDSLLDACVDGFAAHDSRAVFET
FT                   VEKVIETGQDPKRFAEDLLRRLRDLVILSAVPNAVASGLIEAAEDQGERLQTQAAGIGP
FT                   AELTRAADIVAAGLLEMRGATAPRLQLELICAKVLLPGADDSTNGIQARLDRMERRLTI
FT                   GVPAGTPEVAPAARVMPATDGAAGTPAGGSAGGSSAGGVGGSAGAAVAGGAGSAGAVGG
FT                   VGSAGGVGGAAGASGGGTGGSAGDAGAAAGSTGGAAGSTNGGRAASVASARAGAGGRAE
FT                   SGAAGGAVNPPVGGDNRSGAWPDESDSAGAGRAGGGQAAAGRVDGGQAGGAQADAGQAG
FT                   GGDAAPGQASSGQGGAGWSGAGAGQTGGQAGAGQAGAVGEPGGQSLAASAVAPAAAAPV
FT                   SSGAVGLADVRRLWPEVLEAVKTKRRFAWIMLSQNAQVIAIDDQTLTLGLVNAGARESF
FT                   ARSGSDEILRQAMIDTIGLNRRIEAVVDPSTDPGAGQGAAPPPAPPAAPSSSSWGSQAA
FT                   QGVAGGGAGGAQSGVGASGQPASGGSVGQAGAGAGGSAGQSGSGGLGGAAGHGGAAGPG
FT                   GAAGVGVSGGPGGRGGPGGEAGSGGASGVSGSGGASGVSGSGGATGGTGSGGPTGASGP
FT                   GGATGVSGSGGPGGVAGGNGSFGAGAAGGLAGDFGAGQAAAEPDWFAEGGPDWAQGPAG
FT                   SPSDESALAGGGASGAGASLTGGAAARAGAAGVDGGSRGTGAGRAGVADPVSGVDGLSS
FT                   PAGAGGATVNGGVQGPADGQGQPVAGVPLQGGQQAGGPPAPSAVPDQVDRRELAASKRR
FT                   AAEAAVAAEQARKAALATVTEAPLTPEEEAEAIGEDDIVLEEDSRSHTDLLRDTLGAQI
FT                   ITEEPN"
FT   gene            419484..419948
FT                   /locus_tag="Kfla_0408"
FT   CDS_pept        419484..419948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gme:Gmet_3421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29532"
FT                   /db_xref="GOA:D2PUL4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL4"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADB29532.1"
FT                   /translation="MFDGGGGQGGGFDMSELLAQAQAMQNQLMEAQANLENQEVEGTAG
FT                   GGLVTAMVSGTGELLSLTINPKAVDPDDTETLADLIVAAVRDASENAKEVAARAMGPLA
FT                   GGLGGGLPGLGGGPEALPGGAEGGQSGNQGPGLGFTRPGGQTGLPGQNPG"
FT   gene            419950..420549
FT                   /locus_tag="Kfla_0409"
FT   CDS_pept        419950..420549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0409"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: mxa:MXAN_1930 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29533"
FT                   /db_xref="GOA:D2PUL5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL5"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADB29533.1"
FT                   /translation="MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLSADETDVRRLAHV
FT                   LVQVKEKVKFCEICGNVAEETMCRICRDPRRDLALICVVEEAKDVVAIERTREFRGRYH
FT                   VLGGAISPIEGIGPDELRIRELMQRLASGEVTEIILATDPNLEGEATATYLSRLLRPMG
FT                   LRVTRLASGLPVGGDLEYADEVTLGRAFEGRRSIDD"
FT   gene            420542..421186
FT                   /locus_tag="Kfla_0410"
FT   CDS_pept        420542..421186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29534"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29534.1"
FT                   /translation="MTDSTDIADRALDTDNEDLTEFAEQIADQVQSFLISVRDIAAQPD
FT                   EDGVDEGLASLPYLLLEVSQLLLAGGRLGAFEDFVPEERFESDAGPDPDLDAMRDRLAV
FT                   LFEGLDEYAEVFDPYAAPPEITVNRLSDDLTAIATDLVHGLAHYQSGRILEALWWWQFS
FT                   YVSTWGAAASAVLRAIQSLIAHDRLEPAHDPETEASDRELVEVAEEVVQRR"
FT   gene            complement(421338..421733)
FT                   /locus_tag="Kfla_0411"
FT   CDS_pept        complement(421338..421733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0411"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; SMART: Ankyrin; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29535"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL7"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADB29535.1"
FT                   /translation="MGEELTESELAYLRSLFDRARNGETEELVTAIDAGVPVNLTTGTG
FT                   DSLLILAAYHDHPATVRALLDRGADTARVNDRGQTALAAAVFRRSTESVEALLAAGADP
FT                   ALGTRSALDVAQVFELPDMLELLTRAR"
FT   gene            421823..422275
FT                   /locus_tag="Kfla_0412"
FT   CDS_pept        421823..422275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0412"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: bbr:BB0215
FT                   ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29536"
FT                   /db_xref="GOA:D2PUL8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL8"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADB29536.1"
FT                   /translation="MSAPADLRLRGTGLRVTKPRMAVLEVLDEAQTGHDHLTVAVVADR
FT                   ARARLGTVSTQAVYDCLGALTTAGLVRRIEPAGHPALFETRVDDNHHHLVCRGCGLTTD
FT                   VDCVAGAAPCLEPSRRDGFLVDEAEVIFWGLCPDCTTVSDPSERPS"
FT   gene            422272..423933
FT                   /locus_tag="Kfla_0413"
FT   CDS_pept        422272..423933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0413"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: mpo:Mpop_3405
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29537"
FT                   /db_xref="GOA:D2PUL9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUL9"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADB29537.1"
FT                   /translation="MTTASSQQPEPGTERPVLTNRQGHPVYDNQNQRTVGARGPATLEN
FT                   YQFLEKISHFDRERIPERVVHARGATAFGYFEAYGTVGDQPASVFTRAKLFQEQGKRTD
FT                   LAIRFSTVAGGRDSSEVARDPRGFAVKFYTEDGNWDLVGNNLGVFFIRDAIKFPDFIHS
FT                   QKPDPVTFERQDPNRAFDFLSQTPEALHMVTLVFSPRGIPASYRHQQGFGVNTYKWVNA
FT                   QGETKLIKYHWMPLQGVKSLTAEDAANIQATDLGSHTRDLYDAIARGDYPEWELSVQLM
FT                   DDHEHPELDFDPLDDTKVWPEEQFPLLKVGKMVLNRAPENFFAENEQIAFGTGVLVDGL
FT                   DFSDDKMLVGRTFSYSDTQRYRVGPNYLQLPVNAPKKKVATNQRDGQMAYGVDLAEGQN
FT                   PHVNYEPSILGGLREAEYPAHDEQGPEIVGRLTRKRIPRTNDYKQAGERYLLSEQWERD
FT                   DLVANLVDALSQCDRAMQERMVWHFVMAEDELGVRVGDGLGITPADVSHLEPLPTQSLT
FT                   EEELTRMANLGKNGPRDVSGLTMTHCVPNERVVTER"
FT   gene            424045..424698
FT                   /locus_tag="Kfla_0414"
FT   CDS_pept        424045..424698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C6900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29538"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM0"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_C6900"
FT                   /protein_id="ADB29538.1"
FT                   /translation="MSVYELIARLPGIDAVRRTSRALAVLDAVLSPDPEYRYYSFDARW
FT                   SPTDEAALMRNGSGDEYSIVFSPDGAIAQGFDHESPMSPRQSPGGRTWPGLFIGVPDEL
FT                   APALDEPAFRDGDGNQSVTVCFWRTPADDRWLCGPVEGADKDGAERLFGLLAEGPEGYL
FT                   TFAEDHYEVALDLDAIRHVYALMPLTEYVVTSLNRERRLADLTEEIAEIGYPRS"
FT   gene            424745..425317
FT                   /locus_tag="Kfla_0415"
FT   CDS_pept        424745..425317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0415"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bur:Bcep18194_B2529 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29539"
FT                   /db_xref="GOA:D2PUM1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29539.1"
FT                   /translation="MARPRKFVEDAAIDAAMRAFWAHGYEGTSTQDLCEATGLGRSSIY
FT                   NTFASKHDLFEKALARYIELKTAAALELLAGDLPVREKVRTLLWWAVEPDEDNPIGCLV
FT                   VNATVELGPHDPAAADMLRRDQEVRLAALVAAIEAGRRAGEIAADKDAESLARFVVATI
FT                   SGMRVMARGGADRAALESIATTALSAL"
FT   gene            425350..426690
FT                   /locus_tag="Kfla_0416"
FT   CDS_pept        425350..426690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0416"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B2530 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29540"
FT                   /db_xref="GOA:D2PUM2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29540.1"
FT                   /translation="MPLAVYVLGLAIFAQGTSELMLAGLLPELSADLGVSIPDAGLLIS
FT                   AFAVGMLVGAPVLAVVTLRWPRRTALLTFLAIFALTHVVGALTPNYEVLFATRVVGAFV
FT                   YAGFWAVAAVTALNLVPADRRGRAMSVVAGGLTLATIVGLPAGTVVGQHLGWRAAFWGV
FT                   ALLSTAAMAGVLATIPGGKPATAPRIFDEVGAFANPRLWLAYSTTALSVGALIVSFSYF
FT                   APLLTEVTGLSAGWVPIVLALYGVGALIGITVGGRTSDRRPFGTLLVGLGGLVVLSVAL
FT                   ALWAGQPAAVVAVIVLLGVFGFATNPAVNTRVFRLAESAPTLAAAVNVSAFNVGITVAP
FT                   WLGGLAIEAGAGYRSLGWIGAAIGALALLTVVVAALQAARTPGADQPAGTPGAEQPAGT
FT                   PGAEQPAGSLRTDQPAAATRTDEPVSDRAGTAGEDNLCGVSRAASGQ"
FT   gene            complement(426665..427867)
FT                   /locus_tag="Kfla_0417"
FT   CDS_pept        complement(426665..427867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0417"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   mlo:mlr1877 DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29541"
FT                   /db_xref="GOA:D2PUM3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM3"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADB29541.1"
FT                   /translation="MFVSRPPAASILHADLDAFYASVEQRDDPRLRGRPVIVGGGVVLA
FT                   CSYEAKALGVRTAMNGGQALRHCPQAIVVPPRMSAYSEASKAVFRVFNDTTPLVEGLSI
FT                   DEAFLDVGGLRKIAGTPVDIARRLRADVLAKVGLPITVGVARTKFLAKVASGVAKPDGL
FT                   LVVPPDEELEFLHPLAVERLWGVGEVTAAKLRTRGLTTVGDVAMLPEAALVAMLGRASG
FT                   RHLHALAHNRDPRPIEVGKRRGSIGSQRALGRSPKSAETLDAVLAGLVDRVSRRMRSAG
FT                   RAGRTVTLRLRFDDFSRVTRSHTLPQATGQTRALLVTARALMAEARPLIEKQGVTLVGV
FT                   AVGNLENETTVQLALPFDKASNDELDSALDHVRDKFGNNAVTRGILLGRDQGITVPMLP
FT                   D"
FT   gene            427960..429174
FT                   /locus_tag="Kfla_0418"
FT   CDS_pept        427960..429174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0418"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_3030 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29542"
FT                   /db_xref="GOA:D2PUM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29542.1"
FT                   /translation="MRSMDLSAYRALWRTRGVASLLASALVARLPVMASMVPVSFLAKD
FT                   AAGSFGWAGVVAGAYSVGTAVGGPIWSRLADRRGGRWVVIGTGMAWSVAMVVLALLPGD
FT                   LYRAMPVVSAIAGAFVSPVTATLRAAWPRLVQGSRLRAVYALDATAQEVLFAIGPMLGA
FT                   LVVSFASPRAGVLSAAAVAMASIWWYGVQQQPAVKHDENVQRLTAPQLLWHRYRLPLIL
FT                   AFALCVTAFASVSLGIVAFADEHGNRLIAGVLESVWALGSLIGGVIVGALPGRRNSFVW
FT                   RRALLIAAGMLLCVFATSSPVTLGIGLLLSGCVLAPTVGALYERLGTMTPDSVRTEIFG
FT                   WMGSGAMIGGAVGSAVSGVVVESFGVRYVWVMAAGLALLAALAVLHVPPHRPADDPVVE
FT                   EVAVA"
FT   sig_peptide     427960..428064
FT                   /locus_tag="Kfla_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 35"
FT   gene            complement(429248..429658)
FT                   /locus_tag="Kfla_0419"
FT   CDS_pept        complement(429248..429658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0419"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: bur:Bcep18194_A5145 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29543"
FT                   /db_xref="GOA:D2PUM5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM5"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADB29543.1"
FT                   /translation="MMQEELTQAVTIGEASRISGLPVETLRYYDREGLFGDLPRDSGGR
FT                   RRFTPDALGLLDVLLRLRRTGMPVEQVREFAEHVRAGDRLRAGRLALLRAHRERVAADL
FT                   AQLEADLEVIDWKIAAYQAAEDGIDPPARDLN"
FT   gene            complement(429692..430231)
FT                   /locus_tag="Kfla_0420"
FT   CDS_pept        complement(429692..430231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0420"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: scl:sce6060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29544"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM6"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB29544.1"
FT                   /translation="MTELQELLDSTGRKITTEDGTYAVQLRRSYAADVHDVWSAWTTPA
FT                   RLSRWLGDLTGETGVDGTLQLTMSPPDQEVAVLHVETCEAPTRLRVRWTWPGEPDSAVE
FT                   LLLEPEADNTVLTLTHSLVGPDTAVDYGYGWEDFLNRLTELLAGRDPAAVSWVAAQAIL
FT                   KPRWSALLPRSGSPEA"
FT   gene            complement(430224..430574)
FT                   /locus_tag="Kfla_0421"
FT   CDS_pept        complement(430224..430574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0421"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: mxa:MXAN_5617 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29545"
FT                   /db_xref="GOA:D2PUM7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB29545.1"
FT                   /translation="MHAFDILGDPVRRRILELLADGQLPAGSIAATIGAEFGISQPAVS
FT                   QHLRVLRDNGFATVTVDGTRRLYAVDTAPLREIDQWLDRYRKFWTNRLDALDTELRRGR
FT                   RARATPLEETHD"
FT   gene            430846..432114
FT                   /locus_tag="Kfla_0422"
FT   CDS_pept        430846..432114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0422"
FT                   /product="aspartate kinase"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   aeh:Mlg_1480 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29546"
FT                   /db_xref="GOA:D2PUM8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM8"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADB29546.1"
FT                   /translation="MGRVVHKYGGSSVADADCIKRVAQRIVATKKAGNDVVVVISAMGD
FT                   TTDELMDLAQQVSPLPPPRELDMLLTSGERISAALLAMAIANLGYEARSFTGSQAGVIT
FT                   TSAHGNARIIDITPSRIEDALAEGHVAIVAGFQGVAQDTKDITTMGRGASDTTAVALAA
FT                   ALEADYCEIYTDVDGIFTADPRIVPAAQQIPKISYEEMLEMAACGAKVLHLRCVEYARR
FT                   YNVPVHVRSSFSQKEGTWVVDAKELNQMEQAIISGVVQDRNEAKITVVGVPDKPGEAAR
FT                   IFETVAGAETNIDMIVQNVSAVATNRTDISFTLPRADGARAMSALARMKDAVGYEQLLY
FT                   DDQIGKVSVVGVGMRSHPGVSAKFFSALADAGVNIEMISTSEIRISVVVDENLVDVAVT
FT                   AAHTAFDLDDEHTQAVVYGGTGR"
FT   gene            432111..433217
FT                   /locus_tag="Kfla_0423"
FT   CDS_pept        432111..433217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0423"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: ccs:CCNA_03599 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29547"
FT                   /db_xref="GOA:D2PUM9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUM9"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADB29547.1"
FT                   /translation="MTPVSAADPTTDDRAGLPTLAVVGATGAVGTVMLSLLSTRQNVWG
FT                   EIRLIASERSAGKRLKVRGEEVEVVAITEQAFDGVDVAMFDVPDEVSAHWAPIAAAKGA
FT                   VVVDNSGAFRMDPEVPLVVPEVNAEAARNRPKGIISNPNCTTLSMIVAMGALHHRYELE
FT                   QLVVASYQAASGAGQEGIDALYDQLMKVAGNRELGTTPGDVRRVIGNALGPFPAPLVMN
FT                   VVPWAGSLKDDGWSSEELKVRNESRKILNLPGLKVSATCVRVPVITTHSLSVHARFARE
FT                   VDVEEAREVLRDAPGVILFDNPAEGEFPTPADVVGTDPTWVGRLRKSLDDPQALELFVC
FT                   GDNLRKGAALNTAQIAEVVAKEFAAAAG"
FT   gene            complement(433293..434285)
FT                   /locus_tag="Kfla_0424"
FT   CDS_pept        complement(433293..434285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0424"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; KEGG:
FT                   bid:Bind_2976 LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29548"
FT                   /db_xref="GOA:D2PUN0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN0"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB29548.1"
FT                   /translation="MNSTDTERADHLRVLGLNDDEILVYQHLLRTGPSSVSELAAVVAG
FT                   RETGIDTTLGGLVQAGLARRSGSDHARFLPVPPDAGLEALTLRRESELKQARIEVLNAY
FT                   DEFRRTVHNESTTHLIEVVTGTAIVERINQIKGSAQREILAIDSPPYYLGAGPNQMEIE
FT                   QLNRGVAYRVVYSPESVEVPGYLTENILPCVEAGEQARVLPDVPAKLTIIDGSIAFVSM
FT                   SVRDTDVNRSLLIIRPSSLLTALIGMFELCWRNALPLHASVGAEDDRLEPIERRLLALL
FT                   ATGAADDTIARTLGISRRTFFRYLERLMNRTGASTRFQLALHAARENWL"
FT   gene            434684..435853
FT                   /locus_tag="Kfla_0425"
FT   CDS_pept        434684..435853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0425"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   Proprotein convertase P; SMART: peptidase S1 and S6
FT                   chymotrypsin/Hap; KEGG: hch:HCH_06949 secreted trypsin-like
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29549"
FT                   /db_xref="GOA:D2PUN1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN1"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADB29549.1"
FT                   /translation="MLLTRLIKSVGLCAMTAALVIVPAHSASASATSAHGEPGPRVVGG
FT                   TRAAQGEFPWMVRLSMGCGGAMYTSQLVLTAAHCVGSTGNNTSITATVGVVDLQDTSAT
FT                   KVRSTYVHRSPTYGTSTGGDWALIKLASPIAGVATLPIATTTAYDSGTFTVAGWGAATE
FT                   GGTQQRYLLKAQVPYVDDVTCRDAGPYYSDLIFAAELCAGRMATGGVDTCQGDSGGPMF
FT                   RRDNANAWIQVGIVSHGDGCARPSAPGVYTQVSTFAAAIAAAAANLGGGGGPACGPFTN
FT                   GTNVNIPDAGAAVTSSVTATGCTGSTSSAQVAVNIVHTFRGDLVIDLLAPDGSSYRLKG
FT                   TNPSDSADNVNTTYTATVGNEVRNGTWRLQVRDVARADVGYVNSWSLSL"
FT   sig_peptide     434684..434773
FT                   /locus_tag="Kfla_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.450 at
FT                   residue 30"
FT   gene            complement(435945..437885)
FT                   /locus_tag="Kfla_0426"
FT   CDS_pept        complement(435945..437885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0426"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   domain protein; KEGG: bpd:BURPS668_A2859
FT                   x-prolyl-dipeptidyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29550"
FT                   /db_xref="GOA:D2PUN2"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN2"
FT                   /inference="protein motif:PRIAM:3.4.14.11"
FT                   /protein_id="ADB29550.1"
FT                   /translation="MRRFPSSRAVRTGVALLATAALAPIASLTATAGPPAKPFVDGTRT
FT                   VAAYDYDNAVHERVEVEVPGVDGDANGVKDRVTVDIVRPGEAAQAGIDVPVIIQASPYY
FT                   AGDPKNYFDADGTRQVYGSWLDNYFVPRGYAVAFVDMPGTFRSTGCSDVGADLEVLGTK
FT                   AVIDWLNHRVPGHTPAGATAKADWSTGKAGMIGVSWNGTIANSVAGTGVRGLQTIVPIA
FT                   AISSWYDYTRGFGVPFYDEYMGFLHDYVSNDASPRCVQLTDEIEQDSDTRTGSYSKWWD
FT                   PRNYRLDASKVKASVYVVHGLGDENVKTRHFGEWWDELAQRGVPRKIFLHQGVHLDGFS
FT                   FRDEWVSKLHPWFDYWLQGLQNDVMLTPQATVQREDGSFVDEPRWPATGVRSTKLTLSK
FT                   PLNAKTGGLSIAAPTSNPVSFTGTSEPSADSVVLDPTAQRTDRAVFLSNDLERSVRMSG
FT                   TGKVTVRVKVNKVAAGIKARLVDYGTATRYRDVTNVPNTRVCWGDGNTLDTGCYARTQI
FT                   NTAVSDASIAVRTLADIGHYKSLNRKESLQSGKWYDLTFELNADDVVFAAGHRLGLVLT
FT                   VEPDNPSVPFTGATVTLDPARSSLTLPLTSTPDLATADTPQSRIPAASLAQPEPESDPE
FT                   ALMRQFVEASR"
FT   sig_peptide     complement(437787..437885)
FT                   /locus_tag="Kfla_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 33"
FT   gene            complement(438140..439015)
FT                   /locus_tag="Kfla_0427"
FT   CDS_pept        complement(438140..439015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_4451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29551"
FT                   /db_xref="GOA:D2PUN3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN3"
FT                   /inference="similar to AA sequence:KEGG:Mpop_4451"
FT                   /protein_id="ADB29551.1"
FT                   /translation="MSLPPRAVIVHRATELTELVARHGTRQQAGFFLKTRGRDLAELDA
FT                   RHQFQQQALATVSAAIPLDWRRAVAERADLDRFVFGPEDVVVAVGQDGLVANVAKYLDG
FT                   QPVIGVNPEPDRHPGVLVPHPPAAVAGLLRERHVEQRTMVAASTDDGQRLLALNEVYVG
FT                   HRTHQSARYRLASPEGLEERQSSSGLLVGTGTGSTGWCRSAWQERRSRLALPGPTDPAL
FT                   CWFVREAWPSPATGTSCTEGLLTATDHLTVTAEADLVVFGDGIESDSLTLTWGQQLQIT
FT                   VAETRLNLVR"
FT   gene            complement(439012..440007)
FT                   /locus_tag="Kfla_0428"
FT   CDS_pept        complement(439012..440007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0428"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: mpo:Mpop_4450 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29552"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN4"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADB29552.1"
FT                   /translation="MADITRFRFISHLRANPTTHVRHLRNGELAHEGAGQAFWFRALNS
FT                   ALSEVPIDDREQPLLFHGRTVDFQDVVVQATVTYRVTDPGLAATRLDFGIDPDTGRWRS
FT                   TPLEQLGGLLTELAQQTALDLLARMTLTQALSEGMASLRQAVGGGLRQDQRLTGLGIGV
FT                   EDVRVVAVRAESDVERALQTPTREMVQQAADKATYERRAMAVERERSIAENELQNQIEL
FT                   ARREEQLVLQKGQNERRRATEAAAAGRIETEAQAGRRRALSEAEADAKRVIGAAEASAE
FT                   KALLDAYAELDQATILALAIKQGALPEIGTLNLTPDLITPLLSKLTDGQA"
FT   gene            440134..440802
FT                   /locus_tag="Kfla_0429"
FT   CDS_pept        440134..440802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0429"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aeh:Mlg_0745 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29553"
FT                   /db_xref="GOA:D2PUN5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB29553.1"
FT                   /translation="MGVACDLVILTVRDGSFEVLLIRRGIAPHRGRWALPGGFVRPAED
FT                   LEQTARRELAEETGVDSDRIHLEQVATYGEPGRDPRGRVISVAYLALVPDLPVPVAGSD
FT                   AASASWIPVADVLADPGRLAFDHHRILADAVERARAKLEYSPLATAFCADEFTISELRG
FT                   VYEAVWGVALDPRNFHRKATRTEGFVEPVGATTTRDGGRPAQLFRRGAATTLHPPLTRA
FT                   "
FT   gene            440837..441529
FT                   /locus_tag="Kfla_0430"
FT   CDS_pept        440837..441529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0430"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pen:PSEEN0978 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29554"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29554.1"
FT                   /translation="MTFHVLVTGAGRDTGRLLALAFAAQGAHVIATARTPAAAEETVAL
FT                   IRANGGSATAAVLDLASPESIAALELDRLDVLVNSGARYLEGDASPADITDTIAGAATG
FT                   TVLLTERLLPLLRASKRADVVNLISAAGEPGRHRSSAHPAFYAAKHAQAGYAEILSARL
FT                   RPEGIRVISLFPPDFVQAGPRETGAELTAQSVVDCVLFAVHQPRDCFIRSLHFEQVVDT
FT                   RTTAKENH"
FT   gene            441569..442453
FT                   /locus_tag="Kfla_0431"
FT   CDS_pept        441569..442453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0431"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: avi:Avi_7367 transcriptional repressor
FT                   of RpiB expression; transcriptional repressor of ribose
FT                   catabolism (RpiR/YebK family)"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29555"
FT                   /db_xref="GOA:D2PUN7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN7"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADB29555.1"
FT                   /translation="MGEIETRIRGLVPTLTPAEQRVAEQVLADPLGTHRGTIGQLAERS
FT                   RTSLTTVTRFCRALGMAGYQELRFALATEAGEASSRDWTLGAAADIGPDDPMQSVLANL
FT                   VATDVRALQETASQLDLAVAEQLVDAITTARRVDLYAVSGSAAVTNDLQRRLHQLGITC
FT                   HLWIDVHDALASATLLGPEDVAIGISHSGETIEVIEPLTAARDAGAVTAAVTNFPRSAI
FT                   TSVAGLLLTTSAREATYRSGSLSGRHTQLLVIDCLVTGVAQRTSPASDAAVARTAAAVR
FT                   PHRVGRRTPTQEG"
FT   gene            442460..443449
FT                   /locus_tag="Kfla_0432"
FT   CDS_pept        442460..443449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0432"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: scl:sce2610
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29556"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB29556.1"
FT                   /translation="MDHVRLGRTGLQVSRLCLGTMTFGLQSDEQTSFAILDRAAEAGIT
FT                   FIDTADVYPMGGTLEYAGRTEVIVGRWLKGRRDEFVVATKGCSRTGPRPWQEGSSRKQL
FT                   TETLEDSLRRLGTDYVDLYQLHHPDPGTPIEETLSVLDDFVRAGKVRYVGCSNFQAYQV
FT                   ARALGHSETLRVAKFVSVQPRYNLLFRELERELLPLCAEEGLAVLPYNPLAGGMLSGKH
FT                   QDGEPTADTRFTVSTVRDMYRDRYWHRDVFATVNELRAVADELGLPLVTTALSWVMANP
FT                   VVTAPIIGASRPEQLDDNLRALDVELDTDTKKRLDEITYRYRLGDATR"
FT   gene            complement(443457..444202)
FT                   /pseudo
FT                   /locus_tag="Kfla_0433"
FT   gene            444301..444990
FT                   /locus_tag="Kfla_0434"
FT   CDS_pept        444301..444990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29557"
FT                   /db_xref="GOA:D2PUN9"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29557.1"
FT                   /translation="MKWLGPVLEVLLGFALFFGWMAFLGWLLLKLFGPWLERSKARLAR
FT                   DQAGAERYGWTPGTDADGLLASAGRVTSGHDGSVRRVLVGDYQGRPIRMAEFVYSVRSR
FT                   YLPTTYVRHLVAVELPVRLPDLMVRRQAIGEPGRRTFDAESGAFNRQYDVSGPDDRYVS
FT                   AVMHPRMMEWLLAHPGLELCIHGNLVLAFADTPWTVPTTLRALPVLDGVADRIPRFVLS
FT                   DYGLTAQ"
FT   gene            445085..446338
FT                   /locus_tag="Kfla_0435"
FT   CDS_pept        445085..446338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0435"
FT                   /product="Platelet-activating factor acetylhydrolase
FT                   plasma/intracellular isoform II"
FT                   /note="PFAM: Platelet-activating factor acetylhydrolase
FT                   plasma/intracellular isoform II; KEGG: PAF acetylhydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29558"
FT                   /db_xref="GOA:D2PUP0"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP0"
FT                   /inference="protein motif:PFAM:PF03403"
FT                   /protein_id="ADB29558.1"
FT                   /translation="MLSRRLLLTGTAATLLPAAPATASARNATGGALAGSRSPVRLRFP
FT                   RPTGPFPVGTTELHLVDAGRDDPFVPGRPRELMISIWYPAARAGADRAPYLPPLTAQVY
FT                   AEGAAIALQQPLGTVDWAGARHHAGLLAPVSRSWGRRPVILFSPGFGVPRGLASVMVAE
FT                   LAGRGYVVVTVDHTYEAAAVEFPGGRVALQTLPPKPYALLARQTRLTDVRRVLDALTDL
FT                   AHGRNPDAGQRRLPAGLGAVLDLSRVGAFGHSAGGITSADVMLADRRVRAGINLDGTLG
FT                   YGYPSPCDSPTVARGTDRPFLLVGAGGTGPDGGPQTHRTDPSWGLFWERSTGWKRDLNV
FT                   PAGGHYTFIDHQVLIPWFQRFFTVPPELVATTVGTVDAERILRSLRTYLPGFFDQHLRG
FT                   RPGSWRDSPRHPDVRFIA"
FT   sig_peptide     445085..445156
FT                   /locus_tag="Kfla_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.509 at
FT                   residue 24"
FT   gene            complement(446328..446957)
FT                   /locus_tag="Kfla_0436"
FT   CDS_pept        complement(446328..446957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0436"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: psa:PST_3219 probable CoA transferase, subunit
FT                   B; TIGRFAM: 3-oxoacid CoA-transferase, B subunit; PFAM:
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29559"
FT                   /db_xref="GOA:D2PUP1"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP1"
FT                   /inference="protein motif:TFAM:TIGR02428"
FT                   /protein_id="ADB29559.1"
FT                   /translation="MPLTREQMAARAAAELEDGSYVNLGIGLPTLVPNYIPAGVTVVLQ
FT                   SENGILGVGPYPVEGEEDPDLINAGKETVTTLPGASFFDSALSFGMIRGGAIDAAILGA
FT                   MQVSATGDLANWMIPGKMVKGMGGAMDLVHGAKKVIVLMEHVAKDGSHKIVEECDLPYT
FT                   GRGVVNRIITDLAVLDVTDDGLRLVELAEGVTFDELQSRTGAPIKQ"
FT   gene            complement(446959..447747)
FT                   /locus_tag="Kfla_0437"
FT   CDS_pept        complement(446959..447747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0437"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: hypothetical protein; K01028 3-oxoacid CoA-
FT                   transferase subunit A; TIGRFAM: 3-oxoacid CoA-transferase,
FT                   A subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29560"
FT                   /db_xref="GOA:D2PUP2"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP2"
FT                   /inference="protein motif:TFAM:TIGR02429"
FT                   /protein_id="ADB29560.1"
FT                   /translation="MDKTYDSPQAAVDDIGDGASLAVGGFGLCGNPMQLISALHAKGVT
FT                   GLRVVSNNCGVDDWGLGILLADQRIAKMTSSYVGENKEFARQFLSGELEVELTPQGTLA
FT                   EKLRAGGCGIAAFFTPAGVGTQVAEGGLPQKYNTDGSVAKASEPKETREINGTTYVLEE
FT                   SITTDFGLVHALKGDTHGNLVFDRSARNFNPLAAMAGRITIAQVEQLVQPGELDPDQIH
FT                   LPGVYVQRVVAVGKDIEKRIEKRTVQPREAYQAQREKLEA"
FT   gene            complement(447860..448924)
FT                   /locus_tag="Kfla_0438"
FT   CDS_pept        complement(447860..448924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29561"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29561.1"
FT                   /translation="MSDVEFRGGGYDEDLSYLIHLVDDPELRGADPLRLAPSADQGPGG
FT                   ASGTRSAAEGDQVVAAIERACESDPRMALRLVAGLSSYWWSRGLQDEASAAAERVLAML
FT                   GRTVPPGLEEEYLLAVLHGASSAEQEQLELAQQVVLSAVGPFKHPVTVLLWALVFGPFE
FT                   SSATVSTVLARHERDGDAWTRAAVELCKGYPGLIDIAPGDAEQSLRIALARFRMLEDRW
FT                   AMFLALTALRQITSDLMPVLDEAVELADELGLEEEAGLLLCQRADLRLREGELDAARRD
FT                   YGQALDVGERSDLLETVAAARIGLARVARHAGDLACAREHLSAVLTGCPEELDDAREEA
FT                   LHELGVLRAAEASA"
FT   gene            complement(448959..449657)
FT                   /locus_tag="Kfla_0439"
FT   CDS_pept        complement(448959..449657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29562"
FT                   /db_xref="GOA:D2PUP4"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP4"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_9393"
FT                   /protein_id="ADB29562.1"
FT                   /translation="MPDLPRYKAHRTTTPPPIDGTLTHPAWADVAWTSDFVDIRGDRPA
FT                   PPLRTRAKLLYDDEYLYLGAQLEEPHVWSTMAERNTLLFEENNFELFLDPDGDRQNYYE
FT                   FEINPLGTIWELTLPKPYADGGVAVDPTNLPGLRTAVHVDGTLNDPADTDAGWTVEAAF
FT                   PWAELAQFNQGVAPPRPGDEWRMNLMRVEWSHDVVDSAYRKTEQQDFWVWAPQYAVDMH
FT                   RPEHWGVLEF"
FT   gene            complement(449650..450144)
FT                   /locus_tag="Kfla_0440"
FT   CDS_pept        complement(449650..450144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29563"
FT                   /db_xref="GOA:D2PUP5"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29563.1"
FT                   /translation="MGDADDEVTRPMPADPEEMLEQADEAAAERADEGRFDAPPLPPLL
FT                   VLAVVGLLAGFVTIGMVWLSERGCEQFRDTSNCGAWGFPLLVLTVVVTIVLGSLTLSRL
FT                   AMPHPRLVAFLGVTFMLLVVLAFLSDHLFTTWTLLVVPALTAVTFLLAHLIAGLLERAD
FT                   A"
FT   gene            complement(450166..450804)
FT                   /locus_tag="Kfla_0441"
FT   CDS_pept        complement(450166..450804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0441"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.181"
FT                   /note="KEGG: pst:PSPTO_4819 lipoyltransferase; TIGRFAM:
FT                   lipoate-protein ligase B; PFAM: biotin/lipoate A/B protein
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29564"
FT                   /db_xref="GOA:D2PUP6"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP6"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ADB29564.1"
FT                   /translation="MSALQRVDLGEVEYEVAAKDMTTWVEQRIEGSAGDRLFLLSHPPV
FT                   ITYGPRTSLADLPAETAAIPSVAVDRGGFATYHGPGQLVGYLVIDLNQRGPVDIVRWVE
FT                   NGLIAGLGELGFPLVRRETPRGASSLVGVWTEDHRKLCSIGMRIRRGVTSHGFSINVDP
FT                   AMHVFHTFTTCGLHDVTMVSLAELAAERGLPAPPDAAVRDAVATALGAT"
FT   gene            complement(450883..450956)
FT                   /locus_tag="Kfla_R0010"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(450883..450956)
FT                   /locus_tag="Kfla_R0010"
FT                   /product="tRNA-Pro"
FT   gene            complement(451003..451938)
FT                   /locus_tag="Kfla_0442"
FT   CDS_pept        complement(451003..451938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0442"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pca:Pcar_0763
FT                   phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29565"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADB29565.1"
FT                   /translation="MSFRGLATTTLKTAGVLGAVGAACVGYAAAIEARWFTLRRFTVPV
FT                   LPPGADPLRVLHVSDLHLMPSQEKKIRWVNELAELEPDLVVNTGDNISSPHSVLPLLRA
FT                   YGALLDLPGVFVFGSNDYWKPHFKNPVNYLLPPQKQRHKPHGPDLPFDEMRASFTDAGW
FT                   TDLNNAKATLKVNGLRLDFAGTDDPHIKRDRYAEVAGEVDPAADLSIGVTHAPYQRVLN
FT                   AFVADGYPLILAGHTHGGQLAVPLYGALVTNCDLDTSRVKGLSTWGHDGRQAALHVSAG
FT                   LGTSPYAPVRFACRPEATLLTLVPRIRASE"
FT   sig_peptide     complement(451846..451938)
FT                   /locus_tag="Kfla_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.677 at
FT                   residue 31"
FT   gene            451965..452432
FT                   /locus_tag="Kfla_0443"
FT   CDS_pept        451965..452432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0443"
FT                   /product="YqeY family protein"
FT                   /note="KEGG: gsu:GSU3092 YqeY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29566"
FT                   /db_xref="GOA:D2PUP8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP8"
FT                   /inference="similar to AA sequence:KEGG:GSU3092"
FT                   /protein_id="ADB29566.1"
FT                   /translation="MSNSELKQRLHDDMTAALKARDEIRKSTLRMALTAVTKAEVAGKE
FT                   ARELSDAEVLDVLTSEAKKRRESVTAYREAGRTELADKEQAEADILAEYLPEQLTAEQI
FT                   AALVTETIAATGAAELGPRGIGKVMGALQPKVKGKADGGAVSTEVKRQLGA"
FT   gene            complement(452541..454949)
FT                   /locus_tag="Kfla_0444"
FT   CDS_pept        complement(452541..454949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0444"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; SMART: PASTA domain
FT                   containing protein; KEGG: met:M446_6778 1A family
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29567"
FT                   /db_xref="GOA:D2PUP9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUP9"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ADB29567.1"
FT                   /translation="MRVREKNDRGVVQSVVLFLGVSALSGALAAGLAIPFVGLADYSTD
FT                   KTHETLQDLPQELKTAPLAVKSKIVAADGTLIANLFEQNRNLVRLDQINPIMRKAIIAI
FT                   EDDRFYEHGAMDAKGTLRAMLRNQSEGSVQQGGSSITQQYVKLSLIAKAKTPEEYQRAT
FT                   ASTYQRKIAELRYAVAVEKQFSKDEILEKYLNLANFGDGAYGVEAAARHYFSTTAAKLT
FT                   LPQAALLAGLVKNPRGYDPTNNAARAKDRRDLVLRRMQELSIITAKQANDAIRTPVYDP
FT                   KKVQRVPNGCAASKYPFYCEYVVSKLLDNPALGKDEKARAHYIKTAGITVKTSLDLKAQ
FT                   RAAEAAIKERTKRSDTAVAAVTMVQPGTGLVKAMAQSRPYGQDKSKRETSYNYNVEKTY
FT                   AGGYGGFQIGSTMKAFTIAAAIQKGIPLNYRINSPAQMSMGHLKFTTCTGTTRDPKYNP
FT                   RNSTAAKGDLTMIQAAQASTNTYFLQLSQRVGLCSIATLAAKLGLRDAQNGQPLQQVIS
FT                   MTLGIDNVSPLMLSNAYATFAARGKYCKPLVVTSITSLGGKPISTPGVECNQALEPSVA
FT                   DGVNRVLHEVMEPPGTGQALKFGNSDLAGKTGTIQFNKAVWYAGYSSRLAAAAVVADAD
FT                   LPYTDLMRGHTLDGEDIRDASGSGTAGPIWKIAMQKALAGTPPTRFAAPTDKTVRGDVK
FT                   DLPFVNGMNVQDATNRLQQAGFQVTVSPEQVRSTEAAGTVAYTSPRQRDGAPEGSMVTL
FT                   HISRGNGEQPPVPPNSPAPPNPPTTGAPPSIPQCPPWHPKYPNCGGPRR"
FT   sig_peptide     complement(454860..454949)
FT                   /locus_tag="Kfla_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.782 at
FT                   residue 30"
FT   gene            complement(455230..457584)
FT                   /locus_tag="Kfla_0445"
FT   CDS_pept        complement(455230..457584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0445"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: afw:Anae109_2098 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: AAA ATPase
FT                   central domain protein; peptidase S16 lon domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29568"
FT                   /db_xref="GOA:D2PUQ0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ0"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ADB29568.1"
FT                   /translation="MTETLNLPVLPLDDVVVLPGMVVPVRLADTEARAAIDAAQASGQD
FT                   QVLLVPRLDGKYAKAGTLGEIEQIGRLPGGAQAAVIRGTARVLIGAGTTGPGAALWVGA
FT                   TVLNEITDAQSAELAREYKTLITSVLERRGAWQVIDSVRQVNAPAELSDLAGYASYLSD
FT                   AQKLELLENANVTERLTKLIGWVKDHLAELEVSESIQKDVQEGMEKQQREFLLRQQLAA
FT                   VRKELAELDGSTASEEEDYRARVEAADLPEHVRKAALTEVDKLERTAEQSPEVGWIRTW
FT                   LDTVLEMPWNERTEDSYDIREARAVLDADHAGLDDVKERITEYLAVRRRRADRGLGVVG
FT                   GRRSGAVLALVGPPGVGKTSLGESVARAMGRKFVRVALGGVRDEAEIRGHRRTYVGALP
FT                   GRIVRAITEAGSMNPVVLLDEIDKVGADYRGDPTAALLEVLDPAQNHTFRDHYLEVELD
FT                   LSDVVFLATANVLDSIPAPLLDRMELVQLDGYTEDEKVVIARDHLLPRQLERAGLSAEE
FT                   VSVEDSALRLLAGEYTREAGVRQLERSISRVLRKVTAKLALGEDLGGSVTIAAENLKGY
FT                   LGSPKFTPESAERTALPGVATGLAVTGAGGDVLFVEASLADKETGATGVTLTGQLGDVM
FT                   KESAQIALSYLRSHGAELGLPVGDLAERNAHIHVPAGAVPKDGPSAGVTMTTALASLLS
FT                   GRPVRSEVAMTGEVSLTGRVLPIGGVKQKLLAAHRAGLTTILIPKRNEPDLEDVPASVL
FT                   AELTVHPVSDVREVLDLALVPAQVDAHQYAA"
FT   gene            complement(457670..458674)
FT                   /locus_tag="Kfla_0446"
FT   CDS_pept        complement(457670..458674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpp:plpp0103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29569"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29569.1"
FT                   /translation="MTAPVRPPQVWATASWRAEAVDWIHERLAAAGESVTGPVSEPRLM
FT                   PWSATMRVPTSTGTVWFKANGSGTAYEPRLLSALRDWASSRWTTDVVAVDDRRAWSLTL
FT                   DGGEPLKHRLAVDGDLRWWEGALAEHAELQRALMPHADELLALGVPDLRPSVQPGRLGE
FT                   VLARPDELLPGRPGGLTTAQYSALRGLAAEHNRWCAELTAGGIAPSLQHDDLHDDNVLL
FT                   GRSGEYRFFDWGDASVSHPFGVLVGVLDNVGRDRRFTSAQVGRLRDVYLEPWTAEYDRA
FT                   HLVADCDLALRVARTGRVLNWHRLLTPLRSAERIEYAETLADWLAESLAPPSP"
FT   gene            complement(458679..459800)
FT                   /locus_tag="Kfla_0447"
FT   CDS_pept        complement(458679..459800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0447"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   ank:AnaeK_0987 adventurous gliding motility protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29570"
FT                   /db_xref="GOA:D2PUQ2"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ2"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ADB29570.1"
FT                   /translation="MTALDLDALIDDPATRIVVTCGSGGVGKTTTAAALGLRAAERGRK
FT                   VVVLTIDPARRLAQSLGLTELDNTPRAVKDVDGANGGSLDAMMLDMKRTFDEVVLAHAT
FT                   PEKAEQILANPFYVALSSSFAGTQEYMAMEKLGQLHKQAERTGEWDLIVVDTPPSRSAL
FT                   DFLDAPERLASLLEGRFLRLLLAPARGPLRLMSAGVNLAMSVMNKVLGAQVLTDVQTFA
FT                   AAFDTLFGGFRERAEKTVALLREPHTAFLVVAAPQNDALREASYFTERLREERMPLAGV
FT                   VLNRMTTTHAPELSAERSLAAAEKLAEAGKSELTTAVLRLHADRMQQVVGDTKRADRFR
FT                   RGHRSIPTVDVPALADDVHDLSGLRRIGDLLTA"
FT   gene            complement(459797..460732)
FT                   /locus_tag="Kfla_0448"
FT   CDS_pept        complement(459797..460732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0448"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   afw:Anae109_0972 chromosome partitioning-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29571"
FT                   /db_xref="GOA:D2PUQ3"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ3"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ADB29571.1"
FT                   /translation="MVTGKGGTGKTTVAAAMALSLADQGKRVLLVEVEGRQGLAQLFDV
FT                   PPLPYVERRIAVGPAGGEVFGLAVDAEAALLEYLDMYYHLGRAGKALDKVGAVDFVTTI
FT                   APGLRDVLLTGKVYEATRRKAHGRLAYDAVVLDAPPTGRIGPFLNVNHEVAGLAKVGPI
FT                   RNQADAIMGMLRSDVTRVHLVTLLEEMPVQETLDAVEQLEALDLRIGSIVVNMVRRSPL
FT                   DDEMLALAVKEKLPAAELTRGLKAAGITATKEMVGTLAAEARDHAVRVGLERENRDRID
FT                   ALGKKVTELGLLPDGIDHGALFDLAEELRP"
FT   gene            460842..461003
FT                   /locus_tag="Kfla_0449"
FT   CDS_pept        460842..461003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29572"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29572.1"
FT                   /translation="MKKFEYFTAPLLVHSTKEILDNFGQDGWELVQVVPGLNPENLVAY
FT                   FKREITES"
FT   gene            461000..461461
FT                   /locus_tag="Kfla_0450"
FT   CDS_pept        461000..461461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0450"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: oan:Oant_2027
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29573"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ5"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADB29573.1"
FT                   /translation="MSHPEENLAELGLKLPEVAKPVAAYVTALRTGNLVYTSGQLPLRE
FT                   GTLIATGKVGAEVTPEVAAECAQQCALNALAAVKAEIGDLAQVKRVVKAAAFIASTPDF
FT                   TGQAQVANGASELFGQVFGEAGQHARSAVGVPVLPLDAPVEVELIVEVA"
FT   gene            461801..462619
FT                   /locus_tag="Kfla_0451"
FT   CDS_pept        461801..462619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0451"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpd:RPD_3111 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29574"
FT                   /db_xref="GOA:D2PUQ6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB29574.1"
FT                   /translation="MALSSTLLSGRMAAEALAHVRERRTPVEPRPASTVILLRDGDGGP
FT                   EVYLLRRQRSMAFAAGMTVFPGGRVDPTDSTIVDSWSGPPPEWFGQRLGCDAETAAAYV
FT                   AAAVRETFEESGVLLAGPSAETVVGDTTDADWEADRVALESRELGFADFLHRRGLVLRA
FT                   DLLGPWAHWITPEYEPKRYDTRFFVAALPAGQVTRDVTSESDQVAWLRPADAVAAVDAG
FT                   EMLMLPPTYLCCRDLTAYGSVAEALAADREIRPILPTVRVDGDQAYLETR"
FT   gene            462616..463404
FT                   /locus_tag="Kfla_0452"
FT   CDS_pept        462616..463404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0452"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pzu:PHZ_c2735 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29575"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB29575.1"
FT                   /translation="MTAEQLTPYAARVLAPNPGPMTLDGTNTWILRAPESDRAVVVDPG
FT                   PLLPDHLQAVLDAVAAAGCTVETVLLTHHHLDHSEGAAWFANRASCPVRSVDPGFRIPT
FT                   DHAHGLAEGDVIAAGDLRIEVLPTPGHTLDSVCFWLPQDGSLLTGDTVLGRGTSVVAHP
FT                   DGALGPYLTSLEHLRAFANSPAGVARLLPGHGPVIDDPTAVLTFYLTHRRERLDQVRAA
FT                   LAAGHTTPEAVVEHVYADVDPSLRPAAERSVRAQLNYLRG"
FT   gene            463711..464637
FT                   /locus_tag="Kfla_0453"
FT   CDS_pept        463711..464637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29576"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29576.1"
FT                   /translation="MAGGQGGVFSRRQALACGYSLQEIQARLTDGRWERIRYGQYAAAV
FT                   DLGGMPPWERDVVRHRRLVHAAVNSMRLGSVAVSHQSALVLHGAPRWGLDLSEAQLTRL
FT                   DDLRSGPTAGVRHHRGGLTPADLTEVSGLTVTTPARALTETACATSFEAAVVAADAICR
FT                   SHPEVDLHLQRLLVVTEFWPGSTTARAALNFRNPLAESVGESRLRVVMHDHGLPPPTLQ
FT                   VPFEDVGGFIGRVDFFVSSMRTVIEFDGLTKYADGSAEILVQEKIREDRLRALGLEVVR
FT                   VTWPELTQPARVVARIHQAFARAVRAA"
FT   gene            complement(464952..465629)
FT                   /locus_tag="Kfla_0454"
FT   CDS_pept        complement(464952..465629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0454"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bbt:BBta_5745 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29577"
FT                   /db_xref="GOA:D2PUQ9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUQ9"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADB29577.1"
FT                   /translation="MDAAVLRQAPLFSQLDDEAADALAASMTENRLRRGQVLFHEGDSG
FT                   DRLFVVVEGKVKLGRTSADGRENLIAVLGPGQMFGELSLFDPGPRSATVTAVTDASMMS
FT                   LTHDELLRWLAGRPEVARGLLLQLASRLRKVSDVVADLVFSDVPGRVAKALLDLASRFG
FT                   RTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWVRLEPRSVVLLDVERLQR
FT                   RAR"
FT   gene            466250..467038
FT                   /locus_tag="Kfla_0455"
FT   CDS_pept        466250..467038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0455"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: scl:sce3915 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein; SMART:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29578"
FT                   /db_xref="GOA:D2PUR0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR0"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADB29578.1"
FT                   /translation="MPTQHVADPNPHPVPPPVLDPPVKLPRKAPVYADETPTQLVRRAR
FT                   KMHKVLTETYPDAHCELDFSSPLELLVATILSAQTTDVTVNKVTPTLFAKYPTAQAYAE
FT                   ADRDEMEAILKPTGFFRAKTNSLLKLGQALVDEYDGQVPGKLEELVKLPGTGRKTANVV
FT                   LGNAFGIPGITVDTHFGRLVRRFGWTTEEDPVKVEHLIGALFPKKDWTMLSHRLIFHGR
FT                   RRCHAKKPACGACPLAQWCPSFGTGPTDPVLAAKLVKVPA"
FT   gene            467113..467667
FT                   /locus_tag="Kfla_0456"
FT   CDS_pept        467113..467667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0456"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mpt:Mpe_A1221 peroxiredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29579"
FT                   /db_xref="GOA:D2PUR1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR1"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADB29579.1"
FT                   /translation="MGCAPEASREGEGGETPQSPDSSRTVAGAEKLADCPSTPSRPPVS
FT                   DGLPDVSLPCLGNGPDIRLADLRGPLLVNVWAQWCGPCRDEAPYLADLQQKSGGKVQLI
FT                   GIDYADPRPEKAIEFAVEHGLVYPHLADTDKQVRQPLRVGGPPLTAFVDKAGKVVHVHR
FT                   GVFKSQQELDQLVRTKLGVTW"
FT   gene            467664..468431
FT                   /locus_tag="Kfla_0457"
FT   CDS_pept        467664..468431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0457"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pnu:Pnuc_0521 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29580"
FT                   /db_xref="GOA:D2PUR2"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB29580.1"
FT                   /translation="MRTSTSFDVELPGWLHPLATASKTVDPKELSRFLPPDDPAVRQSA
FT                   VLILLADGNEDGPDVLLTERSWTLRSHAGQMAFPGGRSDEEDGTGVDGLVRTALREAEE
FT                   ETGLDPSGVEVFAVWPALWVPVSNFGVSPVLAWWRQPSPVAVVDPAEVASVHRVALSAL
FT                   ADPANRVSCLHPSGFTGPAFLIDDLFIWGFTAGLLDKLLLLGGWVRDWDPAHVVPLPDR
FT                   LVEAAWRSEGQRSGEVRRLTAIEHDLGRPEGVE"
FT   gene            468428..469600
FT                   /locus_tag="Kfla_0458"
FT   CDS_pept        468428..469600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0458"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: mxa:MXAN_4330 periplasmic serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29581"
FT                   /db_xref="GOA:D2PUR3"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR3"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ADB29581.1"
FT                   /translation="MSGLDWALVAVTVLVAISGYVEGFVLGACATVGLLAGAAVGVYGV
FT                   PRVLDNFSPSVEVSFAALVLVVLLASIGRTIGALLGSKLRNKISVKPVKAVDALGGAAL
FT                   AAVSVLVVSWVLGVAVSGARIPSVTSAVRGSEVLARVDEALPSGADRALQAFNDVVNTD
FT                   LFPRFLDPFVPERIRETQPPDGAISRTPAVRNAYTRIAKVTGVANCSRGLEGSGFVYAP
FT                   QRVMTNAHVVAGVSSPKVEVNGRSYDATVVLFDPAVDVAVLYVPKLAIEPLRFDDSGKA
FT                   DAAAVVLGYPENGPFNSEPARIRSEERLRGPDIYGDRTVTRRAFSIWASVRPGNSGGPL
FT                   LSSRGTVYGVVFAASVEDNRTGYVLTAGQVAADAAEGARATREVSTRTCT"
FT   gene            469683..470183
FT                   /locus_tag="Kfla_0459"
FT   CDS_pept        469683..470183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0459"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: bam:Bamb_3917 RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29582"
FT                   /db_xref="GOA:D2PUR4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR4"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADB29582.1"
FT                   /translation="MTSEVSQSFDQVVGSSERRLLRVALMLSGSAHTAEDLVQSVFARA
FT                   HRRWSRIGALEHPEAYLRTMVVNEFLSWRRRLKNRELPTAELTETPTTEDIGARQAQRD
FT                   AAWRLLATLPRRQRAVLVLRYYEDLPDDEIAAVLNCTASTVRSNAARGLASLRAELPAD
FT                   EEC"
FT   gene            470185..470931
FT                   /locus_tag="Kfla_0460"
FT   CDS_pept        470185..470931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet3553 DNA polymerase III subunits gamma
FT                   and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29583"
FT                   /db_xref="GOA:D2PUR5"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29583.1"
FT                   /translation="MNGPHSNGKTDEELAALLRETFAERESQADQLPAATSSAPNADPG
FT                   RARRRLSPVVLAAAAVALVLGAVIIVRQAAEPPSAVPLPAASSTPEAGGPATPSAGTAS
FT                   TPAPTTDEVRIWAATIKGILEREPGTAPGAPVYVLDAPHQGAGGGKPVRGEPFTPAQQD
FT                   AIAAALRPGVTLKWIAQRPAADDPCGPDAGGPYVMVGPIVRKDGHAEVGVNIWRGCLAA
FT                   RWLTFRLDQNATDWRITGTVGPEAVA"
FT   gene            complement(470928..471872)
FT                   /locus_tag="Kfla_0461"
FT   CDS_pept        complement(470928..471872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0461"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ank:AnaeK_0555 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29584"
FT                   /db_xref="GOA:D2PUR6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB29584.1"
FT                   /translation="MSPAGVSDLLVDGPWSHSLVAANGARFHVAECGTADAPLVLFLHG
FT                   FPEFWWAWRHQLPVVAAAGYRAVAMDLRGYGASDKTPRGYDPFTVSADVSGVIRSLGAS
FT                   DAVVVGHGWGGFVAWSAAVLAPRQVRAVAAVAAPHPLMLLTSGQLRAAVQMGWFQLPIL
FT                   PERRLLAHDGIHIEQLLRAWSAAGGDFPDAEASRRYRAALQVWPAPHCALEYHRWFVRS
FT                   RLRSDGRRYSTRMREPIGVPVLQIHGGLDGAVAPAASVTPAQYVTGPLRYELLTTVGHF
FT                   PHEEAPEQFNQLLLDWLPGVSPTTPLATEGDTP"
FT   gene            complement(471869..472276)
FT                   /locus_tag="Kfla_0462"
FT   CDS_pept        complement(471869..472276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0462"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   rsq:Rsph17025_1891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29585"
FT                   /db_xref="GOA:D2PUR7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR7"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ADB29585.1"
FT                   /translation="MGSTGQDQDEPTVGQLVANASRDLSSLVRSEIELGKAELKKTAVA
FT                   AGTGAGMFGGAAFLGLLAIILLSIAAAYGVSALGIHPALAFVIVAVLYLVIAAVLVLVG
FT                   KNQLGKAKGPQRAIETSKESVEALRAIGKGD"
FT   gene            complement(472408..473622)
FT                   /locus_tag="Kfla_0463"
FT   CDS_pept        complement(472408..473622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0463"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   mlo:mlr5309 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29586"
FT                   /db_xref="GOA:D2PUR8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D2PUR8"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ADB29586.1"
FT                   /translation="MPPTVRARRRRAFPRVLGSERAFLADTLRAETTGGLLLLGAAVIA
FT                   LIWANSPWQDAYHHLREAPLGPLTVEAWAADGALALFFYLAGVELKRELVVGTLSKLGE
FT                   AVVPVVAAIAGMVLPAMIYLLVNLTADGGRTSGWAVPTATDIAFALAVLAIVGSSLPGA
FT                   LRAFLLTLAVVDDFGAILVIAVFFSHGFHLFALLAALALVGVYYLLQRFRFRTPLLYVP
FT                   VALGAWWFMHESGIHATIAGVALGLATRVVADPGEKHAPAERIEHRLRPWSAGLAVPLF
FT                   ALFAAGVTLSGDAVREMLTDPVAIGIVAGLIAGKFLGVFGGAWLTARFTRAELNSDLAW
FT                   RDVGAVSVLAGIGFTVALLIAQLAFGDDVAQTERAKAAVLIGSLLAALIAAGLLFRRNR
FT                   VYADD"
FT   gene            473927..474373
FT                   /locus_tag="Kfla_0464"
FT   CDS_pept        473927..474373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0464"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: dal:Dalk_1651 CBS domain
FT                   containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29587"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="PDB:4NOC"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT0"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADB29587.1"
FT                   /translation="MHGEQMAEQFPVVGLDSDAREAVELLASRRLPGLIVVDEKGSPHS
FT                   VLPASQVVRFLVPSYVQDDPSLARVIDESLADQVADKLAGVTVRKLLPSQPAELPVVKH
FT                   DDTVLEVAAIMARLRCPLVAVVKNKEIIGAITASRLLELVVSPH"
FT   gene            474462..475751
FT                   /locus_tag="Kfla_0465"
FT   CDS_pept        474462..475751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0465"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; sodium/sulphate
FT                   symporter; Arsenical pump membrane protein; KEGG:
FT                   dps:DP2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29588"
FT                   /db_xref="GOA:D2PVT1"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT1"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADB29588.1"
FT                   /translation="MTIIAVVVFVVAYVLIATEWTHKLLAALGGAAVLLALGVTDSEHA
FT                   FYSHETGVDWDVIFLLLGMMVIVGILRRTGVFEYIAIWAAKRAKGSPLRVMLLLTMITA
FT                   VASAFLDNVTTVLLIAPVTLLVCDRLGINPVPFLIAEVMASNIGGAATLIGDPPNIIIA
FT                   SRSGLTFNDFLVHMAPLVLIVLVVFCLVVPWLFRGSFEVDPDKVENVMRLNEREAIEDR
FT                   TLLIKCGLVLLGVFAGFIGHSVLHVEPSVVALLGAGVLVLISGVATKDYMSSVEWQTLL
FT                   FFAGLFIMVGALVKTGVIGDLAQQVQALTEGRALLAVMLILGVSAVLSGIVDNIPYVAT
FT                   MSPVVLELTKGIPDPVQAEALWWALAIGADFGGNATAVGASANVVVIGLALRAGHPISF
FT                   WEFTRKGVVMTAITILIAAPYLWLRYFVLA"
FT   gene            475813..476484
FT                   /locus_tag="Kfla_0466"
FT   CDS_pept        475813..476484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0466"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tmz:Tmz1t_1153
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29589"
FT                   /db_xref="GOA:D2PVT2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041484"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29589.1"
FT                   /translation="MRSTEPSRGSAEAASVERIRDAAIVRFGRDGFSAGLRVIAADAGV
FT                   TAGLVVHHFGSKGGLRQACDEHVLSVIRAEKLKAATTGSAAGMIAQLAEVEQFAPMALY
FT                   AVRSLQTGGRLATEFVEQMVRDAEQYLAAGVEAGVIKPSRDPAARARYLAYQSLGSLLL
FT                   WATIRSDALTGDFAAALRELSDEVTPPALELFTQGLFVDRSMLDDYLMYVPDPPVGPAA
FT                   P"
FT   gene            476567..477475
FT                   /locus_tag="Kfla_0467"
FT   CDS_pept        476567..477475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0467"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bpr:GBP346_A2187 copper ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29590"
FT                   /db_xref="GOA:D2PVT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29590.1"
FT                   /translation="MTAALEIRQLHKSFGQVKALDGLDLVVQPGQVAGFLGPNGAGKST
FT                   TIRILLGLLRADAGTVEVLGLHPWNDAVELHRRLAYVPGDVSLWPSLTGGEAIDLLCRL
FT                   RGGADPARKEALLERFELDPTKKGRTYSKGNRQKVALVAALAADVELLVLDEPTSGLDP
FT                   LMETVFQDCIAEVKAAGRSVLLSSHILAEVEKLCDTVTIIRAGQAVQSGTLAELRHLTR
FT                   TSFTATVAGGAEVLAALPGIHDLRQGNGELRFDVDHEHLAAAVQALGTLGVRSLTSAPP
FT                   SLEQLFLRQYGERLVPEEVGS"
FT   gene            477472..479082
FT                   /locus_tag="Kfla_0468"
FT   CDS_pept        477472..479082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0468"
FT                   /product="Putative exporter of polyketide antibiotics-like
FT                   protein"
FT                   /note="KEGG: ade:Adeh_0890 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29591"
FT                   /db_xref="GOA:D2PVT4"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT4"
FT                   /inference="protein motif:COG:COG3559"
FT                   /protein_id="ADB29591.1"
FT                   /translation="MTGPRDSLTGTGHLIRLALRRDRVKLPIWVLAIGLGMQYAVSALG
FT                   TVYSTPQERQVRAELMESPAATMMSGPGYGLNDYTLGAMISNEMVLWLAIPAAMMSIFL
FT                   VIRHTRSEEETGRAELVRSAVVGRHAAPVAALVLAVAANAGIALLTALALIGGDLAAAD
FT                   AFAVGLGLGLTGLVFAGVATVTAQLTEHARSASSMAMAVLGAAFLVRAIGDAAGPGGSL
FT                   LSWFSPLAWVQQQRPFVDLRWWPLLLPLVLVAAMTALAYALSARRDVGAGLLRARLGRP
FT                   TAPRSLSSPFGLAVRQQRTSVIGWAIGLLVFAVPTGSLSDSVTEAALENPDMAEVFTAN
FT                   GQEPTDGFYATMAMFFALLIAAFAVTSVLRLRSEERTGHAEAALATAVSRRQWVSAWLG
FT                   VTVLSSVVLLVVSGLGVGLGALSGDAPTGVVGEVLLATLAFFPPVLVVVGLAAALFGLR
FT                   AGLAMWAWALVGYAFLFGMFGALLDLPAVFTELSPFSHLTVMPLDRIGALPLVTLSAVA
FT                   AVLVLAGGLLFRRRDLDLR"
FT   gene            complement(479115..480062)
FT                   /locus_tag="Kfla_0469"
FT   CDS_pept        complement(479115..480062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0469"
FT                   /product="Glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mno:Mnod_0157 glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29592"
FT                   /db_xref="GOA:D2PVT5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT5"
FT                   /inference="protein motif:PRIAM:2.5.1.18"
FT                   /protein_id="ADB29592.1"
FT                   /translation="MTRAQFAKESAATGEWKRQGNRFTGRISAASASAPGEGPDEQGRW
FT                   PVEPGRYRLVVCLACPWAHRSVIVRKLLGLEDAISLAVVDPIRDEKGWRFTLDPDGRDP
FT                   VLGLRYLSEAYLATDPQYDGRVTVPAIVDTVSGLVVTNDYPQITLDLSTEWKDFHRPDA
FT                   PQLIPADRAELDQLIDEIYQDVNNGVYRCGFATTQEAYEAAYDALFGQLDVLEQRLADR
FT                   DYLLGDSLSEVDIRLFTTLVRFDAVYHGHFKTNRQKLTEFPNLWAYARRLYQSPGFGET
FT                   VDFDQIKRHYYVTHDTINPTGIVPKGPDPTIWQS"
FT   gene            480211..480972
FT                   /locus_tag="Kfla_0470"
FT   CDS_pept        480211..480972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0470"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bur:Bcep18194_C7245 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29593"
FT                   /db_xref="GOA:D2PVT6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT6"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADB29593.1"
FT                   /translation="MARPRNNPGDLAELPSELRTDRPKGDQIREILERLTRSLPAGTVL
FT                   PSERVLAERFGVARMTVRQEVDRVVADGLADRRPGGGTFVAEPRPSRLLASSFSQDMRT
FT                   RGLTPGAKVLEHRAGTADEALAAELEEPVGTPVLHLVRLRTADGEPMAIERTALSLRRY
FT                   PGLDTLDFADLSLYDELAARWGVSLGMVNASIVAAPPASTEDADLLGIDRTTPCLVITS
FT                   APRTAAGDVIEFGRSTYRSDRYDITVAYRTT"
FT   gene            complement(480993..481436)
FT                   /locus_tag="Kfla_0471"
FT   CDS_pept        complement(480993..481436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpd:RPD_1107 putative membrane protein
FT                   involved in export of O-antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29594"
FT                   /db_xref="GOA:D2PVT7"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29594.1"
FT                   /translation="MITALIVVLHAGLAAAWVGGMAYSLFVVQPKLTRFFGADRETREA
FT                   LTATIASGNRWKVLGLIAAIGASGLVLLILSTDQWALHLTKAVLLLAATAIFWYVSWRH
FT                   WPRRIFATSTELPALQARLRLLATAMLGLTGTAFALGVVATRL"
FT   gene            complement(481495..483474)
FT                   /locus_tag="Kfla_0472"
FT   CDS_pept        complement(481495..483474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0472"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: noc:Noc_0873 acetyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29595"
FT                   /db_xref="GOA:D2PVT8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT8"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADB29595.1"
FT                   /translation="MTSSESPHSEALSNLMHEERRFEPPAELAAHANVQADAYDTAAAD
FT                   LEGFWAAQAKRLTWAVEPTETLDWSNPPFAKWYADGKLNAAYNCVDRHVENGLGDKVAY
FT                   YFEGEPGDTREITYAQLKDEVSQAANALQELGVQAGDVVAIYMPMIPETVVAMLACARI
FT                   GAPHTVIFGGFSADALKGRILDCDARVVITSDGGYRRGAPAALKPAVDAALADCPDVRN
FT                   VLVVQRTGQETAMVEGRDLWWQDFVGQQSTEHTPEAFDAEHPLYVMYTSGSTGKPKGIL
FT                   HTTGGYLVGTAYTQWAVFDLKPDTDVYWTAADIGWVTGHSYIVYGALANATTSVLYEGT
FT                   PDTPHQGRWWEIVQKYKVSILYCAPTAIRTFMKWGKEIPEKFDLSSLRVIGSVGEPINP
FT                   EAYIWYRENIGGNQAPVVDTWWQTETGMHMISPLPGVTAGKPGAAMRAIPGVSVDVVDD
FT                   AGTPVPNGSGGYLVITKPWPAMLRTLWGDDQRFKDTYWSRFPGMYFAGDGAKKDEDGDL
FT                   WLLGRVDDVMNVSGHRLSTTEIESALVSHPKVAEAAVVGASDPTTGQAIAAFVILRSEA
FT                   GDGGPDVVQELRTHVAKEIGPIAKPRQIMVVAELPKTRSGKIMRRLLRDVAENREVGDV
FT                   TTLADSTVMDLIKSNLESGKTDED"
FT   variation       482376..482377
FT                   /locus_tag="Kfla_0472"
FT                   /replace="ggg"
FT                   /note="SNP"
FT   gene            483690..483989
FT                   /locus_tag="Kfla_0473"
FT   CDS_pept        483690..483989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29596"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29596.1"
FT                   /translation="MHQQYAAHPQYAETYPQQPVEPQYAEAYLQQPPAQPQYAAQPVAQ
FT                   PPYAAPQPADGPQAAAHPLAGPQRRISRAARRRVHARERRIRRSRRGLPQPATW"
FT   gene            complement(484208..484570)
FT                   /locus_tag="Kfla_0474"
FT   CDS_pept        complement(484208..484570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0474"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   xfm:Xfasm12_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29597"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU0"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADB29597.1"
FT                   /translation="MEPLRADMFDEICPSTLNPFRFGRDKWAGLVLTCLEDGPRRFSEL
FT                   RVPLHRVTPKVLTQSLRLLEQDGLINRTEYAVPVRRVVYELTPLGRSMLEPIRAACQWT
FT                   ADHWDELLDAREANSN"
FT   gene            484653..485267
FT                   /locus_tag="Kfla_0475"
FT   CDS_pept        484653..485267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azc:AZC_0422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29598"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU1"
FT                   /inference="similar to AA sequence:KEGG:AZC_0422"
FT                   /protein_id="ADB29598.1"
FT                   /translation="MSRVLVFGAGGRAGRAAVEEAVRRGHQVTAAVRTPGKYADLPATV
FT                   VAADVTDAAAVERLAADHDAVVAAVYDGGSDPTEFFPRAGRALADGVGTGRLVWVGLAS
FT                   ILAAESGVPLMDTPGYPQEYRAFFLAHQAAADLFAESKADWVSIAPAGDFDHENPARTG
FT                   AYRLAPAAADSRISYADLAIALLDEIDEPRHHGVLLGVERA"
FT   gene            485324..485806
FT                   /locus_tag="Kfla_0476"
FT   CDS_pept        485324..485806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0476"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: mxa:MXAN_2966 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29599"
FT                   /db_xref="GOA:D2PVU2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB29599.1"
FT                   /translation="MAAWLDIEQPELRAAGYGEVIVLDEKAVHLTLAMHRIVRHLRRTA
FT                   VTSALHPTQFIALLVIADEQPVRIGAIAARVPCSQPTATTTVGSLEAAGLVRRLPDTLD
FT                   GRATVVELTEHGTDMVAHVRSDATEALSNMLAVLTPEDRAVVLDAGEILYRLADDL"
FT   gene            complement(485808..486740)
FT                   /locus_tag="Kfla_0477"
FT   CDS_pept        complement(485808..486740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0477"
FT                   /product="superoxide dismutase"
FT                   /note="KEGG: aav:Aave_4523 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29600"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU3"
FT                   /inference="similar to AA sequence:KEGG:Aave_4523"
FT                   /protein_id="ADB29600.1"
FT                   /translation="MRIRTLTVLLTVAATLTVTSQPAIAHPARPRPHTYVVSTTPGDTP
FT                   EGIEVTRGGTIYVTSVGTGAVYRGSVRDPQLKPWLPAGSDGRTSATGVHVDRWGRVLIA
FT                   GASTSQLFLYDVRGRLLTARTAQPGSFLNDFTIAGDFVYVTDSAHNQIWRAPLTRHGLG
FT                   ELEPWLTRDRIQPIPYFLNGIVTDGRTLLVGEQGQDVTYRIDLRTRDVRTLEVTGANGV
FT                   LSGDGYLLEGRRLYAVHNAGGGKYVTRLALLDATLSRAAVVADSQPGAPGATPTTIARD
FT                   GARLLWVNSQLDAAPGTPPYTVSVVRGLR"
FT   sig_peptide     complement(486663..486740)
FT                   /locus_tag="Kfla_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            486839..487825
FT                   /locus_tag="Kfla_0478"
FT   CDS_pept        486839..487825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0478"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29601"
FT                   /db_xref="GOA:D2PVU4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU4"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADB29601.1"
FT                   /translation="MIRIHFTAADLGRVVFPAEPEPLWEAALAARALGDRAIPPAARRW
FT                   RRQAGPLVRPSMRPLFKLIAPAGQFPDFLTPEVPAPGLDPAVEVLAGTPADEVRDQLGP
FT                   WLPAEPEPFMRGLLLGRAGSRRALGIAVRDFHQQVLAPSAAELERRYGADLALRSRAVL
FT                   QGGVDAMLGSLHPDITWARPVLTSYGLGSGSSFDIHLEGRGLQLYPSALTAECLALDAP
FT                   GRRPVLVYPCSDLPLDDVAATDALGDLLGRTRAAVLRSLTASASTTQLARRCGISLASV
FT                   SDHTRVLRAAGLVVTHRSAGAALHSLTPVAHRLLAGEHVVPAVRRTR"
FT   gene            488155..488622
FT                   /locus_tag="Kfla_0479"
FT   CDS_pept        488155..488622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29602"
FT                   /db_xref="GOA:D2PVU5"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29602.1"
FT                   /translation="MFFAGSFTFDQGPDGELATATAEVVRYDDGPGGFGERRLVVRFPV
FT                   GDSVITTKVRAEDRGEESHVPPVGGHQQVEYLISDPRRARPAGAAQAAESDAHGMRILS
FT                   YGCLFLAVVTAAAYVLARRRRAAAERLMSEVIVAVRSCWQDRCSASDDAGS"
FT   gene            488636..489076
FT                   /pseudo
FT                   /locus_tag="Kfla_0480"
FT   gene            complement(489260..489772)
FT                   /locus_tag="Kfla_0481"
FT   CDS_pept        complement(489260..489772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29603"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29603.1"
FT                   /translation="MPIHVFVDETKSKGLLMAAAQCRSGDVTVSRKALRGLLLPGQERL
FT                   HFNHETDARRKQILDVIAEFRILVDIYAAERESLGARRRCLQAIVRDATAATERLVIER
FT                   DESTYDHDKRTLHAACNQYRRFDLRWELMVPKLDPLLWIPDAVAWAWARGGAWRRSVAS
FT                   YCQQQEL"
FT   gene            complement(489918..493529)
FT                   /locus_tag="Kfla_0482"
FT   CDS_pept        complement(489918..493529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0482"
FT                   /product="APHP domain protein"
FT                   /note="PFAM: APHP domain protein; Fibronectin type III
FT                   domain protein; coagulation factor 5/8 type domain protein;
FT                   SMART: coagulation factor 5/8 type domain protein; Parallel
FT                   beta-helix repeat; KEGG: dac:Daci_5804 cell surface
FT                   receptor IPT/TIG domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29604"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033801"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU7"
FT                   /inference="protein motif:PFAM:PF07705"
FT                   /protein_id="ADB29604.1"
FT                   /translation="MRTRSGTWRLLATVLASSLLLSTGPVLGAVSGPAGAGTTAAAAAL
FT                   AGPNLAAGKSATASTSTQNYAASNATDGNQGSYWESANNAFPQWIQVDLGASVSTNQVV
FT                   LKLPTAGWGSRNQTLAVQGSTDGQNFTDLSPSASRAFTAPSNTVTIDYGAATVRYVRLR
FT                   ITANTGWPAGQLSELEVYGPAAGDTQAPTAPGNLAFTEPGAGQIRLSWTASTDNVGVTG
FT                   YDLYANGQLRTSLGAGVTTYTDSQPASASVTYFVRAKDAAGNQSPNSNSVTRGGSSGAG
FT                   SNLALRKPITASGHVHTFVPANANDDNVTTYWEGNGTPATLTTELGSNADVSSVVVRLN
FT                   PDSAWGNRTQTFSVLGREQSAAGFSTIVASAAYTFSPASGNTVTIPVSARVADVRLNFT
FT                   GNTGAPSGQVAEFQVMGVPAPNPDLTLNGVSWTPASPVETDTITLRATVNNLGSAGSGA
FT                   TGVNFYLGATRVGTATVGAIAAGASTTVTATIGSRDAGSYPLSAKVDEAGTVVEQNDGN
FT                   NSASSASPLVVTPVASSDLVAAAVSWSPGNPTAGNNVTFSVSIRNQGSIASAAGAHGIT
FT                   LTLLSGSTVVRTLTGSYSGAIAAGATTPAVTLGSWPAANGRYSVRVVVADDANELPVKR
FT                   GNNTSERPFFVGRGANMPYDQLEAEDAAVGGGAQVVGPNRTVGDLAGEASGRRAVTLTG
FT                   TGAFVEFTTRASTNTLVTRFSIPDAPGGGGISSSINVYVNGTFHKTLPLTSKYAWLYGP
FT                   EASPNNSPGSGPARHIYDEANLMLDGTFPAGTRIKLQKDPANSSPAAIDFVNTEQVAPI
FT                   GNPGAGFVTPAGFSQQDVQNALDRVRQDGTLQGVYLPPGEYPTSNKFTVYGKAVKVVGA
FT                   GPWYTRFVAPANQSNTDVGFDAQASANGSTFSGFAYFGNYDSRNDGPGKVFNFAGTSNM
FT                   TIDNIWVEHQMCLYWGANTDNSTIRNSRIRNLFADGINMTNGSSGNTVSNNDARATGDD
FT                   SFALFNATDNGGGEVRDNVFENLTSTLTWRAAGFAVYGGTNNVFRNLYVADTLVYSGIT
FT                   ISSLDFGIPMNGFGATPPTRFENVSVVRAGGHFWGAQTFPGIWIYSATKVFQGIRLTDV
FT                   DIVDPTYSGIMFQTDYVGGSPLFPVADTVLTNVTISGARKSGDAFDAKSGYGIWANELP
FT                   EPGEGPARGTATFNNLTLTNNAVDIRNTTSTFTIIRN"
FT   sig_peptide     complement(493443..493529)
FT                   /locus_tag="Kfla_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.602 at
FT                   residue 29"
FT   gene            complement(493727..495391)
FT                   /locus_tag="Kfla_0483"
FT   CDS_pept        complement(493727..495391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0483"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: dvm:DvMF_0315 SSS sodium
FT                   solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29605"
FT                   /db_xref="GOA:D2PVU8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU8"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ADB29605.1"
FT                   /translation="MNSLLTPGLVPGLIPLADAEPGNQALTISLFTAVVAVTLYITWWA
FT                   SRQNKTAADYYAGGRSFSGAQNGLAVAGDYMSAASFLGISGQIALYGYDGFLYSIGFLV
FT                   AWLVALLLVAELLRNSGRFTMADQLAFRMKQRPVRTAAATSTIVVSIFYLLAQMVGAGS
FT                   LVGLLLGVTDSTVKAGVIVLVGALMIVYVTIGGMRGTTWVQIVKAVLLMTGTVLITFLV
FT                   LLKFDFNLSKLLGAAADNSGKGDAFLQPGLLYGKDLVGQIDFLSLGLALVLGTAGLPHI
FT                   LIRFYTVPDSRSARRSVQWAIGLIGAFYLMTLALGFGAAALLDTGKDSAVAVSKGNVAS
FT                   PLLAEVVGGGAGSTGGAILLALIAAVAFATILAVVAGLTLASASSFAHDLYANVLAKGR
FT                   VTEKDELRVARFAAIGIGAVAIGLAIPAQKLNIAFLVALAFAVAASANLPALLFNLFWK
FT                   RFNTTGATWSIYGGLTSAVVLVIFSPVVSGSPTSMITGADFSWFPLSNPGIVSIPLGFL
FT                   LGVVGTLVGKDRSSEDRYQELSVRALTGAGAEGAAKH"
FT   sig_peptide     complement(495332..495391)
FT                   /locus_tag="Kfla_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.644) with cleavage site probability 0.635 at
FT                   residue 20"
FT   gene            complement(495388..495729)
FT                   /locus_tag="Kfla_0484"
FT   CDS_pept        complement(495388..495729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0484"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   gme:Gmet_3287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29606"
FT                   /db_xref="GOA:D2PVU9"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVU9"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ADB29606.1"
FT                   /translation="MEDDGVRERDARAYETVHEAADFTELKRRYRNFVVPWTVAFMVWY
FT                   LAYVACNNWARGFMSQQVVGNINVALVFGLLQFVSTFAIAAVYGRFANRKLDPLASGLN
FT                   AKYKRERRR"
FT   gene            complement(495821..496621)
FT                   /locus_tag="Kfla_0485"
FT   CDS_pept        complement(495821..496621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0485"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mrd:Mrad2831_5097 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29607"
FT                   /db_xref="GOA:D2PVV0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29607.1"
FT                   /translation="MTTDDRGSERARSFGAVAAAYDAGRPTFPAEALRWLLGPGRLQIL
FT                   DLGAGTGKLSAVAAALGHDVVAVDPAEEMLAVCRQVPGVDTMVGAAESIPLAHGSVDAV
FT                   LVGQAFHWFDHARALPEIARVLRPHGVLGLLWNKYDTVVPWVRRLHRAMIGEDFLAGSD
FT                   QFDPMPVLLQSDLFAQVETGRFRHWHDLDRGSLRQLALSHSRVAVLTESRRESVLEQVD
FT                   AIYDGTARPPEPLRMPYFTDCYRTRPSDLANYQRTLDAPVAPPL"
FT   gene            complement(496672..497403)
FT                   /locus_tag="Kfla_0486"
FT   CDS_pept        complement(496672..497403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0486"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   nha:Nham_1201 acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29608"
FT                   /db_xref="GOA:D2PVV1"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV1"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ADB29608.1"
FT                   /translation="MKIGIITQARATSTRLPAKVLLTAGGKTFLQHHLDRLAATGLPVI
FT                   VATTTNTDDEPIVEQSGAAGFPVWRGSELDVLSRFAGAIREHGLDGVVRVTSDCPLIDP
FT                   AVVTEGVDRFRADAAENLYVSNCLERTYPRGMDYEIFSADRLLRADAEATLPADREHVT
FT                   SYLHQNRTGDMRLLNLPWDGGDASQYRLTLDTQDDRRLLTTLIEDFGAAQLNCADLVAI
FT                   MGKHPELHALNEHVEQKKLGQ"
FT   gene            complement(497400..498236)
FT                   /locus_tag="Kfla_0487"
FT   CDS_pept        complement(497400..498236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29609"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29609.1"
FT                   /translation="MHHANHFYGHAHVLAKYAGLGPGQPPSIWGYLQHGWNILDGFAYN
FT                   TAFVAGMPKFVWSDTVRRRGWSMGLRNYVVMGAAWLYLLELHPELAKPATDAAGTIFYP
FT                   FHGWEGQNVLGDHAEIVASIKDHETGPITVCLYWNEYGNEAIRRVYTEAGFRVITHGYR
FT                   GLNWRNTDADFLLKQLQELRRHRRVASNRLSSAVLYGASIGLQPGVYGDPMLLENEHPS
FT                   FGGQARIKRLWPEMNQPYVPLELARQFTDAELGVEHVAGPAEIRDMFRWNSTKVAS"
FT   gene            complement(498236..499657)
FT                   /locus_tag="Kfla_0488"
FT   CDS_pept        complement(498236..499657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0030 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29610.1"
FT                   /translation="MIAGEMLNWSDLHPSDGRPATSGPVPAELLAAVLRPTDSVLVAGP
FT                   HSLELLEQVAKTAASVDVLTRSAPDAEEIAEAFGVRVFCGSLDHFGPEHGKPAYDVVVA
FT                   LDGLPRLVGPDTLVMSWTDALGVLKGRLAPEGRLLLAAENSFGIERLVQPDPTVTVPRD
FT                   EDWPRDLAGDTAPPSGLKAVKAALDAAELPVTKTYAIYPTLAEASVALTEVEGALPAAV
FT                   VARAVAGRFSGPTLTDPYRTTQDAVAAGLGSELAAGWYFVVGDAADAPEVLPAGVVPDG
FT                   PGVLLEEQLFAALRIDDQAALRRTVQAYVTWLRAQPADVAAVAAPDNVIADGTAYRVFG
FT                   DGVAVNGRGDALVVAQLGRFVRRALEAGARAPWTAGSTPRDVTSRLASTTGLVVTDELW
FT                   ASVAENNEMIRPQGSAEQLATIARLAQELSEASTQATWFEGQLKGIRMSKPYRVGMAVL
FT                   NPARVVVKRVRRVVR"
FT   gene            complement(499869..500852)
FT                   /locus_tag="Kfla_0489"
FT   CDS_pept        complement(499869..500852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0489"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; dTDP-4-dehydrorhamnose reductase;
FT                   NAD-dependent epimerase/dehydratase; KEGG: aeh:Mlg_2322
FT                   polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29611"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV4"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ADB29611.1"
FT                   /translation="MSILTGSDILVTGGTGSFGKAFIRYTLDNLDPRRIIIFSRDELKQ
FT                   WEVRQLFGDDPRLRFFIGDIRDRARLNRAMHNVDYVVHAAALKQVDTAEYNPWEFVQTN
FT                   VVGSQNVIEASIDSGVKKVVALSTDKASSPINLYGATKLTADKLFITGNHYAAAYDTRF
FT                   CVVRYGNVMGSRGSIIPKFRALHEAGQSLPITDLRCTRFLITLPEAVQFVVDSFEQMQG
FT                   GELYVPRIPSMKITDLAQAIAPGAKMHDMGLRPGEKLHEEMISPEEGRRALAIGDRYVL
FT                   QPDLATWGYTPPEGGHPVPDGFHYTSDNNDQWYTTDEITKILESDV"
FT   gene            complement(500966..501688)
FT                   /locus_tag="Kfla_0490"
FT   CDS_pept        complement(500966..501688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0490"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: reh:H16_A0727 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29612"
FT                   /db_xref="GOA:D2PVV5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29612.1"
FT                   /translation="MEAAEIRKLADLEDKHWWYRERRAVLARALDSLAKAGAKPGRALD
FT                   IGAAGGGNTRVLRSRGWNATALEYGAEGAAVAHGRNIPVIRGDAVALPLADEAMDLVVA
FT                   YDVLEHIEDDKSASNEIARVLRPGGVALIAVPVDMALWSEHDTAVGHVRRYDREGLLST
FT                   LTSAGLQIEHVRSWNVLLRPVAAWRRKKSTGSDLTDLSPVVNLGLTAVIAAERYLPVGK
FT                   LPGVSVLVRARRPLRTVR"
FT   gene            complement(501768..504035)
FT                   /locus_tag="Kfla_0491"
FT   CDS_pept        complement(501768..504035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29613"
FT                   /db_xref="GOA:D2PVV6"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29613.1"
FT                   /translation="MAETAEPSVAAIQRTHGPARLTRLLPWLLPLVGAVGGLLAIDVPL
FT                   GDIVRYAAYFGGCVILPGILLLRAAWRSTGNWGEDVGLGAAVGMAYQLLGWAIFTAVGL
FT                   QAWLLAWPLLLIAVFAAVPQLRPYWRITRPEPLPVAWSWGMAICATLLVVYVSLAVMAD
FT                   HKPPPDGTSYYQDLLYHLSMVHELIRSVPPELPQVAGERLEYHWFANADMAGAADVTGL
FT                   SPVMVMFRLWLLPQAVVSLLVCAALARQVSKVWWTGVLAAVAVLPAGLASLLSPSHTFS
FT                   IATSTAAAIFLVDALFHRSGRRGVWILGAALAVVAGGSKPSTLPILLGGVGLAALFLLL
FT                   RDRKLPWRLVAAGLVLLLALAGTLRFVAGSTSGSGMQLLAILKFDAFYRAITGDLSVPG
FT                   TGGFLPVPLTSGDSTVVTGVGVMLGLTLLSYAGLLIGFGLLVVRSTRRQPAAWMLAGSL
FT                   TAAWLGLLLLNHPAASQQYFLRGVVPFATAATCWLVAVAFEGRGRRTILPVGVAAAALG
FT                   VVFQQLIRRPALDPARSRAEQVETLARPLVTVAVLIVLVIAGWFLTRRIWARRPGAGLA
FT                   VPVLIVIMASLAGMARYSYYAFRTDGTYRAAGGVVRPDEQAAARWLTENTAPTDVVVTG
FT                   SWCRPGPRRPGCDARGWLVSGLAGRRTLVEGWAYTQQALATNGTDGKLYAVQPSPWPDR
FT                   VELSTQILTAPTPQLLENARQYGARWIYADSSDGPVSPSLDQLARLRYQEGKVRIYELP
FT                   AQ"
FT   gene            504219..506492
FT                   /locus_tag="Kfla_0492"
FT   CDS_pept        504219..506492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_0505 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29614"
FT                   /db_xref="GOA:D2PVV7"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29614.1"
FT                   /translation="MNRHGPSVVVPWLVPLTVSVTGLLLIDVPLGPIVRYAAYFASCVA
FT                   LPGVLLLRALWRSTGNWAEDIGLGSAVGIAYQLAGWALFTWLGWQDALVVWPLLVLAAF
FT                   GLVPQLRPYWRIAAPEPLPTAWAWGLAICLSLLALATTLGVMADHAPPPDGLSYYPDML
FT                   YHLSMVSELERSVPPQLPQVAGEALEYHWLPNADIAGAVDITGLSPALVLYRLWLLPVV
FT                   LVGLLAAAALARLVSGVWWTGLLVGLIFIVPQLGYFVPAWPKVDLSGQVSLLSPSQTLA
FT                   ALTVAAAAYFVIVALHRDGGRGVWVLAAAVAVVGGGSKPTVLPILLGGVGLSALFLLVR
FT                   DRRIPWRSAVFGVLLAAIAVGTLLTVAGSTSGSNVQFLAIAKFQAGYRGATGDGSLPGT
FT                   GGLLLPSLTGDQLAVMGAVVVLAAFVLAQAGLVAGFALSRVKAVRQDPVAWWLVGALTA
FT                   SWLGLCLVDHPSASQYYFLRSGIPIAAAAVSWLIAAGVQGRSRRTSLSVIAAGLAAGTA
FT                   VAICAELVSRPATGTRAAQIEALAWPTLVAAGVAVLALVTWLLVGRRWSALAGTGTAFA
FT                   LLLVVGLPIGTTASEAWAARDKPGSGHYASKAWKIYPDEMAAVRWLAKNSGPDDVVLSN
FT                   TFCRPPGARLRGCDARGFVISGVAGRRTFLDGWAYTQPGMAAHGVKGVKYFFQPSPWPD
FT                   RLELTTRALTAPTPQLLDQLWTRYGVRWIYADPRNGPVSATLDDLAVVRFRQSQVKVYE
FT                   LAAP"
FT   gene            506529..508247
FT                   /locus_tag="Kfla_0493"
FT   CDS_pept        506529..508247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29615"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29615.1"
FT                   /translation="MRKGWYNCVVDATVQGRLTDAPEFSLFCTTAFEFWQRNLLPGDER
FT                   VILVEAMSQDIRVTLRNLTVANALRRFVPARLVVFTGADDDWNEILWTFFDAEALEALS
FT                   RAYGAVDVIDIHDLVDSRIGNPEPGDLRVAGKDLPVPGSGIEPAVLDEIVRATVSRVLK
FT                   IPRVTDEVRAGAKYAQVHQRSTEFSNIYDALFAGLDPIALVTSHVDYNHWGLAVESATR
FT                   FGVPTVHVQSTGTFKAYTLFPETRRGAATFRAELTHQIAEFFEQYVWGNRERLRSSAEL
FT                   TAWRLKGNWGKPSWWRGGAMSAIEIQTPPERLAVREHALARFGFDPDKPVVAVYNHALS
FT                   DAPRTNIEIFDDLAAWYEATADYAAKREDVNWLFIDHPNQYLYDGTGFFDSLKDKHAGS
FT                   PMAFVPSLALSKNVMWSLVDLGITVRGSISNELPAFGIPAIQAGWSEWSQCGFTMVAED
FT                   VDDYWARLDSSLESLLAGRPLLTDEQIERARLWAWFYRSGTDVSTPLVQHWEMGRTEHL
FT                   LNAVMVAMQHVEADADPAFTAVRRMWARKDPFLTRIDLTAAPEDLTLALGGVSEL"
FT   gene            508244..509554
FT                   /locus_tag="Kfla_0494"
FT   CDS_pept        508244..509554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3271 putative prolin-rich exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29616"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29616.1"
FT                   /translation="MTRTFTTPRFQTAYDRVIEPLALPGELRSGQAPDLTTVDQFVRGV
FT                   AVIGRFIASPGLLGLKVRPTGRPVRVTAHFRFDSMSLDWWEERVSAEDEPLRGIGAPRL
FT                   MLVRAQGKTRGAVLIIRQAADAGRPTTGAVSFDLRPEELTEEGLFVFEVASIDQGRPEW
FT                   APAVVNGSIGVLVDRIEFTEVDGPLELGRVSTGTLPVDPQAETMTVRGGYFVANPDDRD
FT                   EPQRWIARATVVEPLVPGPRTRVAPVVEPVEAVAEPVTEPVPEQPKAPTVGRKLKRRIR
FT                   RAARWVVPVAAVPAAQRMSRRAAALERRVRRAAGKRLSARSATPPPPPPPPPPPPPVAP
FT                   EVPAAPPGPPPNPLADVMHDLVSRKLVQVELAGVEPGPVPGVELRARADAELEIVTDGP
FT                   LTAPVLVRLSVDPSVLREVPGVDGETVRWELVVKPDA"
FT   gene            509554..510540
FT                   /locus_tag="Kfla_0495"
FT   CDS_pept        509554..510540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29617"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29617.1"
FT                   /translation="MEAEYRPQLGGDGDSNGALLRDLLRTAEPGHVVLPAGSYPITGGL
FT                   VLTDHWSLSGSAAGTTLWRAEAEQAPLIHVLGSDVAVSDLLIELPDASPGPHDGAEWTA
FT                   VTVGRYFYPERPRWIERITLERLVVRRAGRCAANNLTLIGAVRHARFSDLEVHGGGTAF
FT                   IAHWGAVGAGVSDISGHSLHPHHFEVDGLRVHDAFEGFCLSSVHDVQVRHVRCEGVEIG
FT                   FRLLPGDNTDRYHENGAASGINQRLLVEDCDIGWCGDLYAVRVAGWGRSEVDGAVTTRG
FT                   YLWLDLRDVTVRPLPVVVADRPPREGRRPIVVEDAGPVDLGGVSVLS"
FT   gene            complement(510623..511747)
FT                   /locus_tag="Kfla_0496"
FT   CDS_pept        complement(510623..511747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0496"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; KEGG:
FT                   pca:Pcar_1141 pyridoxal-phosphate-dependent
FT                   aminotransferase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29618"
FT                   /db_xref="GOA:D2PVW1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW1"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADB29618.1"
FT                   /translation="MLPYGRQSISDDDIEAVTAILRGDWLTTGPAVTAFETAVGELAGG
FT                   HRAVSCTSGTAALHMAYAGLGVGPGDEVVTTPMTFVATASCAAILGAKVVFADVEEDTA
FT                   LIDPAAVEAVVTDRTKVIAAVDYAGHAADYDALQPIADSVGAKTLGDAAHSVGGTYKGR
FT                   PVGDLADVTTLSFFPTKNLTTGEGGAVVAKDPAIAQRVHEFHHIGVVRDPERFEHTGEG
FT                   SWYYEVHEHGLNYRLTDIACALGLSQLKRLDAFKKRRTEITARYNEALAGVDGLRTPTQ
FT                   RDHVDPAWHLYPVRVLGGRRREVFDGLRAAGILVQVNYIPVHWQPVFANAGYQRGLCPN
FT                   AEQFYREEISLPMFPDLTDADVDRVIETLTKLVA"
FT   gene            complement(511747..512730)
FT                   /locus_tag="Kfla_0497"
FT   CDS_pept        complement(511747..512730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0497"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; dTDP-4-dehydrorhamnose reductase;
FT                   NAD-dependent epimerase/dehydratase; KEGG: aeh:Mlg_2322
FT                   polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29619"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVV4"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ADB29619.1"
FT                   /translation="MSILTGSDILVTGGTGSFGKAFIRYTLDNLDPRRIIIFSRDELKQ
FT                   WEVRQLFGDDPRLRFFIGDIRDRARLNRAMHNVDYVVHAAALKQVDTAEYNPWEFVQTN
FT                   VVGSQNVIEASIDSGVKKVVALSTDKASSPINLYGATKLTADKLFITGNHYAAAYDTRF
FT                   CVVRYGNVMGSRGSIIPKFRALHEAGQSLPITDLRCTRFLITLPEAVQFVVDSFEQMQG
FT                   GELYVPRIPSMKITDLAQAIAPGAKMHDMGLRPGEKLHEEMISPEEGRRALAIGDRYVL
FT                   QPDLATWGYTPPEGGHPVPDGFHYTSDNNDQWYTTDEITKILESDV"
FT   gene            complement(512859..513299)
FT                   /locus_tag="Kfla_0498"
FT   CDS_pept        complement(512859..513299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0498"
FT                   /product="PilT domain-containing protein"
FT                   /note="KEGG: xau:Xaut_2562 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29620"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW3"
FT                   /inference="similar to AA sequence:KEGG:Xaut_2562"
FT                   /protein_id="ADB29620.1"
FT                   /translation="MASDRRLQLVPTAVSLVDTCVILDILTADSTWGSWSASAVADARD
FT                   RGELVINPIIYAEVSVGFERTEDLDDAVPSTDFRREPLPYEAGFLAAKALLAYRRRGGA
FT                   KTAPLPDFYIGAHAAIAEYQVITRDKARFSTYFPTVELLTPT"
FT   gene            complement(513289..513516)
FT                   /locus_tag="Kfla_0499"
FT   CDS_pept        complement(513289..513516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0499"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: gur:Gura_3174 AbrB
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29621"
FT                   /db_xref="GOA:D2PVW4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW4"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADB29621.1"
FT                   /translation="MKLNSKGQVTIPAALRHKHHLHEGDEVEVVEDGGTLRIVRAPDSE
FT                   TRGQRLVREMRGRATTRRTTDELMELLRGE"
FT   gene            513574..514602
FT                   /locus_tag="Kfla_0500"
FT   CDS_pept        513574..514602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0500"
FT                   /product="Spore coat polysaccharide biosynthesis protein
FT                   predicted glycosyltransferase-like protein"
FT                   /note="KEGG: ccs:CCNA_02947 SpsG-related polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29622"
FT                   /db_xref="GOA:D2PVW5"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW5"
FT                   /inference="protein motif:COG:COG3980"
FT                   /protein_id="ADB29622.1"
FT                   /translation="MTVRIGVRCDVGPQRGIGHVMRSLALAEELVRRGAEVVFVCDSHT
FT                   VPWADEQIRARGIAVEPAIWTVEQHLEVFGRLGLAAVVFDSYDLDPAVFAAVRASGLPT
FT                   LAIVDGGYGAAEADVLVDQNLGSELDNPPLPEGTVRLAGLDYVLLRNEILELRPAEPPA
FT                   PRQHAAPKVFAFFGGTDAFGAGPHVVRALAATGTPFEALVVAPGDELAEAVAAVELQAG
FT                   QHVEVIGPTSELAKAVVASDLVLSASGTSTWELLCLGATAGLVCVVDNQVMGYQRTVAT
FT                   GAAVGVGLLSELKQDPSAAAAVLRPLLQDPAERARIAAQGWKLVDGLGRARVADALFQR
FT                   IS"
FT   gene            complement(514587..516839)
FT                   /locus_tag="Kfla_0501"
FT   CDS_pept        complement(514587..516839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_1597 major facilitator
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29623"
FT                   /db_xref="GOA:D2PVW6"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29623.1"
FT                   /translation="MQSKARRRGPRESGAAPVSGMAAAAAVLLLSLVMLDRHAPVLDVL
FT                   KFTAFAVLGVGLPGLVLWRLIGAYRRNLVEDCAAAFAIGTSVQLVVYLAGASVGLQRWT
FT                   WVWAPVVLLVAVLDRDVRERVWRRVEAPLRPVTAWLLAAASGVVLFAVLRTGPDRYAPP
FT                   YTTPDPSYPDMAFHQALAASAKTDVPIVPLWVAGEPMKYHTFFHQLAAATSWGTGIDLT
FT                   HLVYGLAWLPLMLACCALVFVLTQRFLVRPGREPHPAATWAGPLAVLVAGLGGALQPLH
FT                   DQALGGVSMATAAYLSPSQNLGLMLGLLLVVVCVDLLRDQPPRTRWILAILLALAASGA
FT                   KATVLPLVVCGFGLVFFVRLVAGRPARIAVVGGVVMMLVFVGSVIAIFGGESSGLQIKP
FT                   GAVFIQLPPYADLRDGAGVDRAAQLLSAAATLTAWGLAVVGVLFLRRFWRDPATAFLAG
FT                   LSIGAFVATVLTTQPGISQMYFYRTAVPFLVVLSCLGLAQLIERLEDRRAAVLVAVASA
FT                   AGLIACLLAREAASGQAGVKLPFLWTIGALLAVALVVAVGWRSIRRTGRAPTAFFAAAV
FT                   AACMVGATALPLAGLVSDQASLVVYGRTGMYGPTKAQADAARWLRVNSGRDDLVATNAH
FT                   CIVQRGTVCDSRHFWIAALSERQVLVEGWAYTNRANRIAVTTGVNPSVLPFWDQRLLAA
FT                   NDAAFTAPSDRVIERLRQYGVRWLYADRRAGEISPALKQYVRLRHATADATVYEIR"
FT   sig_peptide     complement(516765..516839)
FT                   /locus_tag="Kfla_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.382 at
FT                   residue 25"
FT   gene            complement(516898..519198)
FT                   /locus_tag="Kfla_0502"
FT   CDS_pept        complement(516898..519198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29624"
FT                   /db_xref="GOA:D2PVW7"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29624.1"
FT                   /translation="MSTAESDKRRFPWRAVGRNLVKYAAALALAWLVVWLMAGHASEDS
FT                   IVALLRFWVLGITVPGTILWRLASPFRHNLVEDFAAGALVGVSVLMLVYLAIAPLGLQQ
FT                   WAWLWAAPVLMVAVAVPSWRRRCLSRVERPISPLTAWLVAATCALPLYAIGHYRNLLPA
FT                   PYTDARSNSPDMWFHQALAASAMRDFPLQAPYLQGEEMDYHYFWHQFTAATAWATGVDL
FT                   TDLVYTIGWVPLLLAGCALIFALTDRIAPGSRWAGPLAIAVAGVGGTVNVYPSVALPAD
FT                   GLTNYVWGSPTQNLGGGLAVLMALLGIDLLRGRSAPGTWVLFVLIGVAASGSKATVLPL
FT                   IICGLGLVVFIRIFYRRFAVGALALVAVLSAIFLAAIVVVFGNHSSGLAVRPWITFAKI
FT                   GIYPLIAKDVGWGEYDHGAMWISAITTCGALLLGSAGLLVLAGTTARWFRDPGMVFLVG
FT                   ISIAGFGGMVLTDQPGTSQMYFHRTAVPVIAALAAAGAWMLVFWFADRRSGIAVLASVL
FT                   GGAGATAAARAIVRANPGDGKPFRRPDGTLTGLVVPWLWTVGLLALVALIVTGLWKLAK
FT                   RRGRPSRIAMASFVLAGMGAGLLLPIQAMANYEQVTLPPLTDRYPLGPTSSQADAARWL
FT                   RDHTSPGDLVATNAHCAAKNTLGCDVRHFWISALSERHVLVEGWGYTNTINDLVAATGM
FT                   SPNGLPFWDQQKLEENDRAFSSPTRDNLRLLRTKYGVRWLYADPNQTAVSPNLDVLATV
FT                   RFRAPDAVIYELP"
FT   sig_peptide     complement(519073..519198)
FT                   /locus_tag="Kfla_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.804 at
FT                   residue 42"
FT   gene            519294..520289
FT                   /locus_tag="Kfla_0503"
FT   CDS_pept        519294..520289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0503"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   maq:Maqu_0288 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29625"
FT                   /db_xref="GOA:D2PVW8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB29625.1"
FT                   /translation="METSQPILSVVVPMYDEEDVLPIFFARMRPLLDGLGVSYEVLVVD
FT                   DGSRDATAALLTEATRQWRQLRLVRLLRNSGHQAALSAGFRRARGEYLVTIDADLQDPP
FT                   EVIADLLSAARDKDVDVVYGVRSDRSSDTWAKRTTARMYYRLMCRLVGKDIPFDAGDFR
FT                   LVSRRVVDAVNALPEDGRVFRLVIPWLGFPSAEVSYVRAERAAGVTKYNVSKMLRLAFD
FT                   SVTAFSAAPLRLATWLGLLGGLLSVVFVIGALVTKLTGQSIPGWTSTVLAVAVIGAIQL
FT                   LCLGLLGEYVARLFQSSQKRPQFLVGYDSLEDPGHHSYAEVTEPRDPEHR"
FT   gene            520301..521440
FT                   /locus_tag="Kfla_0504"
FT   CDS_pept        520301..521440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0504"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /note="TIGRFAM: TDP-4-keto-6-deoxy-D-glucose transaminase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aminotransferase class I and II; aromatic amino acid beta-
FT                   eliminating lyase/threonine aldolase; KEGG: pen:PSEEN0254
FT                   TDP-4-oxo-6-deoxy-D-glucose transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29626"
FT                   /db_xref="GOA:D2PVW9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVW9"
FT                   /inference="protein motif:TFAM:TIGR02379"
FT                   /protein_id="ADB29626.1"
FT                   /translation="MPDPIVFSKAYISGDELAYVAQAFSSSAVAGDGPFTARATELVTK
FT                   LTGGLGSLLTTSCTHALEMTALLLDLAPGDEVIMPSFTFVSTANAYALRGAVPVFVDVR
FT                   PDTLNLDETQVEAAITDRTKAIVVVHYAGVAVAMDEILAIAAKYGVAVVEDNAHGLGGS
FT                   YKGRPLGSLGLMATQSFHGTKNVHCGEGGALVVNDTDLLHRAEIIREKGTNRSQFFRGQ
FT                   VDKYRWVDIGSSYLPADPLAAFLTGQLERFDQIQAPRLAIWERYDRELADWAGARGIGV
FT                   PTVPEECVHPAHMYYLLMPSHEHQLGLIAHLRERNITAPFHYIPLHSAPAGEKYGRVGP
FT                   GGCDVTERISGQLVRLPLFSQLTEEEQTRVIEGLLSYPI"
FT   gene            521457..522260
FT                   /locus_tag="Kfla_0505"
FT   CDS_pept        521457..522260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0505"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nmu:Nmul_A0726 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29627"
FT                   /db_xref="GOA:D2PVX0"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29627.1"
FT                   /translation="MGWYDALEAGELTSSPSAYESQRFGVSVDRITVSASAGTPLAEVL
FT                   TAVGKSTADVVVLRYPAREVDWFAALATGPRTALLADSLVYWSLPVGKGRRPAPLAGFT
FT                   AGLESAIDDDLVDDLVGDIFGDYGNHYCANPLFNRALALAGYQQWARRSISTAGAVVLR
FT                   GPDRRVLALATVDQQASWTEIELAGVVPAEQGRGRYAHLLAAVEDASTTRRLVISTQGH
FT                   NTGVQRAWARYGFEPVHTLLTVHLVTPGLLPDERCGGAAEAGRAR"
FT   gene            522434..524764
FT                   /locus_tag="Kfla_0506"
FT   CDS_pept        522434..524764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0506"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bid:Bind_2048 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29628"
FT                   /db_xref="GOA:D2PVX1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX1"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB29628.1"
FT                   /translation="MTPRLSVVVPFYNVRDYIGDCLDSIARQTWTDFEAILVDDGSPDD
FT                   SAAIAKEFCDRDARFRIVAQENQGLGPARNTGVRHAQGEYLTFVDSDDLVTRHGFEKLI
FT                   RSLDRTGSSFAGGNARRFNNSAGVRPSWIHRQPFARDRLATHVIETPDLILDRMVWNKV
FT                   YRRSFWDEYGYQFPAIRYEDYPVTLKAHLDAVTVDALAVPVYYWRERESGESITQQKFQ
FT                   LGNLEDRVRSAEMVMDLVETGDTLREVRRRVHGHFTQIDLLTLMMAFGAAPPEEEQNLL
FT                   KLARRLMDRLDDSVLARAHSYDRIQHSALLAGDIDLLRRLATFRNEGGLRGGARAFTRP
FT                   GRPWQFEHNYPGAQEQTASVPRELYRLPMKDLTIATSVQEVRWLEDGTLSVKGTTEIRH
FT                   LETKTSSNLRVSLVVGGAETQLAVRRFDAIDSHGDPALVGFEVRLDKALLGKVKGTGAP
FT                   AHFMVRLRSGRLRRHGKLRGQRPGSPGWPPGAWIDQSSWIQPGPGADGSFVLRRMVDPG
FT                   RLTSAEQTADALVLKGRVTAGLEDAKLQVTRPLAGKDQMLPLTLTGDGRDFTVRIPIRP
FT                   IIEDTNPDDPFTQRTTWAFRLVGSNDEKLLLWTAEPKAVHHLDQGRIVTLTRSTGGYVN
FT                   LHEAPLRLPAEDAEIVAGDNGMELRVGGPDLARDGYTFSWRRYLDDSDDHLDVPCTLTV
FT                   GEGRWTAAADLSTLIPADAVANAHDPLASLADWILFATGPDGADHAVQCEPFLSGRLPI
FT                   SVEQDGHTAALRPHAGTLHLEVR"
FT   gene            524764..525594
FT                   /locus_tag="Kfla_0507"
FT   CDS_pept        524764..525594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29629"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29629.1"
FT                   /translation="MHHHNHYYGQAHILARYAGLDDEYPPRLRGYLQHGWNIADGWNPV
FT                   HEFYDGAWRFTWSDAPRRRGHALGRRNYHSIGAPFLYLQELEPELGAVPEEEREGTLWF
FT                   LFHGWEGGKIQGDHQRLIDEIRETEPGPVTFSLYYTEYDRPEVRKSYEDAGFRVVSFGR
FT                   RGFSYEGTDRRFLYKQLTELRKHKRVAANRLSTAIFYGIAAGCEAAVYGDPMEMEGENP
FT                   LFGGQSRIARLWPEMLGKELDPEAARATTDLELGVPWMMPPEELRMLFDWRERV"
FT   gene            525587..527368
FT                   /locus_tag="Kfla_0508"
FT   CDS_pept        525587..527368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to ankyrin repeat domain 24"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29630"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29630.1"
FT                   /translation="MSDNQLAVEVVRGEMQPWSDYTGKRGAVQGPALRALLTDVLPDGA
FT                   RTLILGPHGADLVDAVVAKASETTLLVRSVSDAGELGEKFGAGLQVVAGALDGLADDGR
FT                   PQYDVVVAADGLDRVLGYDSADLNWTQRLDALAAVAAPGAVLVLGLENEFSLTNLLDSR
FT                   PADQRHGDDEWRPLHDDPTRPVSVDQLLAELDRVGLSGGSAYAAYAVGETQHALISADV
FT                   AAAARPGHLPTRLAVEALEAAATVVPLLAPVAEGAESAARAGLLAATPTGWIAVTGTNP
FT                   KHAIYTRTTGHPAVLTGDASNDGWSVAVAAQEDADSVEGLLVFDPSAVPSTVPGGVTAE
FT                   TLLFRLAAAENVPAFRDLAARLGDWARSQTGSRVLPRWDDVVVDGDSFAFGVSAWATVG
FT                   EESEQDRLAAAWARFHDRLISTHRRHPWPPWMVGDDLVSAWLAMSGIEPVKQTPATAAD
FT                   TPSASTAQIARGRELADALATALGVPAEAPQTPDVRTALADAERAAQEVFELKGQIFGL
FT                   ERTLGFRDKALKTRETRLREMRTQVQKANLERTKLRNSRAYSAVKLIRGAAQIRNPRKL
FT                   AGKVKRRVKSQLREKLG"
FT   gene            complement(527473..528969)
FT                   /locus_tag="Kfla_0509"
FT   CDS_pept        complement(527473..528969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce9048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29631"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29631.1"
FT                   /translation="MYLLFPGRHHVLTRFQAEYLTATAGDRTVVWAVTSANHHTTKRNP
FT                   VPYHRREAAIERFSVATGLRSLVVGVTDTPPTDDFAEVTVKAIEAGTDDQVRLDPGNTV
FT                   VACSTPEVAKLYERLGYQVIGVEPPDRARPWDVLLMIAAGNEQWRELAHPATVDVFDRY
FT                   HLDAHVRRCVNDPVVGDDGGLTTTRDYKTYADAFETAADRKWAQIKDFVRPGRILDIGC
FT                   ATGATLQLVDADPRFHESDLIGVEVARHLYAECVHKKEQGLFGNPNVYFYQRNMLGSAV
FT                   FPPRSIDSTLTLALTHEIWSYADGSRPATVQRFVNGLFAHTAPDGVWINSDVCGPAEPD
FT                   RMVLLELDDSDGANPADVADLESLADPAAYVGGLSTRARFFQFAHDFRRNANVAFQYAE
FT                   GPGGRLSLRLADAMDFLTRKDYVDNWLSETHEQFCGLNFAQWAAVAQTAGFVVDPASTA
FT                   WRNDWVISNRIAPVAALTAPDGTAVAWPDTHQLLIARRPS"
FT   gene            complement(528971..529924)
FT                   /locus_tag="Kfla_0510"
FT   CDS_pept        complement(528971..529924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0510"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   nmu:Nmul_A0725 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29632"
FT                   /db_xref="GOA:D2PVX5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB29632.1"
FT                   /translation="MLVSVVVPCYRSAKTLPRLVEDLQHVLPEATTGFEIVLVVDGSPD
FT                   DTWQVASQLANKFPETRALRLARNYGQHNALIAGVRSARYEVVVTMDDDLQHPADQVPV
FT                   LLRALTDDIDLVYGVPVEEEHGVFRSFSSRLVKAAMASTLSVQNAKSISAFRAFRTFLR
FT                   DGFDGLDGPHASVDVALSWSTTRIAQTTVRMEDRAEGKSNYTTWMLVKHALTLITGYST
FT                   EPLRLVGYLGFICAVFGVGLFGVIIYKYAVGATTVAGFTTIASMVALFSGAQMLALAVL
FT                   GEYVGRLHSGSMGRPTYVIRERTDVDAHPDITTESD"
FT   gene            530039..530443
FT                   /locus_tag="Kfla_0511"
FT   CDS_pept        530039..530443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0511"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: pne:Pnec_0338 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29633"
FT                   /db_xref="GOA:D2PVX6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX6"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADB29633.1"
FT                   /translation="MLRDHRIRYLIVGAGTNILYFGLFWLGWHVLEGVLPYLVVTALAN
FT                   LMTALIMYPTYRGFVFSSSAGWLRGFTKFYAVYLFGLACSLVGMPLLIELLNTPVLLAQ
FT                   ALVILLVPVASYLLHRFWTFRDVSHTPVDA"
FT   gene            complement(530469..530846)
FT                   /locus_tag="Kfla_0512"
FT   CDS_pept        complement(530469..530846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_1526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29634"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX7"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_1526"
FT                   /protein_id="ADB29634.1"
FT                   /translation="MAVPHGEQPPVLTIDTVVVDCADPLTLGRFWQHLLGGELRKDHHE
FT                   EFFELRGGAVGLDFAQVPEAKQVKNRLHLDLRVDPAQRQQAIDHALALGATTADDLYDG
FT                   DRWQVMRDPEGNEFCIVWGAA"
FT   gene            complement(530955..532010)
FT                   /locus_tag="Kfla_0513"
FT   CDS_pept        complement(530955..532010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0513"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: bph:Bphy_3008
FT                   N-acylneuraminate-9-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29635"
FT                   /db_xref="GOA:D2PVX8"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX8"
FT                   /inference="protein motif:PRIAM:2.5.1.57"
FT                   /protein_id="ADB29635.1"
FT                   /translation="MSASTIYFGDVPVGPDHQPLVIAEMSGNHNGDLERAKDIVRAMAE
FT                   TGVQALKLQTYTADTITLDVDLPAFRLPSEHELWGGARLYDLYQEAHTPWEWHEPLFEL
FT                   ANSLGMLAFSSPFDPTAIEFLEKLNVPAYKVASNEIGDLPLVRGMAETGKPIIISTGSA
FT                   TLMDIDAAVRAARSTGNEQIVVLSCTASYPAPPEQSNLRSIPVLRDALGVQIGLSDHTM
FT                   GIGAAIAAVALGATVIEKHVTLSRADGGVDSAFSLEPDEVKALVEGTKIAQQALGEPVV
FT                   GPKQAEQNVLRFRRSLYVTRDVKAGEKVAADNVRSVRPAGGLAPDAFASVEGREFRQDT
FT                   PKGTPLTWDVL"
FT   gene            complement(532015..532536)
FT                   /locus_tag="Kfla_0514"
FT   CDS_pept        complement(532015..532536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1284 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29636"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29636.1"
FT                   /translation="MLRTATDGDVDIIRTLRNQQPNRDVSITAHEISAAEHAAWWAKAS
FT                   VDPTRRVLIYERDGVVAGVVNFFDLELDAEPRTGAWGFFLDAEGLAERGETLPAWIEVM
FT                   KDATAYAFDELGLDELSGEVLEHNTVVRQMNRRFRFVEGEPETRVADGREITVLPITLH
FT                   KDNRRKPKGN"
FT   gene            532735..534318
FT                   /locus_tag="Kfla_0515"
FT   CDS_pept        532735..534318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0515"
FT                   /product="protein of unknown function DUF187"
FT                   /note="PFAM: protein of unknown function DUF187;
FT                   Fibronectin type III domain protein; KEGG: bpr:GBP346_A1998
FT                   putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29637"
FT                   /db_xref="GOA:D2PVY0"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY0"
FT                   /inference="protein motif:PFAM:PF02638"
FT                   /protein_id="ADB29637.1"
FT                   /translation="MTVRRIVGVLGVAAGLVLGVLPGTAAAVPAQPESTAKTCTADPKT
FT                   PLRQFRATWVSSVVNIDWPSRSGLPAAQQQAELIGWLDDAVRQRHNAVVLQVRPTADAF
FT                   WPSAVEPWSRYLTGTQGRDPGYDPLAFAVAEAHKRNLELHAWFNPYRLSMGTDLNALVP
FT                   THPARQHPDWVVTYGGKLYYNPGIPAARKLVEDAIMDAVAKYDIDGVHFDDYFYPYPVA
FT                   GQVFDDAATYAQYGAGFATVADWRRHNIDLLIQELQQRIKAAKPWVKFGISPFAVWRNK
FT                   GTDPQGSDTTAGVQTYDDLAADTRKWVREQWIDYIVPQVYWAGGFAPADYNKIVPWWAE
FT                   QVRGTNVHLYIGQATYKVGTSTQSPDWSDPNELSDHLAFNSTIPEVQGDIYFSAKDVRA
FT                   DRLGATSLLNSTWYTRPALIPTMPSLDSRPPLPVHALRASRTAGGVQLQWRATSADTTS
FT                   YAVYRRDLAAGDWCADKDARNLLATLRATGGKQTYVDTTAVAGRHYIYLVTALDRGWNQ
FT                   SVPLPAAVIR"
FT   sig_peptide     532735..532818
FT                   /locus_tag="Kfla_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.892 at
FT                   residue 28"
FT   gene            complement(534326..536572)
FT                   /locus_tag="Kfla_0516"
FT   CDS_pept        complement(534326..536572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_0991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29638"
FT                   /db_xref="GOA:D2PVY1"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29638.1"
FT                   /translation="MSRGGRATTVAALASLPALPLGWFVALQAHPAWIPAAYLGYLLVV
FT                   IAVPGTMLWRRLTGGTGWFVVDAALGTTFGLACEALVYPLGRWLDVPMVALVLPALALG
FT                   LALAVPAKTRPSRPTPWWAVAGVMVSTGLVAAWFVRVGSRVIPLDGPAALRPNTDSPFQ
FT                   LSLAAELTHHFPPQVPYVAGEPLTYHWMAYNHIASAHWITGIELDVLTQRVVPLAFLLL
FT                   TTLAAAAVGMVLTGRAVAAPIAAGLTVLAGDLAPWGWAVTHTLYHDSPLSMGQMISPTQ
FT                   AFSTVLMLPLIAVTALLLRREQDQAKQRLAGLFLVAAVLITVLSISKATALPVYGAGLA
FT                   AAWIYLTVKARRLNLRALVLGLTVGATYAVNFFFVLRGASHGMELKPAGTYRSMLDGML
FT                   RGIDPSVQPGPSVLAVVAAAVLIGWLMPATGALLIRRRLPRDPMVVLLLAGLIGAIAAV
FT                   SVLYHYSQAQVFFARTAFVYGVLLATWGLSSLDRRQYFVVAPALALGVAAINLGRSRTD
FT                   TLIRDCRDTSCLQRIFAEPPVVALAVTAAGIVVLGLLSRGSRRTWAVIAVAALIGLTVS
FT                   PTVVSLRRFALPPQTAYDSIAPGGIEAARFIRRQSGPDDLIATNIHCHAPTGPRCHTGS
FT                   FWIPGYAERRVLVQGWSYTAKANDAQTSTEASYGQFWDQEKLRVNDAAFSAPTRESLDR
FT                   LRAQYGVRWLLADGRVNPVSDQLERLAELRFQSGTVRVYQLYPPRGDQAANPVP"
FT   sig_peptide     complement(536483..536572)
FT                   /locus_tag="Kfla_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.969 at
FT                   residue 30"
FT   gene            536772..537461
FT                   /locus_tag="Kfla_0517"
FT   CDS_pept        536772..537461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0517"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: afw:Anae109_4101 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29639"
FT                   /db_xref="GOA:D2PVY2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29639.1"
FT                   /translation="MTTAGRQETLRYHRALYADHSPTGPATWLHRPSPFVLRSLPQLHA
FT                   DGPALAVELGAGAGRHTIPVAQALPAGSRVLGVDLLPVAAEQLRTSARGAGVSDVVRPV
FT                   VADIEAFGISGQADLVVACSALEHVSGPAAFERVLGEWQAATRVNGLHCLVIGVDKTEV
FT                   HPGGEVRPAAVEFPFGRAEAERLLQRCYSGWRWLEYSVGGFSVTEQRDGTAYRLDTVCV
FT                   RLLVRRT"
FT   gene            537526..537777
FT                   /locus_tag="Kfla_0518"
FT   CDS_pept        537526..537777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29640"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29640.1"
FT                   /translation="MSELTRAQIRDLMGEVMKAQGKELPSDDSADLREIGFRSLDFSEL
FT                   ALRVEDEIGDELNFDAPGLRQIAKVGDVLDFIEQLQSA"
FT   gene            537774..539030
FT                   /locus_tag="Kfla_0519"
FT   CDS_pept        537774..539030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0519"
FT                   /product="Acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II-like protein"
FT                   /note="KEGG: rpb:RPB_0995 AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29641"
FT                   /db_xref="GOA:D2PVY4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY4"
FT                   /inference="protein motif:COG:COG0318"
FT                   /protein_id="ADB29641.1"
FT                   /translation="MTAPRRTTALIGDDNRVVVGGKTLTWRTLHKLPQLPSPAAVLVDN
FT                   GADALAAVRHHAVHGTELLVATSSRVDLAMREELGESGFAVVLANGDEHSVTPAKLKRV
FT                   EESGRVWLLTSGSTGRPKRIGHTLESLTTVRGQQQPRTWLVPYSPGTYAWWQVITISLT
FT                   QADQNLVVIEPSELETWPLIAAEHGVTAASGTPTFWRQTIYRDTEALAKVPLEQITLGG
FT                   EPVDQAILDRLKEIFPNARVSWIYASSEVGASIVVHDGQAGFPKAWLNRDPDPASERPV
FT                   LSVDGDELVIASPHHGAGLEGAHRTGDRVEFVGDRVLITGRLDTDEINVGGSKVSAGLV
FT                   RNVLMAHPAVAWARVFARKAPLVGRMVAAEVVLNPDLGPVTDADLVQWCTNRLPDYGVP
FT                   RRIRFLPEIPQKETLKSDV"
FT   gene            539023..539769
FT                   /locus_tag="Kfla_0520"
FT   CDS_pept        539023..539769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0520"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   pat:Patl_3071 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29642"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB29642.1"
FT                   /translation="MSEATPVPPSKVVLVSGGSRGLGLAIVTDLIDSGVKVAAFARTVT
FT                   PELTALAEKDPDQVHVGSVDVNDEKAGQAFVKEVEGKLGPIDGIVNNAAVGQDSLHVHT
FT                   SAEQIANIIQTNLTAPLVLTRFVLRRMLAKGLKGRIVNVTSICAQRGYPGLVAYSATKG
FT                   GMDSATRALARELGGRVLANSVAPGFFASEMSAVLGQTQLDQIVRRTPTGHLTEPEEVV
FT                   PVVRMLLLDNTNINGQVIVIDGAAGI"
FT   gene            539750..540166
FT                   /locus_tag="Kfla_0521"
FT   CDS_pept        539750..540166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29643"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29643.1"
FT                   /translation="MAPPASDLLDRAESYLRVGSAEEMADAVTRSHLPDFRCVGWYAVP
FT                   PPGWSVAIDAEYAGRQIPQPLARRFGTEAFWERWTRAECLCKLADTPMLAWWPQHGLDV
FT                   PDDFPGAWRTLRLDDLVVSVALSPTTAGRTLRPA"
FT   gene            complement(540153..541547)
FT                   /locus_tag="Kfla_0522"
FT   CDS_pept        complement(540153..541547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0522"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: cti:RALTA_A0971
FT                   FAD linked oxygen oxidoreductase; putative
FT                   (R)-6-hydroxynicotine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29644"
FT                   /db_xref="GOA:D2PVY7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY7"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADB29644.1"
FT                   /translation="MTQTAETGLAELRAALAGTVIGPRDSGYDDARRLWNASIDRRPAV
FT                   IARCESVADVQAALAYAGRHGLEVAVRGGAHNAAGLATVDDGLVIDLGAMHGVTVDPAA
FT                   RRARVGGGALLQHLDAATQEHGLAVPAGMISHTGVGGLTLGGGMGWLSRIGGLSVDNLV
FT                   SAQVVTADGRVLRAAEDENPDLFWALRGGGGNFGVVTEFEFRLHEVGPMVQYGLLFWGL
FT                   DQAAEVFRLARELIPTLPPEFNVVIAGLNAPPAPFVPEQYHFQPGYGLIVVGFGAPESH
FT                   AELVERIQGAMPPLFAFTSPMPYVALQQLLDEPNAWGSHVYEKNCYLGDLSDETIAVFT
FT                   EHFPRKQSPLSLNLFYRLDGAYSQVAEDATAFAGGRSPRYACFVVGVCPAPELMPAERE
FT                   WVRTFWEALQPHAFGSGAYVNALGEEVSDDRVRAVYGAKYDRLARVKAEYDPTNTFHRN
FT                   TNIKPA"
FT   gene            541682..542494
FT                   /locus_tag="Kfla_0523"
FT   CDS_pept        541682..542494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0523"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   bxe:Bxe_B1478 putative luciferase-alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29645"
FT                   /db_xref="GOA:D2PVY8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY8"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADB29645.1"
FT                   /translation="MRYGMILPGGTAPEQLEQAVLAEQAGWDGVFVWEAAYGVDAWGLL
FT                   SAIAARTSRIKLGTMLTPLPWRRPWKVASQVATLDQLSGGRAILAVGLGATETDLPRTG
FT                   EQLDLRTRAAMMDEGIDLIRALWTGSLTYHGEHYRYDSTRDDLTQVGRPVQERIPIWVV
FT                   GAWPRPKSMRRVLRCDGVLPQFQGEQSPEELRAMRGWLAERGADPALDVVAEGETAAED
FT                   PAAAAAEVAPWADAGATWWLETRWEMPHHSAERMQQVRARLAAGPPAP"
FT   gene            complement(542548..542835)
FT                   /locus_tag="Kfla_0524"
FT   CDS_pept        complement(542548..542835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_1559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29646"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVY9"
FT                   /inference="similar to AA sequence:KEGG:BBta_1559"
FT                   /protein_id="ADB29646.1"
FT                   /translation="MTAAVIRYRTKPEAADENQRLIEKVFAELAEQQPAGLSYQAFRLS
FT                   DGVSFVHVVDDADGSLRQLAAFEEFQRDLTDRLAVQPEREEGTRIGGWPR"
FT   gene            542963..544336
FT                   /locus_tag="Kfla_0525"
FT   CDS_pept        542963..544336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0525"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr6921 putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29647"
FT                   /db_xref="GOA:D2PVZ0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29647.1"
FT                   /translation="MRQQKTTAEQRWVLGLTSIGSVMVALDVLVVAVALTTIRQDLGAS
FT                   IEQLEWTVNAYSLSFAVLLLTAAALGDRWGRRRTFAAGLVLFTVASVGCALATSVPLLI
FT                   GARALQGVGAAVVMPLAMSLLGAAFPPERRGWAIGIFSGVTGLAVLGGPMVGGAVTEGL
FT                   AWQWIFWINVPVGLLAVPLVLSRVRESKGAVRRLDPVGAGLATLAVLGPVWGVVRGEAA
FT                   GWGSAEVLGSLTAGALVLLGFLAWEARTEQPMIPLGFFRTAAFSAGNAAGFFLSAALLG
FT                   AVFFLSQFMQVQLSSGPLEAGLQLLPWTATLFLVAPVAGRLVDRFGERPFVVTGLLLQG
FT                   AGLAWIALIAAPDIRYAELVLPLVVAGLRGVDGDARRAECGRRLLAQGVGRYGVRHLRH
FT                   AAPARWSGRGRRGRSRLRGGGRLPVLQRRLHPCDGRLRRTVGGRSVRRAGDHRAAPDE"
FT   gene            544370..545314
FT                   /locus_tag="Kfla_0526"
FT   CDS_pept        544370..545314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0526"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ank:AnaeK_3232 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29648"
FT                   /db_xref="GOA:D2PVZ1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ1"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ADB29648.1"
FT                   /translation="MNLEDEFAQYRSGLLAHCYRMLGSLHDAEDAVQETYLRAWKGMAA
FT                   FEGRSSVKTWLYRIATNVCLSALQHSSRRVIPSALGAPGNDPDNLEAQALETSWLEPWP
FT                   DLLDPALVVGNRQTLRLAMVAALQHLPARQRAVLILREVLAWPAAEVADLLDTTTAAVN
FT                   SALQRARAELARLSPAEEQFSEPDEPVRRALLDQYAVAFEQGDLVALEGLLTADTRWEM
FT                   PPIPTWFSGRDDVLRLLAAKLPPGAGKRLMVETGANGQPAFAVYLRGRDGAFHGYAIQV
FT                   LELNKAGISGVLAFHRPDLFPLFGLPVTRLPEA"
FT   gene            545343..546548
FT                   /locus_tag="Kfla_0527"
FT   CDS_pept        545343..546548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29649"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29649.1"
FT                   /translation="MLRVLQLATVAEDPELHLAELGRYDEQNQQLVDRVVRRYLTDLLR
FT                   TTWERGWAPADVVQHARRQLEPGVEPLLLAVVGAEHRAYKPSTLDARWADQLADLGLSH
FT                   PFPELDLTRWSADQRVGRYLSLHLAVTLAGFLYRLPALARLFPLPGAAQPASPRKTRDG
FT                   SATAQATDRKMLARVRALLAKAEATEFPDEAEALSGKAQELMAKFSLDHALLDAGPELD
FT                   LPDDSGARRIWVETPYVTAKAQLVGVVAAANGCRTVTMDQLAVVTIVGAELDLQLTELL
FT                   ATSLLVQANRAMLAAGKHFGHRGESRTRSFRQSFLMAYAQRIGERLQATADAARSAVPA
FT                   ADRDRLLPVLSRREQQVDALFTRLFPETVTRRTRITNGAGWHAGLTAADLAQLDTHRPV
FT                   TR"
FT   gene            546621..547592
FT                   /locus_tag="Kfla_0528"
FT   CDS_pept        546621..547592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0528"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   pag:PLES_39461 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29650"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ3"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB29650.1"
FT                   /translation="MRVRMDDDASPTAKALLALELIQNVPGITGDRLGRRLGVTDRAAR
FT                   RYVGILREAGIPIESTPGRYGGYTLGRGYRLPPLMFSTAEALGLMMTALEGHHSAADAT
FT                   DPAGSALAKIIRVLPTSVAQPADAIRRMISPADRIATPDPEITAAVVQGCAEHHRIRIG
FT                   YRRGECDVEPLMMDVDPWAVSVRHGRWYLLCWSHTRDARRVLRVDRILSVEPLPESFTP
FT                   PDGLDAAQAVQDHLTEGWQYQVEIVFEAPADLISRRIPGILGRLEELGSDRCRLIGSTD
FT                   DPEWYAERLTFVRAPFQVVAPPELRKALQDLGQRLIAAGEDV"
FT   gene            complement(547657..548409)
FT                   /locus_tag="Kfla_0529"
FT   CDS_pept        complement(547657..548409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0529"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dal:Dalk_1807 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29651"
FT                   /db_xref="GOA:D2PVZ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB29651.1"
FT                   /translation="MYNGKTLSVVLPTYNEKDSIADVIRRFDKLGVVDDILVINNNAAE
FT                   GTSEEVATTNAREIVETRQGYGAAIQRGLREVDTDLVCVCEPDGTFNPEDLLKLLSFSA
FT                   ECDVVVGSRTVSNFIWDGANMGWFLQFGNWAVAKFLEVLFNTSSMSDVGCTFRVITREH
FT                   VQTILDRSTLPGSAYGLEMLLISVVTRARLVQIPVNYHPRVGVSSVTGDFGKTVSLGLE
FT                   MIRLVLKTRLKTIGRRPRRSVSSANATV"
FT   gene            complement(548441..549124)
FT                   /locus_tag="Kfla_0530"
FT   CDS_pept        complement(548441..549124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0530"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sml:Smlt0631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29652"
FT                   /db_xref="GOA:D2PVZ5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB29652.1"
FT                   /translation="MSDDPLAQTPQSGEPDGTYVSNYFETRLAHNANRTKIWQHLCKYL
FT                   QRWISTDAEVLELGAGWCDFSNNVAAKRVVAMDLDSTVDRAAAPHVEPVVGDCTDLGKF
FT                   EDGTFDVVFASNLLEHLDRDACNRLLAEAKRVLRPGGRLILMQPNFRLNPGRYFDDFTH
FT                   VAIFTDQSLQDYLVAEGWKIDAVKAKFMPLTLKSKGGNLTFVVPWYLRSPIKPLAGQML
FT                   VVASR"
FT   gene            549300..551594
FT                   /locus_tag="Kfla_0531"
FT   CDS_pept        549300..551594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB2498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29653"
FT                   /db_xref="GOA:D2PVZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29653.1"
FT                   /translation="MPQTAELSSSTAAASPPEQTTTEKPTGGGFGRWTSTVISALVLLA
FT                   AVAFFLGTAVSADLPAGAAVLALLGLVVTQLLPGVVVWRTVRPNRGWWVEDVMMGLAVG
FT                   FMLAIGAQTLAGWSRQPWMSAALPLALAVVLLAVPRTRARIRRVRSSGLPLWWMPAVVA
FT                   TSLFGLQDVLQYYERQPLTWPSGFRAPYIDGYLHLALSAQLQHRGPTSFPWVENAPMAY
FT                   HWFSHAWVAQVAAVSGAELDEVLFRFMPALMPLAIVLVVAIAAVRITGIAWTGPVAGLL
FT                   CMAGAEQNLFGRVTFGYPMSPLSPSLAPSVPLMIAIVLLLVFRWRGQMGRAGLVLIPLL
FT                   ALAASGTKGSTMPLVVAGIGLAFGVMMLVDRTRLKGLLLDGVLCAGTLLVAMVVVFQGS
FT                   DSGLHVQFREASLATPALPLLGEVTTTTMVMSSVLAVLGILARGTGLLWRLRTAEGRRD
FT                   PVTWLLLGGGIAGAAAVAVFSHPGVSQYYFARTAGPLLAIGSAVGLATMVDQLKSRWWR
FT                   ATLVGLVGGPLFVLLPIWLVGAIKPNHGGLIHATKMLAIGVAVLLVVGVIAWFVTPRMR
FT                   FTAAFAAVTVMILAGGVTMVTRGQLEVPGVQPLRPGKPTGYLAVGTDQIAAARWIRDHS
FT                   DVDDVVMTNRHCTTPIAPKKCDSRRFVVGAFSERQMLVEAWTPTVEANKRGPEGRDSIT
FT                   VDYWKPEILQLNDSFVAQPDAAKAQQLRDLGVRWIYVEFTRPHAQTLEPFAQERYRNAH
FT                   AAVYEFPEAGS"
FT   gene            551591..552151
FT                   /locus_tag="Kfla_0532"
FT   CDS_pept        551591..552151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0532"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose 35-epimerase related;
FT                   KEGG: avi:Avi_1490 dTDP-4-dehydrorhamnose 3,5- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29654"
FT                   /db_xref="GOA:D2PVZ7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ7"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ADB29654.1"
FT                   /translation="MTGPSLTETSIPGLLHVELEVFDDGRGWFKESFQAEKLEKLGLPH
FT                   LEVVQNNVSYNAEVGVTRGIHAEPWDKYISPAFGRVFTAIVDLREGPGFGRLETFELTP
FT                   RQGLYVPRGCGNSFCTLEPNTVYNYLVNAHWSPDAKYTLVNLFDPRINVPWPLPKEQLI
FT                   YSEKDAGHPLLDAVTPIRPDWEL"
FT   gene            552151..552981
FT                   /locus_tag="Kfla_0533"
FT   CDS_pept        552151..552981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0533"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: mch:Mchl_4002 dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29655"
FT                   /db_xref="GOA:D2PVZ8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ8"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ADB29655.1"
FT                   /translation="MAILVTGAGGQLGRALAARLPDARLVTSADLDITDRAALDAFDWT
FT                   GITALVNAAAWTAVDKAEDAGSTLAAWDVNAAGVANLAWHARRLGIPLVHVSTDYVFGG
FT                   GEGFLPAGHPIDPQGVYGITKAAGELAARLSPTYYVVRTSWVFGDGPNFVRTMLRLGAE
FT                   RDELTVVDDQYGRPTYTVDLAAALIALLESEAPSGTYHATGAGDVVSWADFAAAILAGT
FT                   SCKVRPISSAEYAQGKVIAPRPANSALDLSALEAVGITMRDWREALAEYLETQR"
FT   gene            complement(553001..553591)
FT                   /locus_tag="Kfla_0534"
FT   CDS_pept        complement(553001..553591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0534"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msl:Msil_3313
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29656"
FT                   /db_xref="GOA:D2PVZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2PVZ9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB29656.1"
FT                   /translation="MSASATDRPPLPDLRPTRADARRNYDLLVTAAREAFAEHGTGTSL
FT                   EQIARRAGVGIGTLYRRFPNRTALLEAVYVDEIQSVCDRAYGFHEQLTPFEALAAWMRS
FT                   FVGYNVSKKSLAHELTAALGKDSEFFKACKLNVKDAGDLLLESAKQEGTVRSDLQLIDV
FT                   MRLVGAISSLPDIEPEQADRLLDIVLAGLRPQD"
FT   gene            553725..555269
FT                   /locus_tag="Kfla_0535"
FT   CDS_pept        553725..555269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0535"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rfr:Rfer_2443 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29657"
FT                   /db_xref="GOA:D2PW00"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW00"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB29657.1"
FT                   /translation="MSATSAAPAGAQSEPPASPPATGSGAARRPGVVLAVIVITQLMVI
FT                   LDGTVVNIAMPKIQTALDFSPANLSWVQNAYALAFGGLLLLGARAGDLLGRRRVFVTGV
FT                   TVFTAASLLGGLAPTAELLLAARVLQGVGGAIAAPAALTLLMLTFKEGPERMKALGLYS
FT                   LVSSGGASVGLVVGGMLTDWVSWRWGLFINVPIGIALVVAARRVLTETPRERGRFDVAG
FT                   ALTSTVGITALVYGFIRVAEAGWSAPEVLASFAVGVVLLAGFVLIERRVSHPIVPLRMF
FT                   RNADRVASYLTMLLLVGTMFGMFFFLTQYLQGVLEFSPLAAGLAFLPMTGLLFASSRIV
FT                   PRLTGRMDNGLMMIAGSVSVLAGMIWLTRLSLDSSYLGGVVGPLVLFGAGAGLIFIPLT
FT                   GRALSGVPAEDAGAASGLLNVLQQVGGALGLGILVTVFGTASRNATPGTTDPAEAAREI
FT                   LTDGVHAAFIGSAIYAALTLLVIVVGVRPWNRRKAVTPETATEPAAVEPAVAEAHI"
FT   gene            complement(555316..556515)
FT                   /locus_tag="Kfla_0536"
FT   CDS_pept        complement(555316..556515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0536"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gur:Gura_3474 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29658"
FT                   /db_xref="GOA:D2PW01"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW01"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADB29658.1"
FT                   /translation="MSGLVPARLSVGDQVRVGGAGLRARPLRVVLSALGIAIGIAAMIA
FT                   TVGISASSREDFNRQMQALGTNLLTVGPGQNVFGEEAQLPVESVGMIERIGPVTEAAAI
FT                   GLLPDADVYRTDRIPVGQTGGISVAAADVGLLSAVGTTVADGTFLNGASAQYPAVVLGA
FT                   AAATKLGVGWAGAEQQVYLGDHWFTVVGILHPAPLAPELDTTALIGWAVAKQLLRFDGS
FT                   PTTVYARAADDAVTAVQKVLAATASPEAPNEVAVSRPSDALAAQQAADATLNALLLGLG
FT                   AVALLVGGVGVANTMVISVLERRAEIGLRRSLGATRGQIRGQFIAEALLLSALGGVGGA
FT                   LVGSAVTAAYAISQGWPVVVPAWAPAAGIGATLVIGSLAGLYPAVRAARMSPTEALATP
FT                   "
FT   gene            complement(556512..557195)
FT                   /locus_tag="Kfla_0537"
FT   CDS_pept        complement(556512..557195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0537"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vcj:VCD_002808 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29659"
FT                   /db_xref="GOA:D2PW02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW02"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29659.1"
FT                   /translation="MTALVELERASKVYPGGVSALAGAELRIGRGELVGIVGPSGSGKS
FT                   TLLNLIGTLDRPTDGTVRIDGHDIGRLTDREVSALRAQRIGFVFQQFHLTAGVRAVDNV
FT                   ADGLLYAGAPRPERIRRAAAALVEVGLGHRLDHHPHELSGGERQRVAIARAVIGKPALL
FT                   LADEPTGNLDSTAGAAVMTLLRDLHRGGTTVVVITHDRAIAATLPRRIEILDGRVLAQG
FT                   TEAAL"
FT   gene            complement(557192..558271)
FT                   /locus_tag="Kfla_0538"
FT   CDS_pept        complement(557192..558271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0538"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   gur:Gura_3473 peptidoglycan binding domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29660"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW03"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADB29660.1"
FT                   /translation="MSRPAGTARQRRLGVAGVAGLLLVAAAAVVVLRPGGSSGRTVAAA
FT                   DQPPATTAVVKTTLTQTVQISGTLSYGVPQALKAPPGGGTLTWLPGEGSTVGFGAPAYR
FT                   VDNVPVLLIKGTVPLYKTLEQGVSGPDVLQLEQYLVSGGWLKVKANTTFGSATTAAVLD
FT                   WQDATGQPETGQVKPGQLVVRPVPIRVAVQEAQIGDQLGGGTPLYTFSTTQPKVVVGLD
FT                   VAKQHLVKKGLTATVVLPTGQQVPGTVSSVSKVATQPAAGSDDPPHVPVVVTPDNLGAI
FT                   SGLDSAPVDVELVSAQQKGVLAVPVNALVALAEGGYGVQVVTGGQAAFVAVQLGMFAGG
FT                   KVEVSGPGITAGTLVGVPA"
FT   sig_peptide     complement(558188..558271)
FT                   /locus_tag="Kfla_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.417 at
FT                   residue 28"
FT   gene            complement(558268..558777)
FT                   /locus_tag="Kfla_0539"
FT   CDS_pept        complement(558268..558777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29661"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29661.1"
FT                   /translation="MASFGLWRLLAVPLLTLAVASCNDSAGPGVATADQPTSGVPATST
FT                   PSASATPAGFSACMAGYGLQVEDPKPGQGLGIDPQVSGNPKFDEAMAACKQYLPGNTRT
FT                   QSTDPAELAKYQAFAQCLRANGLPDFPDPKPGGDGGLFGSGVDRNSPAFQAASKKCEQH
FT                   LAGTAG"
FT   sig_peptide     complement(558697..558777)
FT                   /locus_tag="Kfla_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.608 at
FT                   residue 27"
FT   gene            558934..559590
FT                   /locus_tag="Kfla_0540"
FT   CDS_pept        558934..559590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0540"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: avn:Avin_15530 heavy metal response
FT                   regulator, two-component"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29662"
FT                   /db_xref="GOA:D2PW05"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW05"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB29662.1"
FT                   /translation="MRILVVEDERVLADAIGEWLRRESFAVDIVYDGAAALERTAVTGY
FT                   DVVVLDRDLPSVHGDEVCRQIVTAGGQTRVLMLTAAAAVRERVAGLAIGADDYLGKPFA
FT                   FAELSARVHALTRRSRAAVPPVLERSGIRLDPVRREVARDGRRVELANREFAVLAELLR
FT                   AEGAVVSAEQLLERAWDENIDPFTNTVRVTVMKLRRKLGEPPLVETVPGAGYRLP"
FT   gene            559587..560756
FT                   /locus_tag="Kfla_0541"
FT   CDS_pept        559587..560756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0541"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sfu:Sfum_2006 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29663"
FT                   /db_xref="GOA:D2PW06"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW06"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB29663.1"
FT                   /translation="MKRWTLRTRLTLLYGVLFLVAGAVLLGVTSVLVQNSLAGQLEKQA
FT                   DTRIAAIRAAAAAAAPADGQPAEEQVTEIRRQQKELQATAARSVVTAGGVALLGVAVLA
FT                   GVSGWLIAGRALRPVQRIRETARRISTATGAGRGLHERIALSGPDDEVKQLADTFDSML
FT                   EHLDRSFDGQRRFVANASHELRTPLALNRALVELAITDPAASPDARRLGTALLTVNQRH
FT                   ERLIEGLLMLADSENEVTDRVPVDLAEVAAQVALGDTPLEIRRDLRPAPTTGDPVLLER
FT                   LAQNLVENATRHNVPGGWLSIATTRRGDRVVLTVSNTGEEIPAYEIESLFQPFRRRASV
FT                   TADGDRGFGLGLSIVRAVARSHGGDAAARPRPGGGLTVEVSLPAAACGR"
FT   sig_peptide     559587..559703
FT                   /locus_tag="Kfla_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.498 at
FT                   residue 39"
FT   gene            complement(560725..561747)
FT                   /locus_tag="Kfla_0542"
FT   CDS_pept        complement(560725..561747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0542"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein; K00676 ribosomal- protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29664"
FT                   /db_xref="GOA:D2PW07"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW07"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB29664.1"
FT                   /translation="MPAKALPAYRRGMSTEGWPAGLVARPIDRADADAWAELLAAKEKV
FT                   DAEGENYDADDLLEELADPKLDAARDTVALWSGEQMVGYGVARTPDVVVDVHRVRTEGA
FT                   VHPQWRGRGIGAALVDWLGRRAAELHAERQPGAVGEINTGAISTNTGAEQLLSGAGYEK
FT                   CRYFFHMLRPFATPIVEPATPEGLRLVAYTPEYDEPLRLAHNEVFLDHWGSSPKSPESW
FT                   KTWFTGSRAFRPALSYLVLDEDEIVAYALGYEWVADTEATGIREVYVGQVGTRRTHRGR
FT                   GLAGVALARVMTEAATTGFQRASLGVDAENPTGALGLYERLGFATEHTFVTYRKPLPAS
FT                   "
FT   gene            complement(561753..562775)
FT                   /locus_tag="Kfla_0543"
FT   CDS_pept        complement(561753..562775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0543"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: acp:A2cp1_3922
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29665"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW08"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADB29665.1"
FT                   /translation="MLPWSAELAGRFEQSTLDSTLLRDNPLGDPHQRQVLVYLPPGYDE
FT                   SDRRYPSIYVAIGYTGHVGMWFNRTAFRQPYPEQLDALFAAGDVPPAIVVFFDGWNRFG
FT                   GSQYVDSPGTGRYHSHLCEEIVPWVDATYRTVPERDQRAITGKSSGGYAAMVTPMLRPD
FT                   LFGALATHAGDASFELCYRPEFPQRARELRDRYAGSFENFFAEIAQRPNRITNAELGML
FT                   EIYGCSAAYSADPDGTVQLPFDELGEIRPEVWQRWLALDPVVMGAGSHREALGSLRAVW
FT                   IDAGKQDEYYLDLGATAFERVVRAAGVPAVHFELFEGAHGGIEYRYPLAIQWLCEQLSR
FT                   "
FT   gene            complement(562800..564488)
FT                   /locus_tag="Kfla_0544"
FT   CDS_pept        complement(562800..564488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0544"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: scl:sce7660 hypothetical protein; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29666"
FT                   /db_xref="GOA:D2PW09"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW09"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADB29666.1"
FT                   /translation="MSVVPVLSARLTAAAALAFDLPGADPELRAATKPEFGHFQTNLAL
FT                   RLAKTLGTSPRAVAAELVAHAELDDLCAPAQIAGPGFVNLTLLPSTLAAGVNELPRSLP
FT                   TTGRRVVVDYSQPNVAKQMHVGHLRSTVIGDALCNVLRYAGYEVVRQNHVGDWGTQFGM
FT                   MVEQLLDEQTPVESLDLEEMQQLYQRSRKHFDSDPVFADRSRRRVVLLQSGDPRTRGIW
FT                   QQLVDISLAEFDRVYALLGSPLTQADVVGESAYNDALQGIVSDLAAAGLLTESGGAQCA
FT                   FLPGFTGRDGSPLPVIVQKSDGGFGYSATDLAAVRHRVRDLKADRIVYVVDHRQSLHFQ
FT                   QIFALARTARWLPETTSAEHVAFGTVLGPDGKPFKTRDGGTVSLVSLLDAAIARAGALL
FT                   ADRTGIDRESVARAVGIGAVKYADLSSDRTNDYVFDLDRMVAMTGNTGPYLQYAHARLT
FT                   RLLSKAGHPEGQVTVLAEPAEQRLALLLAGFGDAVQQVAETLQPHRLCTYLYDVASALS
FT                   AFYESCPVLPSEGETRTSRLALCTATRTVLHDGLALLGITAPDAM"
FT   sig_peptide     complement(564432..564488)
FT                   /locus_tag="Kfla_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.875 at
FT                   residue 19"
FT   gene            complement(564647..566869)
FT                   /locus_tag="Kfla_0545"
FT   CDS_pept        complement(564647..566869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0545"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; glycosyl transferase family 2;
FT                   KEGG: ppr:PBPRA2712 teichoic acid biosynthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29667"
FT                   /db_xref="GOA:D2PW10"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW10"
FT                   /inference="protein motif:PFAM:PF04464"
FT                   /protein_id="ADB29667.1"
FT                   /translation="MAASTDSAPRFSIVVPCHNVRAWLRPCLDSVLSQSFADFEIIGVD
FT                   GASTDGSGRILEEYAAADPRVRAIHLTENIGLGPTRNAGLKQCRGDYVLFLDADDLYTP
FT                   GSLAALAARIDATGRPDLVIFDYERVFWDGRVVGNQQHDAFARDGEGVFTAAERPVFLT
FT                   FLELVWNKACRRDFLTLHGFAFTAGYYEDAPWTYSTMLTAERIATLDRVVVHYRQHRTG
FT                   GNIHATRTRRQFDIFDQYDRVHAFITSDPALAGWRRFAFDRSLDHILAVLAKPERLAPE
FT                   DRAEFFHTAHAFAKRWKPEGYAADRTSRGFKRWMLIHDDYATYSTLKLSSKMLHVPSPR
FT                   KAVGKLLHRGDLDPDLALYGAYWFKQYACNPRAIYEKAAELAPRLRGVWVIDADHVGAI
FT                   PEGVEYVVAGSPAYEKLVHKATYFVSNMNLPKELEKRDGQIHVQTQHGTPLKTMGTDLR
FT                   RYPLAARDLDLDELMRQVDRWDFNISANRYSSEIWERTYPAHFEELETGFPRNDRLLTA
FT                   TLDDVRAIRAGLGFDDSHLVVLYAPTFRDSQDAVRTPTGLVDLGGDGIHLDLDRLAAAA
FT                   GEHGRVLVRTHYSLAKGAPDVRSDRVLDVSEHPRVEDLMLAADVLISDYSSITFDYANL
FT                   DRPIVLLVDDLGFYDRTRGTYFDITECPPGLVARSADELFTALQTGRFASAEAAKHRQL
FT                   FRERFCDFDDGRAAERVVRRIFLGETELPPVTPLADRRPAPSAYRR"
FT   gene            566895..567680
FT                   /locus_tag="Kfla_0546"
FT   CDS_pept        566895..567680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0546"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: acp:A2cp1_0593 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29668"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW11"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADB29668.1"
FT                   /translation="MTADVFAPLAALEGVGSAARAARDAVDVLLRDRGLRRVGADVTAE
FT                   ALLRGAHASAALAGSPSTLAEVREGTGDALASGAVRMTRELMSLARQADTAPVQVWTRL
FT                   HQLAAADLAPADQLGHLRTSREPLPDDIPGLPPAPPADVMWERLSGLAKALTTATTAPG
FT                   LVVAAIVHAELAVLRPFPVANGLVARAAERVLLVARGTDQVAVTVPEVGHLELGASYAR
FT                   GLTDYAEGGVSGVQSWLLRECEVVALAAERSPLNNSARS"
FT   gene            complement(567951..568781)
FT                   /locus_tag="Kfla_0547"
FT   CDS_pept        complement(567951..568781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0547"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: afw:Anae109_1214 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29669"
FT                   /db_xref="GOA:D2PW12"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW12"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADB29669.1"
FT                   /translation="MLDLMEHPRTPRPAAFFDLDKTIIARSSTLAFSRPFYAGGLINRR
FT                   TVLRSAYAQFVYLLGGADHDQMERMREYLSAMCTGWDVRTVREIVADTLHHIVDPIVYD
FT                   EAVTLIEQHHAEGRDVVIVSSSGSEVVEPIGELLGADRVIATRMVVADGKYTGAIEDYV
FT                   YGPHKATAITTLAAAEGYDLQASYGYSDSITDEPMLAAVGHPFAVNPDKALRRLAVSRG
FT                   WPVLDFSEPVALAERTRRFHRVRRPAFAVSAAGAVLAAGALLYAARRRVRPAED"
FT   gene            569246..570949
FT                   /locus_tag="Kfla_0548"
FT   CDS_pept        569246..570949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0548"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18; Carbohydrate-
FT                   binding CenC domain protein; Fibronectin type III domain
FT                   protein; SMART: Fibronectin type III domain protein;
FT                   chitinase II; KEGG: mxa:MXAN_6008 chitinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29670"
FT                   /db_xref="GOA:D2PW13"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW13"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /protein_id="ADB29670.1"
FT                   /translation="MTPRSRRPQAAIIPALLLALVGLLLVPGTSSAATNLVTNGTFETG
FT                   TLAGWSCSSGTGAAVSGSARTGTYALQGTPTAGDNARCSQTVSVQPSSTYTLSAWVKGS
FT                   NVYLGSDGGSSTWSSSTAWNQLTTTFTTSASARTATIYLHGWYGVPAYQADDVVLDGPG
FT                   GTGPPPDTTAPSTPGGLTVGSPTSSSLRLNWAAASDASGIDHYDVVRGSEPAQSVGNVT
FT                   SWTATGLSPSTTYSFKVRACDPSGNCSAYGAAVSGTTSSGPTVPPSSLPKHILTGYWQN
FT                   FDNGAAVQRISDVQANYDLIAVAFADADPSRPGGITFTLDPTLASRLGGYTAAQFKADI
FT                   AAKQAAGKKVILSVGGEKGTISVGTATAAANFASSALSVLREYGFDGIDIDLENGVNAQ
FT                   YMGQALRTLHSQYGPGLIIAMAPQTIDMQSTSFEYFKLALAIKDILTVVNVQYYNSGAM
FT                   NGCNGQVYSQGTVDFITAQACIMLQNGLRPDQVGLGLPASTRGAGSGYVSPTIVNNALD
FT                   CLTKGTNCGSFKPSTTWPTLRGAMTWSTNWDATNGNAFSNQVGPHVHSLP"
FT   sig_peptide     569246..569344
FT                   /locus_tag="Kfla_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 33"
FT   gene            570949..571881
FT                   /locus_tag="Kfla_0549"
FT   CDS_pept        570949..571881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0549"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; KEGG:
FT                   ank:AnaeK_0902 two component transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29671"
FT                   /db_xref="GOA:D2PW14"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW14"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB29671.1"
FT                   /translation="MHSYRPAPVLEALGVCSEDEQLYRALLARPEATVTDLAEDTGWPA
FT                   ARVTRHLRSLLTLGLACRTPGRPALYTPAVPEAAVELLALRKQAAIVEARLGATVLTAE
FT                   FRAGNEAGPFTVVRGAQAIAQRYDQAQQSAQSEVLVLDRPPYAVLPVAPRRTSGVSYRM
FT                   IYDMAALGDPAELAAARSAGTSCRMLRDVPLKLVVADRRTGLLQTGADVLVELRPSTLL
FT                   DGLLRLFELLWQQATPLAFEPSGGPLSVDDQQLLGLAAAGLTDQAIARRLGVAQRTVER
FT                   RMQRILKALDATTRFQAGLRAGQRGLLSP"
FT   gene            complement(571871..572407)
FT                   /locus_tag="Kfla_0550"
FT   CDS_pept        complement(571871..572407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0550"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: vvy:VV2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29672"
FT                   /db_xref="GOA:D2PW15"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW15"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADB29672.1"
FT                   /translation="MAEAGALFLVTLVLPLVLRRVPSRCQTRPMTRATEAADALGLTYQ
FT                   ETRHGRVNSLEEAAAARGIEPAKLIKTIVVRLADDDYRFVLVPGDREIAWPKLRTLLGV
FT                   NRISMPSADTALAVTGYVRGTITPLGSTHDWPVIADERITGTISIGGGDHGVGITVDAE
FT                   ALLKTLSATVADVTD"
FT   gene            complement(572421..572549)
FT                   /pseudo
FT                   /locus_tag="Kfla_0551"
FT   gene            complement(572557..574101)
FT                   /locus_tag="Kfla_0552"
FT   CDS_pept        complement(572557..574101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0552"
FT                   /product="cellulose-binding family II"
FT                   /note="PFAM: cellulose-binding family II; Fibronectin type
FT                   III domain protein; SMART: cellulose-binding family II;
FT                   Fibronectin type III domain protein; KEGG: azc:AZC_2901
FT                   type III fibronectin"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29673"
FT                   /db_xref="GOA:D2PW16"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW16"
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /protein_id="ADB29673.1"
FT                   /translation="MKRKPLAVALAAITAVVASFLAAPTAQAAPATASFTKVSDWGSGF
FT                   EGRVTVTNGTSSPLTWSIALDFPSGYSISSAWDAQRSSSGLTHTFTPPSWAGPLAPGAS
FT                   VTFGFNGSPGNFPGITACRLNGGSCTGGGGGTVPAAPTGLTGTSTASSVSLSWSAASGA
FT                   TSYNVYRNGAKVGSPTGTSYTDSGLSASTAYSYQVSASNSAGEGAKSSAVSVTTKAGGG
FT                   DTGTRRAAPYLYMGWGDPPNPATVMNATGIKWFTMAFILSSGGCNPAWDGSRPLQGSAD
FT                   ATAIAQIRAAGGDIVLSIGGWSGNKLGPNCSTPEALAGAYQQVINAYNLKAIDVDIENS
FT                   DEFENEVVQDRILTALKIVKQNNPGIQTILTFGTTTSGPNFWGNRLIERSAALGANIDV
FT                   FTLMPFDFGSSNIYNDTVSASQGLNNKLKATFGWTTAQAYAHQGISGMNGLSDQQEMTT
FT                   TATWQNITTWAKNNGLARLAFWSVNRDRGCAGGGVVSNCSGIAQPDWEFTRITAGF"
FT   sig_peptide     complement(574015..574101)
FT                   /locus_tag="Kfla_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(574130..575878)
FT                   /locus_tag="Kfla_0553"
FT   CDS_pept        complement(574130..575878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0553"
FT                   /product="Chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="KEGG: cvi:CV_4240 chitinase; PFAM: glycoside
FT                   hydrolase family 18; Carbohydrate- binding family V/XII;
FT                   SMART: chitinase II; Carbohydrate-binding family V/XII"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29674"
FT                   /db_xref="GOA:D2PW17"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW17"
FT                   /inference="protein motif:PRIAM:3.2.1.14"
FT                   /protein_id="ADB29674.1"
FT                   /translation="MSRLRTLAATATVAATALIAAAGISVATAGPPTGSTVQAAPQATS
FT                   GGVKTAYFAQWGIYGNAFYPKNLATTGAAGKLDFVNYAFANIHPTSHTCFMANKAASQN
FT                   ESDPNAGDGAGDAFADYGKSYGADISVDGVGDVWNQPIQGNFNQLRKLKKQYPNLKILI
FT                   SIGGWTYSKYFSDAASTDAKRKAFVSSCVDMFLKGNLPVVDGFGGPGSAAGIFDGIDVD
FT                   WEYPGSPNGHVGNHHSPADKQNFTLLLAELRAQLDAYGNSVGRKMWLTAATPAGQDKIA
FT                   TIETNKIGQYLDYNNVMTYDMHGGWDATGPTNFQDPLYAAPDDPSTPIPPGTAKYSIDG
FT                   AVKAWTTGDPAYGIPGGFPANKLTIGYPFYYRGWKGVPATANGKYQPATGPADGNAMSG
FT                   NVPGVSFYKELVGFVDNPAYSFYDETTKASWFYRNGTFWTGDNARSIKEKADYQHCHGL
FT                   AGAMMYSMEALDPAATLFNAVVNAVDAPTPGCTGPTPTPTPTPTPTPTPTPTPTPTPTP
FT                   TPTPTPTPTPTPTATPPTATPWAANTAYPTGALVSYQGVTYRCIQGHTSLTGWEPPNVP
FT                   ALWGRI"
FT   sig_peptide     complement(575789..575878)
FT                   /locus_tag="Kfla_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 30"
FT   gene            576092..577171
FT                   /locus_tag="Kfla_0554"
FT   CDS_pept        576092..577171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2457 CpaE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29675"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29675.1"
FT                   /translation="METSLPSAPVLLATADEMLLDDLLRLAAAAEVTPQIEKDLLGLRR
FT                   YWQTATLVVMGQDLVEPFARTQPVRRPGVVVAGVDPDDGAVYRRALTIGAESVFLLPGD
FT                   EAVLGDRLADTLDGGLRAATTFAFVGGCGGAGATTLAAAVAVTASRRGVRTMIIDGDPL
FT                   GGGIDLALGSETGSGARWPDLLNAAGRVSAAALRAALPAVDGLAVLSWDRSDVTTLPPE
FT                   AMRSVLGAAQRSSDLVVVDLPRRADPAAEEALVRSTATFLVVPRDVRSCAAAARLVGPL
FT                   REVATDLRVVAREPGLGGLSAVDVAKHLSLPLAAKLRFDRDVAALMDQGRFDPRPRGAL
FT                   GRTAGELLDLFGLYGLLAA"
FT   gene            577168..578325
FT                   /locus_tag="Kfla_0555"
FT   CDS_pept        577168..578325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0555"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   pfs:PFLU0645 putative type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29676"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW19"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADB29676.1"
FT                   /translation="MTVPTELIERVRGILAAQGAEPTPARVAAALRADGGVFGDSTVLA
FT                   VVEALRREAVGAGPLDRLLTEPGITDVLVNGPNEVYIDRGTGLERIALRTGDETAVRRL
FT                   ATRLAAAAGRRLDDATPYVDVRLPDGTRFHAVLSPVAAPGTCLSLRVPSRTVFGLEDLV
FT                   AAGALPLPGIAIFRDLLDARLAFLVSGGTGTGKTTLLNSLLSLVDGAERLVIVEDASEL
FT                   RPDHPHVVRLESRPPNVEGSGEITLRDLVRQALRMRPDRLVVGEVRGAEVMDLLNALNT
FT                   GHEGGCGTVHANSAADVPARLEALGALAGVGRDAVHSQVSSALHAVVHLTRGRDGVRRV
FT                   AEIRIIGQAPDGLVTTLPAVRFGAGGTVELCDGASRFTQLLAGAA"
FT   gene            578322..579140
FT                   /locus_tag="Kfla_0556"
FT   CDS_pept        578322..579140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0556"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   aha:AHA_1457 Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29677"
FT                   /db_xref="GOA:D2PW20"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW20"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADB29677.1"
FT                   /translation="MSPALLAAAMILIAVLTVLPRRSRALHRLTSARSDRRSDGAAGLA
FT                   RSVRRRLVPLALSAIVALGIGLSLGAAALVSTLAVGVVLAVITTQRARARRLHLADQKR
FT                   AQVIEACDTLAAELAAGRPPHDALEGAAEVCAELRPAAAAARLGGDVPAVLQLAADTPG
FT                   AESLKALAAAWQVADRSGAAVAAIVDRLAASLRAEESLRRQIATNLAGARTTARLLAIL
FT                   PLFGTLLGYALGADPLTFLTTTIPGAACLTAGLALAITGLWWTERLATYP"
FT   sig_peptide     578322..578399
FT                   /locus_tag="Kfla_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.354 at
FT                   residue 26"
FT   gene            579382..579951
FT                   /locus_tag="Kfla_0557"
FT   CDS_pept        579382..579951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0557"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   mno:Mnod_2571 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29678"
FT                   /db_xref="GOA:D2PW21"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW21"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADB29678.1"
FT                   /translation="MACLLLLPLPWNIAPTVLAYLAIPAVLGRLEPAAVRKRNARISAD
FT                   LPLAVDLLAACLRAGRPPQAAIATVGHALDGPLAGLLAEVERRLDLGADAIDAWSVLRA
FT                   EPTCATFARATQRALRSGAPLAKTLESQSADLRQSRRWTAEQQTRAVETRSVLPLGLCF
FT                   LPAFVLLGVVPTIAATFTDILTELSP"
FT   gene            580077..580334
FT                   /locus_tag="Kfla_0558"
FT   CDS_pept        580077..580334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29679"
FT                   /db_xref="GOA:D2PW22"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29679.1"
FT                   /translation="MSKVLVPVHRIPQRIVRNVAQREAGIVRRRTERGATTAEYAVGMV
FT                   AACGFGGILITLLKSDAMMSVLKAIINWALQSAGVEGVQV"
FT   gene            580412..580795
FT                   /locus_tag="Kfla_0559"
FT   CDS_pept        580412..580795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0559"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29680"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW23"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADB29680.1"
FT                   /translation="MASRRQKTEHGTVTAELALLFPVLLATIVAGVWATGLVVANIRCI
FT                   DAARDVARAVARGESPETATTIGHRAAPENATIDITTTEHGEVQVVVTAERHLDWPLFA
FT                   ALPPISVHAQAILQAEPGEQPPP"
FT   sig_peptide     580412..580516
FT                   /locus_tag="Kfla_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.604 at
FT                   residue 35"
FT   gene            580792..581154
FT                   /locus_tag="Kfla_0560"
FT   CDS_pept        580792..581154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29681"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29681.1"
FT                   /translation="MKPRSIATDERGGATLLVLFTALFLLAVGALATVWSTISLAHHRA
FT                   SAAADLAALSAAQAIQSGIPNPCAAATRAAATQQATISRCAQQGEAVSVAASVTLRLGA
FT                   LGTPTITTYAHAGPHP"
FT   sig_peptide     580792..580890
FT                   /locus_tag="Kfla_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.708 at
FT                   residue 33"
FT   gene            581151..581675
FT                   /locus_tag="Kfla_0561"
FT   CDS_pept        581151..581675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to syndecan 3 (N-syndecan); K06257
FT                   syndecan"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29682"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29682.1"
FT                   /translation="MKPPPSPTPQTDLVTDPNPDLRPVFLAPTAPTDSTDSTAPTGAVR
FT                   PLLVVDAANVIGSRPDGWWHDRAGAAHRLLTSLAACLAGPGIHTDIIVILEGAARAAAD
FT                   EPVADTPSTLHVVLAKGSGDDTIVEVVTTALQQHPDRPTTVITADRGLRSRVEPLGAAT
FT                   AGPSHLWSLLD"
FT   gene            complement(581830..582450)
FT                   /locus_tag="Kfla_0562"
FT   CDS_pept        complement(581830..582450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0562"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   xcv:XCV4086 LuxR family two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29683"
FT                   /db_xref="GOA:D2PW26"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW26"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB29683.1"
FT                   /translation="MPDRIRLLLVDDQILSRGVLRSGLERERDLEIVAELKRSDDVVAA
FT                   AKQHRANIALVDAAGSGRDSIIVTTELRTSMPECRVVMLTTYGRPGQLRRGLEAGAKGI
FT                   ALKGSPAPQLADAVRRVHLGLRVVDANLAAETLHYTESPLNEGETETLRAARDGGTVAA
FT                   MAEKLAVSERVVRTRLWSAIGKTGARTRADAITIAEHNGWLYD"
FT   gene            complement(582698..583951)
FT                   /locus_tag="Kfla_0563"
FT   CDS_pept        complement(582698..583951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0563"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: cak:Caul_4076 phosphotransferase
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29684"
FT                   /db_xref="GOA:D2PW27"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW27"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADB29684.1"
FT                   /translation="MAITSYRQRWTLDDRAESVWHSLPVDVPPGCPGLSVTLTVPDVDG
FT                   VVIDLGCEGAGGWRGWSGGARRTFAITPDVATPGYLAGELEPGTWWVVLGLHRLPVEGA
FT                   ELIVEAVTGPVAVVPGVTEYAAAAAAVGVPARPPRRDLPAVAGLRWVAGDFHAHSLHSD
FT                   GSTPIANLAALGLAAGLDVLACTDHNTEAHHRELPSVGRRFGIGLIPGQEVTTESGHAN
FT                   AFGAIGAIDFRRPAAEWEPEVARRGGLLSINHPLGGDCSWRQPLGLSHPPLAEIWHSTW
FT                   LDRRWGGPIAWWEAWGLDSTTPIGGSDWHTPDSLTLPGTPTTWIAVDASASGPDELVEA
FT                   VLEGLAAGRTAVSAGYTSPVLLRVGDEFVVLDAPNTVLVAPDGSRRAVRTEREVLPASQ
FT                   SGGHVLITHTGEFMALCS"
FT   gene            complement(583951..585057)
FT                   /locus_tag="Kfla_0564"
FT   CDS_pept        complement(583951..585057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0564"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: mlo:mll3499
FT                   glycerol-3-phosphate transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29685"
FT                   /db_xref="GOA:D2PW28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW28"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29685.1"
FT                   /translation="MAGIDIEGLATVYPNGVRAVDGLDLTVADGEFFALLGPSGCGKTT
FT                   LLRTIAGLENASEGSVRIDGADVTRLEPGKRGVAMVFQDYALFPHMSVSENITYPLKVR
FT                   RVAAATRSSVAERTAGELSLQGLLERRPGQLSGGQQQRVALARAIASEGKVLLLDEPLS
FT                   NLDARLRLEARTFLKKLQRDLGITTVFVTHDQAEALALADRIAVMQSGQLRQLGSPREV
FT                   FARPVNTFVANFIGSTPMNLLDGAVVASDSGAVSVAGGSLPASTGSVPTGAEVTVGVRP
FT                   EYLTLSVASAGDVAGPAIRGEVVVAENLGTSSLVSVDCAGTLIGVTVPEEDEPEPGTPV
FT                   VLTAPEQRVLLYDKESGELLARQAAAVA"
FT   gene            complement(585057..585878)
FT                   /locus_tag="Kfla_0565"
FT   CDS_pept        complement(585057..585878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0565"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:RL4243 putative
FT                   transmembrane component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29686"
FT                   /db_xref="GOA:D2PW29"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW29"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29686.1"
FT                   /translation="MTPAYVVRRIGFYVLICAITLFFAVPMLWIASAPFDASPGLGVQW
FT                   PDWTLDNVRKTFDHPYALHSMVNSLLICVTTAVAVTAFAALASYALSRVRIPGRDALLY
FT                   GLLLLSSVVTGTAAMVPIFVMMFQLGLIDSRFGVALVMTGGLLPAAIFILKDFVDAVPK
FT                   SYEESARVFGASTGQILRDVVLPVARPGLATILVWAFVNSWGNFLVPFLLIRSIDKQPG
FT                   AVLLQTFTDEGGSANLSVIPVFSLLFSIPVVVLYLLVNSRYGFRFHGGIKS"
FT   gene            complement(585875..586777)
FT                   /locus_tag="Kfla_0566"
FT   CDS_pept        complement(585875..586777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0566"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:RL4244 putative
FT                   transmembrane component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29687"
FT                   /db_xref="GOA:D2PW30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW30"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB29687.1"
FT                   /translation="MPGRPARVRGPAQDVAGLGVGRALGFVAPALLLIGAFLVFPAVWT
FT                   IYIGITNYRLTGVEAVSPSIVGLANYTKALNDALFHNALWLTCLFVLGSAIVGQNILGF
FT                   ALAWTMRRARPAVRRTVEGLVLLAWILPSTVVAYLWIAFFDRDTGTLNSILGQQGTAWL
FT                   IEYPMVCLILFNTWRGTAFSMMLYSSALQAVPPSQLESARMVGASGWQTLRDVVFPHIR
FT                   GHVLTNTLLISLWTANDFSPFLLTKGGPNHESETVPVYIYNVALQGGELGYSSAISFLL
FT                   LLANLLVALLYLRLLRRRS"
FT   gene            complement(586798..588225)
FT                   /locus_tag="Kfla_0567"
FT   CDS_pept        complement(586798..588225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0567"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rhi:NGR_b11850 ABC transporter sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29688"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW31"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB29688.1"
FT                   /translation="MRPISRVLPPAALGAAALVLLTGCLGSSDSGGGDQDANRNADAKQ
FT                   VELVIGANAVKGGKNSAGATFTQDVLIPKFVEAQKAKGVDVTVRFEGDGSDDEVYKQKL
FT                   ALSLSNKAGPDLMNLDGIWVGEFAQAGYVKPLTDTVGDAAKVDGWDGWAQIPESVQQLG
FT                   SFEGKRYGVPAGTDGRVLYFNKKLFAQAGLPADWQPKSWDDILAAGQKLKQLPGVTPIQ
FT                   INGGTAMGEATTMQGVLPLLVGTGATIHTDGKWLGDTVKVRQVLDFYAKVYGGGLGDPV
FT                   LQREAKGRDKSFAEFAAHKIGILAEGDYFWRSVVEPKEGVAKMADRDTTVGYALIPAAR
FT                   PGAGVKGQDFVSMSGGGVVAVNPNTKYPQQAWELLQFMNSAEMVEAALDGAAKITQRTD
FT                   VNAKVLANDPMLNFVATKVLPITQYRPGLAEYPKISAALQQATADVIGGKSTDAAARAY
FT                   QTAVAAAAGGKDKVAGN"
FT   sig_peptide     complement(588127..588225)
FT                   /locus_tag="Kfla_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.535 at
FT                   residue 33"
FT   gene            588581..588679
FT                   /locus_tag="Kfla_0568"
FT   CDS_pept        588581..588679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29689"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29689.1"
FT                   /translation="MIGDLLDDILGGGNGGGGHHWHHWHHYWNCWW"
FT   gene            complement(588867..589337)
FT                   /locus_tag="Kfla_0569"
FT   CDS_pept        complement(588867..589337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29690"
FT                   /db_xref="GOA:D2PW33"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29690.1"
FT                   /translation="MAVLGIVLIVIAVLFGLGVAVSSSDSTTLEVFGVNFGVIVPTVFF
FT                   LGAVAGALLLLGLWLMKKGLGRGYRRHKEVRELRQKVATTPDTGTDPATGTGTHGDRSP
FT                   VTDEPVDADGQPVGRHAADVPPDVAPVADRPDRDRLADDRHTVADGTETRPR"
FT   sig_peptide     complement(589263..589337)
FT                   /locus_tag="Kfla_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.400 at
FT                   residue 25"
FT   gene            complement(589377..591716)
FT                   /locus_tag="Kfla_0570"
FT   CDS_pept        complement(589377..591716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0570"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: dde:Dde_3603 DEAD/DEAH box
FT                   helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29691"
FT                   /db_xref="GOA:D2PW34"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW34"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADB29691.1"
FT                   /translation="MSLLSTRVVAMSGEAATVLKRLAAGPGRAERLTHVESVPARAGRT
FT                   GEWPRWVPPEVLTQLADAGVVAPWTHQVATAEAAYGGRHVVVATGTASGKSLGYLLPAF
FT                   ATLSIAHAASPHRRAASVLYLSPTKALAHDQLRAVSQFKVEGLRATTLDGDSERTERDW
FT                   ARDHATYVLSNPDMLHRSLLPNHQRWARFLGCLQYVVVDECHHYRGVFGAHVAGVLRRL
FT                   RRVCAQYGAHPVFVCASATVAEPAVSGERLTGVPMVEVVDDGSPRGGISFGLWEPPLTS
FT                   LKGENGAPVRRSATAEVADLLTDLVVSGVRTVAFVRSRRGAETVAMTARDNLAEVDPAL
FT                   ADQVSAYRAGYLPEERRRLESMLQSGELTGVAATNALELGIDIAGLDAVLLSGWPGTRA
FT                   SLWQQAGRAGRSGGDALALLVARDDPLDTYLVRHPQAIFGRPVEATVFNPENPYVLGPQ
FT                   LCAAAQELPLTEADYEVFGSTTESVIGQLVRQRLLRQRPHGWFWTRRDRAVDAIDIRSA
FT                   GGKTVQIVEDRTGRLLGTVDGGSAHASVHAGAVYVHAGESYLVRSLDLDEHAAVVEPAS
FT                   PDYTTFARDVTEIGILATEATSAWGSAELSRGWVQVTNQVVSFQRKQVATGDVLDEQPL
FT                   DLPERTLRTKAVWWTVPDDVVAGLGLDDVPGAAHAAEHASIGLLPLFATCDRWDIGGVS
FT                   TARHADTGRLTVFVYDGHPGGAGFAEHGYAAAREWLTATREAIAHCECTDGCPSCVQSP
FT                   KCGNQNNPLDKGGAVALLTALLSSEA"
FT   gene            591902..592231
FT                   /locus_tag="Kfla_0571"
FT   CDS_pept        591902..592231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0571"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   mca:MCA1686 anti-sigma B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29692"
FT                   /db_xref="GOA:D2PW35"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW35"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADB29692.1"
FT                   /translation="MDLSLTTRPEGGRTVVEVGGEIDVYTAPKLRETIVSLVDAGHYDL
FT                   VVDLERVEFLDSTGLGVLVGGLKRVRTHDGSLSLVCTQERLLKIFRITGLTKVFEIHPD
FT                   VASAL"
FT   gene            592445..594751
FT                   /locus_tag="Kfla_0572"
FT   CDS_pept        592445..594751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0572"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: smt:Smal_3307 V-type H(+)-translocating
FT                   pyrophosphatase; TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29693"
FT                   /db_xref="GOA:D2PW36"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW36"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADB29693.1"
FT                   /translation="MGTLLAAQAVDLSSSNTMLVVVVGVIAILAVLIAMVFRSQVLAAN
FT                   DGTENMKTIALAVQEGASAYLSRQFKTLSVFAVVAFLLLFLLPAHSDGDNDTVLKIWRS
FT                   IFFLIGAGFSAFIGYLGMWLATRANVRVAAAARTEGREPAMRVAFRTGGTVGMATVGLG
FT                   LLGAAAVVLFFKGDAPTVLEGFGFGAAMLAMFMRVGGGIFTKAADVGADLVGKVEQNIP
FT                   EDDPRNAATIADNVGDNVGDCAGMAADLFESYAVMLVASLILGKAAFGEQGLVFPLIVP
FT                   AIGALTAIIGVYLTRPRAGENGLRTINRAFYISALISAVLCTIAAFAYLPGTFADLTGA
FT                   TEAIAANDGDPRVIATVSVLIGIVLAAVILALTGYYTGTEDKPVKDVGKTSLTGAATVI
FT                   LSGISVGFESAVYTALVIAAAVYGAFLVGGGGVVALFAIALAGCGLLTTVGVIVAMDTF
FT                   GPVSDNAQGIAEMSGDVDGEAAQILTELDAVGNTTKAITKGIAIATAVLAATALFGSYT
FT                   DSIYSVLNDAGDAAFNSDALVFDPSTLVGLIIGAAVVFMFSGLAINAVGRAAGAVVYEV
FT                   RRQFRDIPGIMDGTGKPEYGKVVDICTRDSLRELATPGLLAIAAPIAVGFGLGASALAG
FT                   YLAGAIASGTLMAVFLANSGGAWDNAKKLVEDGNHGGKGSPAHEATIIGDTVGDPFKDT
FT                   AGPAINPLIKVMNLVAVLIAPAVVGMSSIGEDTNTALRLIIAGAAVAIIAVAVIVSKRR
FT                   ESVISDTPAEANVAA"
FT   sig_peptide     592445..592576
FT                   /locus_tag="Kfla_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.698 at
FT                   residue 44"
FT   gene            595127..596107
FT                   /locus_tag="Kfla_0573"
FT   CDS_pept        595127..596107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0573"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccs:CCNA_03389 lantibiotic transport ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29694"
FT                   /db_xref="GOA:D2PW37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW37"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB29694.1"
FT                   /translation="MIEAQGLTKRYGATVAVDNLSFEVKPGKVTGFLGPNGAGKSTTMR
FT                   MILGLDTPTAGDVRIDGQHYSDLKQPLRKVGALLDAKWVHPNRSARAHLNWMAASNKLP
FT                   RQRVEQVLDIVGLTEVAGKRAGAYSLGMSQRLGIAGALLGDPEILLFDEPVNGLDPEGI
FT                   VWIRQFMHRLADEGRTVFVSSHLLSEMALTAEELLVIGRGRLISQSSTKEFVEQASGNS
FT                   IKVRSPQLGELQSALQQTGLETRVEDVEDEGKVLFVDGKVTTDQIGETAAAQGIVLHEL
FT                   SLQRGSLEQAFMQMTGDSVQYHAHGTEQAPPVAPAEAVVAAEQEK"
FT   gene            596110..596862
FT                   /locus_tag="Kfla_0574"
FT   CDS_pept        596110..596862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29695"
FT                   /db_xref="GOA:D2PW38"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29695.1"
FT                   /translation="MSLLAMERIKFLSTRSPWWCMALAAVLSIGFTALVVGLVPAEELG
FT                   APIDTATTQAGYLWGQMIIMVMAALAATTEYRFNTIKTTFLAAPNRVTALLAKTAIVAV
FT                   AGALVGLLLAFGSWGISLLLASDADLALNSGADLRAVVGVGLNAALTAVFALAVGILIR
FT                   QSAGAIAIVLIWALLVERILITVIPRVGDDIKNWLPLSNGDWFNAAGLAGSGTYDVGHG
FT                   PWVSLLVFAAWSFGLLVIGLLVTQKRDA"
FT   sig_peptide     596110..596217
FT                   /locus_tag="Kfla_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.591 at
FT                   residue 36"
FT   gene            complement(596988..597905)
FT                   /locus_tag="Kfla_0575"
FT   CDS_pept        complement(596988..597905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0575"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2060 WD40 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29696"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29696.1"
FT                   /translation="MRSIFRSTVVAVLAAAVSLAATQASAVTPATPATAPSTGTSTGTA
FT                   TDTATDTATDTATVVERALAARGADRLGPERPAVAVRHDAKSVTVATDGISHSVTAVDR
FT                   RNSEVRRLPDGGQVLSVLRSGSSTRFGLTLHPGWRLQPAAGGYLITRPGSDLVGVIEAP
FT                   WAIDADGRSLPTWYQTDGSQLVQHVDPAGARYPLTLDPKLTYGRGIYLNLWGYEAQAAV
FT                   SALIAIGGGAAYITCQGLSRLPSGIKKVLDVVCKVSGAAAAVTIRNILETLKGITGIRA
FT                   YDCYQKRIVPNQGGWRTVKAKNCA"
FT   sig_peptide     complement(597825..597905)
FT                   /locus_tag="Kfla_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            598155..598943
FT                   /locus_tag="Kfla_0576"
FT   CDS_pept        598155..598943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_2007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29697"
FT                   /db_xref="InterPro:IPR021247"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29697.1"
FT                   /translation="MTDWARVRAEGFAVPTDRPLPELVAELSAMLRSPDPVQRDSQAYS
FT                   ILATWIGAGALGPELLHALGDEMVERFGDPETQARTFAPLILDAIVSAGVFEPSWVPPF
FT                   ERWYVAEEDLRGHDPKLGWLHAVAHGADLLGALGQFPAVEPVEMLRLGIGRLLTPTEYV
FT                   WRDLEDDRLGYALAVTLTRADLTETDATGWLDPAARALVGYPPDGPRPEVSNTLRTLRV
FT                   VYVLVDQGVRIGDQVAEVPHRDLVRAKLTEVLRMATPHFL"
FT   gene            599066..600511
FT                   /locus_tag="Kfla_0577"
FT   CDS_pept        599066..600511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0577"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: lch:Lcho_0579 protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29698"
FT                   /db_xref="GOA:D2PW41"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW41"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADB29698.1"
FT                   /translation="MSELTSGLVDRLRDAFEAADYTVEGVAARLGARANAALARNETTL
FT                   AYRQTAQESDLDTLIRLFLLQRPVLRSLLDKATGGLLPDLVALGILSVDGAEVSAALDV
FT                   RPYAEDDRSWWVIADLTPGLDGRRATMRPDYVLGIAPASLSLVKLTVPLKVESALDLGT
FT                   GCGIQALHLADRANHLVATDVNPRALQLTRWTAALNRIELDVRDGSLYEPVAGQRFDLI
FT                   VSNPPYVIAPPSDGKLTYRETGFAGDSVVEQLVRQAPQHLTEGGWCQLLANWTCVRGED
FT                   WRERIAGWTGDRSSWVVQREQLDPAEYVELWLRDAGLHGRPEYTRRYDEWLVWLDQQRV
FT                   EAIGMGWITVRNVAGSTLAEEWPYEIEQPIGPHVLQRFQRQQELPEDLTGLYLKLADDV
FT                   VQETAGPPGADDPATIVLRRQRGMRRAEQVDTVLAGFVGACDGDLRVGQILDALATLLD
FT                   RDDLHADYLPEIRRLLVEGFLEV"
FT   gene            complement(600527..602095)
FT                   /locus_tag="Kfla_0578"
FT   CDS_pept        complement(600527..602095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0578"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: xau:Xaut_1425 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29699"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW42"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB29699.1"
FT                   /translation="MRQTSGVTERIAAAMTRAQSGGPAEAMLDIRRLLAELGPEPTPER
FT                   AAAEYVRAVAAHHGTDADEALDAVDGCIRVARAIDEPGWEANALALRIVTLIRTGEGGD
FT                   SVTDLVAAENALSRTRDPGLASWAHTGLGYAYDLLRLFELCIPHFEQAAATDTDPLGLP
FT                   ESPAINRLNLAESNLRWAHEMERLGDPSYDEQTRHRRSEARRWAAEAIEVIVRADLIGY
FT                   WPMAGRMWLAASNWDDDPAEAAVVLKDCRDQLAKLGDLELAAIAGAYLAKTYAALGRLE
FT                   EAVEAAERSGTDLPLTSDPPVEALVRHTAVQIVADSGDAGAAAGLQYARAITRGWWAER
FT                   LRGLYAVRSALATHELSIRHDAEWRAAREDPLTGVANRRALDERMTAALDSGRSVAVIA
FT                   IDVDNLKIVNDSHGHACGDEVLRRVAQVLTEQSRAEDLVVRAGGDEFVVVLDNPDDRGA
FT                   RELVERIKTAADRVAASADEPWYAMLRLSIGYASSTDGVPVTELLDLADARMYAEKRDR
FT                   RAGKR"
FT   gene            complement(602164..603726)
FT                   /locus_tag="Kfla_0579"
FT   CDS_pept        complement(602164..603726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0579"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: rpi:Rpic_1171 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29700"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW43"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB29700.1"
FT                   /translation="MGMDGGPLTARIAAAMTLAQSGGHALAAAEIEAVRAELGPEPSYA
FT                   LAAAEYVRGVTAHHASDADEALAAVDDCLRVARAIDEPGWEANALPIRIINLARSDRGG
FT                   DTVADLVAAETALSRTTDPGLTAWAHTGLGYAYDVLRLYELCIPHYEVAAQSDVDVFEL
FT                   AESSAIDRLNLAETYLRWSHELERLGDPAYQQEIRERLASAAYWAREAERVVVAEDETQ
FT                   EYWRLSARLWLAAATTSQDPAAAVVELTECRDQICKLGETERLAIAGAYLARAFAASGD
FT                   LEQARAAAERAADDLITLADPATHMLVLQTRSELAADAGERGAVAGLVYARSVARSWWN
FT                   ERRRTLNAVLHALDVHDLSARHDAEWHAARQDPLTGIGNRRALDERLTAARDSQRAVTL
FT                   LAIDVDDLKTVNDSFGHACGDELLQVVANLLVEQARATDAVVRSGGDEFFVVLDQPDAK
FT                   GGYQLAERVRAAVAGIAAGTAKPWLAGLGLSIGYAATAEGVPVDQLVPLADRRLYEDKR
FT                   RTR"
FT   gene            complement(603868..605181)
FT                   /locus_tag="Kfla_0580"
FT   CDS_pept        complement(603868..605181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0580"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: rpd:RPD_0041 cytochrome
FT                   P450"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29701"
FT                   /db_xref="GOA:D2PW44"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW44"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADB29701.1"
FT                   /translation="MEVMVATYLKKWVGSRLLNRTTRRGGLDLSKMKMFPRQVSMPLRR
FT                   SGLDPVPELGQIREAAPVHKLAHLFGLNVFMVSGHAEAKAVLADSTNFSNDIRPLVGSD
FT                   PNKPSEGIGGLGFTDPPDHTRLRKLLTPEFTKRRLARLEPAIEKIVADQLDLMEAKGPV
FT                   VDLVADFAFNVPFLLIADLLGVEESDRDRFRALGPARFDLSGGGIGVFGSASESRDFLF
FT                   EIVGKQRKHPGDGLIGSIIREHGDTIDDIELGGLADGVFLGGYETSASMLALGTLVLLR
FT                   DPANFALIREDPTAVDGMVEELLRYLTVVQVAFPRFARHDQELFGHQVKKGDLVAVSLS
FT                   GADRDKTVFGPDAEEFWPRRAPAAHLAFGHGMHRCVGAELARMELRAAFTALAHRFPDL
FT                   SLAVPEQQLRFRDFSIVYGVESLPVQLHAAAKSQQAVG"
FT   gene            605825..608596
FT                   /locus_tag="Kfla_0581"
FT   CDS_pept        605825..608596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0581"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29702"
FT                   /db_xref="GOA:D2PW45"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW45"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADB29702.1"
FT                   /translation="MAGATGTKSAAGAPAAAAGRRLVIVESPKKARMIAGFLGSGYVVE
FT                   SSFGHIRDLPKGADEIPAKYKGLPWARLGVNIDDHFDPLYVVPADKKAQIRKLKDLLKD
FT                   ADELYLATDEDREGEAIAWHLLDELKPKVPVKRMVFHEITPKAIQDAVGSARQINDALV
FT                   DAQEARRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVAIRMVVDRERERIAFRSASYWD
FT                   LDATLDAGEGKTPRLFPSRLVSVDSRRVAQGRDFAPTGELKSQNTVHLDEPTATALAAA
FT                   LAESRFTVRSIESKPYTRKPYAPFRTTTLQQEAGRKLGMSASQTMQIAQRLYENGNITY
FT                   MRTDSVTLSDTAITAARAQVRELYGASYLPDKPRVYTSKVKNAQEAHEAIRPAGEVFQT
FT                   PAQTGLSGPEYRLYELIWMRTIASQMKDAAGNSVSIKIDATASTGENCEFTSSGRVITF
FT                   HGFLKAYVEGADDPSHETDDRETQIPDVAEGDVLPATEVLASGHETKPPSRFTEATLIA
FT                   QLEEREIGRPSTYASILGTIQARGYVYKKGNALVPAWLAFAVVRLLEQHFTRLVDYAFT
FT                   ASMEDVLDDVAAGNLQREGVLGRFYFGDDDLEGLQSMVSDLGDIDAREMSTFGVGPPDS
FT                   GIVVRVGRYGPYVEGPDETRANVPEDLPPDELTVDKAKELLSQPSGVEVELGTTPDTGL
FT                   KVIAKAGRYGPYVTEVLPEGAPKSAKPRTGSLLKSMSLDTVTLDDALKLLSLPRVVGKD
FT                   PESGDEITAQNGRYGPYLKKGTDSRSLQSEEQMFDITLDEALKIYAEPKQRGRRAAAPP
FT                   LKELGEDPESGKPVVVKEGRFGPYVTDGETNATLRKDDSVDTISLLRAAELLADKRARG
FT                   PVKKTAKKAPAKKTAAKKTTAKKATAKKTAATGATKKTAAKKTTKKAAAKKS"
FT   gene            608615..609058
FT                   /locus_tag="Kfla_0582"
FT   CDS_pept        608615..609058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0582"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: glo:Glov_2468
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29703"
FT                   /db_xref="GOA:D2PW46"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW46"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADB29703.1"
FT                   /translation="MATQPLGPAEVTALRLRERGERVTPARLAVVEVLAGTAEHLSAEQ
FT                   IGERAEQLRPGIHRATVYRALDALGEFGLVTHVHLGRAGTTYHLAGELAPRHLHLRCSE
FT                   CGTVLDAPGDTLEQTRRKLQRDLGFRLAPEQVALVGVCADCAD"
FT   gene            609141..612059
FT                   /locus_tag="Kfla_0583"
FT   CDS_pept        609141..612059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0583"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 42 domain 5 loop region; KEGG:
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29704"
FT                   /db_xref="GOA:D2PW47"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW47"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ADB29704.1"
FT                   /translation="MRYRREVSISVHQCGFVNRSAVGSMPVTYDHSYVEDFAPGAGVLA
FT                   PRAWLDDDSARLALTGDWSFRLSPGLADAPDDLTDPDTSAWDTISVPGHWQLQGYGAPA
FT                   YTNVVYPFPLEPPFVPTDNPTGDYVRAVTVPADWAGARIVLRFEGVDSRFAVHVDGRLV
FT                   GWSSGSRLPSEFDLTDLVAPGKEIRIAVRVHQWSAGSYVEDQDMWWLSGIFREVNLLAL
FT                   RPSAPTDVFVRAAYDHVDGAGTLVVESDVPGTVVVPELGLEVPTGEHVRLDRVEPWSAE
FT                   SPKLYDGVVRTDGGEVRLRIGFRTIAIVDGVLTVNGNRVLFNGVNRHEFHPDRGRALTE
FT                   QDMLDDVLLMKRAGINAVRTSHYPPHPHFLDLCDLHGLYVVDECDLETHGFGYEPQPPN
FT                   LPNPVMDERFRDDLVERMRRMVERDKNHPSIVLWSLGNECGMGDNLRAMYDVAKDRDPS
FT                   RPVHYERDTQAEFVDVYSQMYTSLEDVEKIGEDPSSYRGLPFILCEYGHAMGNGPGGLS
FT                   DYRELFERYPRCQGGFIWEWIDHGLRTSVDGRQFFAYGGDFGETIHDGNFVCDGLLFPD
FT                   RTPSPGMLEYVKVIEPLVITADGAGGVSITNRYEVLDTSHLTFELVTEINGEGVGFGTL
FT                   PVPAIGPGETTSVQLPPGTIKQREANRPETWLTVTARLTEGTAWAEAGHRVAWGQLRLD
FT                   DPAAADSAAAGPAAGTGSDASVAPGAVVQGTAGAHGITVGAISNARLDVWRAPTDNDAI
FT                   PGVAEAWKEAGLHRVQHRVVSAGENGSAWEVVTRTAPPALQWGLISTWRWTRVHDAIQL
FT                   DLAVRPEGQFPATLPRLGITFELPKVDSVEWFGAGPSEAYVDTRAAAAVGKYSASVAQL
FT                   QTPYVRPQENGHRIDTRWAVLTGQETLRIEAALDLFGLTVRDWTSKDLEDAKHTVDLTA
FT                   GDTTYVTLDLAQAGIGSNSCGPALPDKYRLHTAPASLSVRFS"
FT   gene            612121..612411
FT                   /locus_tag="Kfla_0584"
FT   CDS_pept        612121..612411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0584"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   cak:Caul_0214 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29705"
FT                   /db_xref="GOA:D2PW48"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW48"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ADB29705.1"
FT                   /translation="MLIIAGHVQVDPVRRDEFVAAHTDLVRRARQAPGCLDVAITADPV
FT                   DPGRVNNFERWESQESLDAWRAVAAAPDTGIAFRSVHVELYDATGARPPFG"
FT   gene            complement(612420..613388)
FT                   /locus_tag="Kfla_0585"
FT   CDS_pept        complement(612420..613388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0585"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mlr3236 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29706"
FT                   /db_xref="GOA:D2PW49"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2PW49"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADB29706.1"
FT                   /translation="MTVPAMMRALVYDPPQSVRMSKIAVPDPGPSDALVAVEYSSLNWV
FT                   EVARMELVHRPGDVVGRDSAGTVVRAAADGSGPAVGSRVVGFRPGAWAEYQAVGTVDLA
FT                   VVPGEVDLAAAAALPGAAVSALQAVRRLGAHLCPGIPPGDAPGDQSLEGHRVLVTGASG
FT                   GVGRAATQLAALTGAEVVAAVGAPERGAGLLELGAAEVVTDLAGVAPVNAVLDMVGGET
FT                   LTAAYGLLKGGGLALSIGSAGGATSSFDFEAARLRGGRRAVEAFAVSTPFGPDLEHLLQ
FT                   LLSAGLFDPQIGWQGSWHQVDEASTALLGRKVRGKAVLAID"
FT   gene            complement(613503..614102)
FT                   /locus_tag="Kfla_0586"
FT   CDS_pept        complement(613503..614102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0586"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: mxa:MXAN_2207 BioY family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29707"
FT                   /db_xref="GOA:D2PX59"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX59"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADB29707.1"
FT                   /translation="MTTAVPLPAQRPIVLADVLGRSRTRDAVLVLTAALFTAALAQIAI
FT                   PVPGSPVPITGQTLAVVLTAAALGPHRGLAGQGLYLLLGAVGLPFYSEASGGFEVIAGA
FT                   TGGYLIGFLPAAYLIGLAARHQLDRAPWKALPLFIAGQAIIFAVGVPWLAVTADLSASA
FT                   ALDAGFYPFVLGGLIKAAVAGVVLPGLWKLTDRTSH"
FT   gene            614287..616272
FT                   /locus_tag="Kfla_0587"
FT   CDS_pept        614287..616272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0587"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: dds:Ddes_0128 dTMP kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29708"
FT                   /db_xref="GOA:D2PX60"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX60"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADB29708.1"
FT                   /translation="MPEVYDPLTDPAPAHDLRAVLRIRAFRRLWIAFGLSSLGDWIGLL
FT                   ALTAMAKSFAGDDYQAANFAIGGVLFLRVLPALVMGPVAGWVADRLDRRWTMILGDLIR
FT                   AAFFVSIPLVGTLTWVLVATVLIEIVSLVWGPAKDASVPNLVPRHRLEAANQLSLITTY
FT                   GSALPAAAIFTAITLVTRGFGEFSIDLAVYVNAATFLVSGLAIVSVAEIGRAGRHEHED
FT                   HPTLWRTMVEGWSYVTGTPVVRGLVVGISGAFAAGAVVIGLGRTYVEDLDAGDPGYGVL
FT                   FGAVFGGLALGMGFAPRLFSGLSRRRLFAAGLVGSGIGLAGLALIQQIEIATMIAILLG
FT                   FCAGASWVSGYTLLGLEVPDNVRGRTFAFVQSAVRTVLALTLAVAPFVAGAIGRRTWSV
FT                   GDRSVSYNGAALTMLIAAVLAGVIGLVAWRQMDDRPGVPFWRDLRRSFGKTPGVYPTTG
FT                   LFIAFEGGEGAGKSTQSALLVKWLEERGQHVLLTREPGATDLGKTLRQIVLDPATGDIS
FT                   HRAEALIYAADKAEHVDSVIKPALKAGTVVITDRYVDSALAYQGSGRDLDLADVERVNR
FT                   WATDDLRPNLTILLDLPPKSGLGRFEERDRIEAQSADFHERVRAAFLELAAAEPQHYLV
FT                   LDATQDREQLAAQIQARLLPMLPKVG"
FT   gene            616280..617449
FT                   /locus_tag="Kfla_0588"
FT   CDS_pept        616280..617449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0588"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gsu:GSU2230 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29709"
FT                   /db_xref="GOA:D2PX61"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX61"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADB29709.1"
FT                   /translation="MTVWDDLVGQEPAVDVLRRAVSGAAARSRGERGAATAGMTHAWLI
FT                   TGPPGSGRSNAGRAFAAALQCANEGCGECTECRTALTGAHPDISLIRTELLSIRVSEIR
FT                   ELIRRAAMSPTQGRWQVMVVEDADRLTEQAADALLKSIEEPSPRTVWVLCAPTVEDVVP
FT                   TIRSRCRLLVLRTPPVGAVAEMLVRKLGVDAELASFAARAAQGHIGRARALARDEEVRA
FT                   RRTKVLELPFALRDLGACLKAAQQLAEAAKEEAKASAAAVDERERTELEQALGVGTKGA
FT                   RPREAAAAVKELEEQQKARAKRWERDVLDRSLVDLMALYRDVLVVQTGAGTELINAELR
FT                   RSIDQFASRTTPEQTIRRIDALTACRQAIEGNVAPLLALEAMTIALFEG"
FT   gene            617626..618285
FT                   /locus_tag="Kfla_0589"
FT   CDS_pept        617626..618285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29710"
FT                   /db_xref="GOA:D2PX62"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29710.1"
FT                   /translation="MTQPPVPLEPARLLPSAESWLDGVPVPAQRRLDRFAVAALAFSLP
FT                   GLVPVGLTLAAVALRRIRRNGSRGRPAALAALAISGCWVIAIAVAAALGLYGERQAGIG
FT                   RSVAIAEVRVAQCFDADLAAETLRVVRLADCAAAHSGEAYAKVRAAMTGLSTQQKGASA
FT                   TQHCATAFREFVGTSYEQSALDMYYVVLEDQAVADGNVLCMVGGERLTGTMRGSQR"
FT   gene            618315..619247
FT                   /locus_tag="Kfla_0590"
FT   CDS_pept        618315..619247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100020402"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29711"
FT                   /db_xref="GOA:D2PX63"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29711.1"
FT                   /translation="MTQPPSGGDRPQDTPRSFPSYTESGRPRLQDTPAPFVPPYSPPQQ
FT                   PPGQPFHQPPFQQQPSHQQPFPQQLDPRYPPVHGQPPYGYGYGFPGVPSRATNGLAVAA
FT                   MATGLASVLFTIAAPVAVGLGIAALVQIKRRNETGTAQAVVGLVVGGLVTLVAGGLVVA
FT                   MIVFGLTDDDSYSAGIPQPSSSATGASDPDGIYIDGLVVGECFDDTGVEDEVKRQPCNG
FT                   PHDGELYAVVTLPDHAWPGDRRMGDQAEAACDERFEQYVGISADESELEPVSWFPDAAG
FT                   WRGGDHDVYCTTYGPDEDRLDRTVKDSKR"
FT   gene            619305..620570
FT                   /locus_tag="Kfla_0591"
FT   CDS_pept        619305..620570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0591"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: dde:Dde_1593
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29712"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX64"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADB29712.1"
FT                   /translation="MVMAVSFERYGRLYYLDPGPHRPRVGDKVLVPTDDGPEVAECVWA
FT                   PQYVTEEIGGLPLCAGIATSDDLDRDEQNRQRRADARLTAKRLIRRHGLPMKVVGIDFV
FT                   DRRPDVDQLVIVYFSAPHRVDFRELVRDLARGLRARIELRQVGARDEARLQGGIGPCGR
FT                   DLCCATFLKDFEPVSVRMAKDQDLPLNPLKISGACGRLMCCLKYEHPLYQEFNAKAPSV
FT                   GTPVETPAGDGVVVGHNVPSDTVVVRLAASGRRCACSRADVCSPRQQYEASSTTTPDAP
FT                   LPVDLPTPAPAVAKATPGRDGAARTDSAPATDRGAVTDRGAVTDRGAATEGRAMAEGGA
FT                   TEAGTVTEAGAASGDEPAVRRKKPRRRRRLSESTGTESTGTEPTAGDPGEARPSSSAPD
FT                   RLSDPPVQRAPGVREDDTGDGS"
FT   gene            620570..622105
FT                   /locus_tag="Kfla_0592"
FT   CDS_pept        620570..622105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0592"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29713"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX65"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADB29713.1"
FT                   /translation="MMVRRVTAVLVSVALAAGCGVASRAQDAGDGGSAQPGANPSKGPA
FT                   GPVPAGLEKFYQQQPDWERCGSGSQCATITVPLDYSKPAGETIELRARKVPARDRTGKI
FT                   GTLFINPGGPGASGVEFAGAASFVLGSSLLRKFDVVGWDPRGVGDSTPVKCLDTEQLDA
FT                   FIAADGSPDDEAEITALNTQAKTLAEGCRQRSGKLLPHVSTKDAARDIDVLRGIVGDSE
FT                   LYYLGMSYGTYLGATYAELFPKNVGRLVLDGAVDPSNTAEQNNMAQAKGFDTALEAFAA
FT                   DCAARSCRLGGSKEEVLAKVDKLLTESDATPLPGNGDRNVPQALVVLGVIFPLYLKDYW
FT                   PRLEDAVVDGLAGNGSRLLALADEYTDRTPRGYTTNANEVIYAVNCVDRQDITSIADAK
FT                   ADAAKYQAASPRFGAFLLWGSLACANWPVKAEDKPHPIKAPGAKPIVVVGTTRDPATPY
FT                   EWAVGLAGQLESGVLVSRDGDGHTGYNEGNDCVDNAVETYLLQGTAPTADLKC"
FT   sig_peptide     620570..620647
FT                   /locus_tag="Kfla_0592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 26"
FT   gene            complement(622127..622753)
FT                   /locus_tag="Kfla_0593"
FT   CDS_pept        complement(622127..622753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0593"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: see:SNSL254_A2719 helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29714"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29714.1"
FT                   /translation="MLTPRHQALLATLAGMTVGVAVFGTVLAVNGALSNNSAAQTVVTT
FT                   TTTPTPTPIASDGLDPAVLQYVVATFGSEKSPISAEVPASWPATQSGTRARYADPTGLW
FT                   QLRFDARGSKQSPAELLDTRSGSIDEQEYKVLSTDNSTLVYTYLDKERGHRMGMSRWIA
FT                   AEGGKRSVLEITVGGRPQDEAGLRAVLERATETVQLPPTGDDRPS"
FT   sig_peptide     complement(622667..622753)
FT                   /locus_tag="Kfla_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.864 at
FT                   residue 29"
FT   gene            622840..623187
FT                   /locus_tag="Kfla_0594"
FT   CDS_pept        622840..623187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29715"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29715.1"
FT                   /translation="MEFEQALGRYTAGEAERADLKLLVKQLLKLLVAKAPGHAVEVRVP
FT                   PYGAVQCIEGPRHTRGTPGAVVELPAELWIDLALGRTTWAEARSTGKVRASGERTDLSG
FT                   LLPLVADGPDR"
FT   gene            623223..624554
FT                   /locus_tag="Kfla_0595"
FT   CDS_pept        623223..624554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0595"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: lpp:lpp1608
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29716"
FT                   /db_xref="GOA:D2PX68"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX68"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB29716.1"
FT                   /translation="MPVATSSGGRPADGEKPGIRGRLARLRVDLTPWRSSRDFRILVIS
FT                   GTVFYLGAMVGYVALPFQLYQLTGSNFAVGVMGLVTIAPLVVFGLYGGALADHVDRRKM
FT                   LIVTGIAQVAICALLLANTLLASPQVWLIYVCGALNAIASSLQRPSREALFPRVVRHED
FT                   MPAAVTLNSLTLQVGQLAGPALGGVLVGTAGVAWAFGIELVGLVAATLLFMLLGSYKTS
FT                   EHSTPPSLRAIGDGIKYAFRRRDLLGTYAVDMVGMFLAMPIVLFPAFATEVLKEPKLLG
FT                   LLYSAEAAGAMLATLTSGWARRVHHHGRAVVIATITWGASVGVAGLAPNIWFAIAFFAV
FT                   AGGADMISGLFRAVIWNQTIPDEMRGRLAGIEMLSYSLGPLGGQSRSGLVADLTSVRTS
FT                   IVSGGVLCVAGVIGTAVWLKDFWRYDARTDEHAVRERELRGSAG"
FT   gene            624666..626030
FT                   /locus_tag="Kfla_0596"
FT   CDS_pept        624666..626030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0596"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: avn:Avin_09240
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29717"
FT                   /db_xref="GOA:D2PX69"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX69"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADB29717.1"
FT                   /translation="MITGTERALQIHDPADGSPVGTIPVATAEEVDEAVGTARRLSTDW
FT                   ARTPAAERGAALREAAAAIRARADDLARINCSETGKPVEESLGGVLAGAGTLEQYAELC
FT                   PLRGGRTLLGNHNATDLMVPEPRGVVVALTPWNDPVAVACGLIGAALVTGNTVIHKPSE
FT                   RCPHTGARLGQLLTQALPEGVLQTVQGDGEVGAGLAARADVDVIAHVGSTATGRSIAAA
FT                   TAATGAKALLENGGNDPLIVDEDVDPVWAAGQAALGAFANSGQICVAVERIYVHRAVAE
FT                   PFLSALVAEAQSRVLAPLVDRRHRESVHGQVRQAVESGAELLTGGEVPDGPGAHYPATV
FT                   LSSCGPNLDVMRTETFGPVAPVAVVDSFDEALRLAADDEYGLAATVLTGSQANAQRAWR
FT                   ELPVGTVKINAVFGGAPGGAAQPRAASGAGFGYGPELLDEMSQVKVVHWEPAPGR"
FT   gene            626116..627087
FT                   /locus_tag="Kfla_0597"
FT   CDS_pept        626116..627087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK12364 gene product from transcript GK12364-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29718"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB29718.1"
FT                   /translation="MRIRPAVAVVAVLALAGCTSAGGENSPDVPPLVSVSTTPTETPSE
FT                   TPSATPSGPATAKVADTLCVRMDQALVQSTLAVPVVTIQPKAVPAEIGLPSYDLCELAL
FT                   STSPSGPVLRVGVSVLPATKADLSAAQKAYAATKGEPAKPIAVGQGGYVTSRFAVFLFD
FT                   TRLIKVAGPAATPTKYVALAQEAARQAPGLTEAAPLVTRPECERGTSAAAKVMGAEAMA
FT                   RRDGQTAAGDVVCGWITATSVLSTTARRVTDAETAMTPVRKAPTSQSVPLGDEGYIDTA
FT                   TGRGTLRVGTDKIADLVPLPAGKAKTDDMVAFALAISPLYTR"
FT   sig_peptide     626116..626187
FT                   /locus_tag="Kfla_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.777 at
FT                   residue 24"
FT   misc_binding    627138..627330
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 65.58"
FT   gene            627360..628385
FT                   /locus_tag="Kfla_0598"
FT   CDS_pept        627360..628385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0598"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pfl:PFL_2238 iron compound ABC transporter, iron
FT                   compound-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29719"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX71"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADB29719.1"
FT                   /translation="MAVVPKAVLAAVLLSLIAACGAAAEAGPRAASTTVKNCGLDIGVD
FT                   GPPERVFAAYQPAVELAHALGISDRLVGTAYLDAQVLPPYAEAQRDRKYYKNLPSREEL
FT                   LSLNPDFVLSGFNDVFSSAGSDSSFGTRGSLAQLGVQTWIFSPLCPTADGKGDEAIDPS
FT                   TVSMDNVYADLRDLGRLFGVSDRAEQVIADQQARIAAVQAKVQNAPRPTVAILRPGLEG
FT                   GGMTVSAGPDFGSVLIRQAGGVNAFAGLTSKRNVKLSVEQFIRTDPDYILVSGCCDASL
FT                   TEAQVQPEVQKILGNPALANLKAVRNKRVVPWLFAHHSAGVRGASSTELIAKIIHPDLV
FT                   K"
FT   sig_peptide     627360..627434
FT                   /locus_tag="Kfla_0598"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.742 at
FT                   residue 25"
FT   gene            628439..629428
FT                   /locus_tag="Kfla_0599"
FT   CDS_pept        628439..629428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kfla_0599"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   sme:SMa1745 ABC transporter, permease, Fe3+- siderophore
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Kfla_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB29720"
FT                   /db_xref="GOA:D2PX72"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2PX72"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADB29720.1"
FT                   /translation="MSRTGGLVLAVVVLLGVVLLSLLAGNQWFGPRDVYLAAADFTGSD
FT                   TDRVIRYLRLPRTATGLLAGAALGLAGALMQGVTRNVLADPGILGVNAGAAA