(data stored in ACNUC30630 zone)

EMBL: CP001737

ID   CP001737; SV 1; circular; genomic DNA; STD; PRO; 6060298 BP.
XX
AC   CP001737; ABUH01000000-ABUH01000096;
XX
PR   Project:PRJNA29537;
XX
DT   17-SEP-2009 (Rel. 102, Created)
DT   19-AUG-2018 (Rel. 137, Last updated, Version 8)
XX
DE   Nakamurella multipartita DSM 44233 chromosome, complete genome.
XX
KW   .
XX
OS   Nakamurella multipartita DSM 44233
OC   Bacteria; Actinobacteria; Nakamurellales; Nakamurellaceae; Nakamurella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-6060298
RX   PUBMED; 21304699.
RA   Tice H., Mayilraj S., Sims D., Lapidus A., Nolan M., Lucas S.,
RA   Glavina Del Rio T., Copeland A., Cheng J.F., Meincke L., Bruce D.,
RA   Goodwin L., Pitluck S., Ivanova N., Mavromatis K., Ovchinnikova G.,
RA   Pati A., Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Detter J.C., Brettin T., Rohde M., Goker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.,
RA   Chen F.;
RT   "Complete genome sequence of Nakamurella multipartita type strain (Y-104)";
RL   Stand Genomic Sci 2(2):168-175(2010).
XX
RN   [2]
RP   1-6060298
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Sims D., Meincke L., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Nakamurella multipartita DSM 44233";
RL   Unpublished.
XX
RN   [3]
RP   1-6060298
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Sims D., Meincke L., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (08-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 46c99d406189df15a7c11e1d706c073e.
DR   BioSample; SAMN02598467.
DR   CABRI; DSM 44233.
DR   EnsemblGenomes-Gn; EBG00001442859.
DR   EnsemblGenomes-Gn; EBG00001442860.
DR   EnsemblGenomes-Gn; EBG00001442861.
DR   EnsemblGenomes-Gn; EBG00001442862.
DR   EnsemblGenomes-Gn; EBG00001442863.
DR   EnsemblGenomes-Gn; EBG00001442864.
DR   EnsemblGenomes-Gn; EBG00001442865.
DR   EnsemblGenomes-Gn; EBG00001442866.
DR   EnsemblGenomes-Gn; EBG00001442867.
DR   EnsemblGenomes-Gn; EBG00001442868.
DR   EnsemblGenomes-Gn; EBG00001442869.
DR   EnsemblGenomes-Gn; EBG00001442870.
DR   EnsemblGenomes-Gn; EBG00001442871.
DR   EnsemblGenomes-Gn; EBG00001442872.
DR   EnsemblGenomes-Gn; EBG00001442873.
DR   EnsemblGenomes-Gn; EBG00001442874.
DR   EnsemblGenomes-Gn; EBG00001442875.
DR   EnsemblGenomes-Gn; EBG00001442876.
DR   EnsemblGenomes-Gn; EBG00001442877.
DR   EnsemblGenomes-Gn; EBG00001442878.
DR   EnsemblGenomes-Gn; EBG00001442879.
DR   EnsemblGenomes-Gn; EBG00001442880.
DR   EnsemblGenomes-Gn; EBG00001442881.
DR   EnsemblGenomes-Gn; EBG00001442882.
DR   EnsemblGenomes-Gn; EBG00001442883.
DR   EnsemblGenomes-Gn; EBG00001442884.
DR   EnsemblGenomes-Gn; EBG00001442885.
DR   EnsemblGenomes-Gn; EBG00001442886.
DR   EnsemblGenomes-Gn; EBG00001442887.
DR   EnsemblGenomes-Gn; EBG00001442888.
DR   EnsemblGenomes-Gn; EBG00001442889.
DR   EnsemblGenomes-Gn; EBG00001442890.
DR   EnsemblGenomes-Gn; EBG00001442891.
DR   EnsemblGenomes-Gn; EBG00001442892.
DR   EnsemblGenomes-Gn; EBG00001442893.
DR   EnsemblGenomes-Gn; EBG00001442894.
DR   EnsemblGenomes-Gn; EBG00001442895.
DR   EnsemblGenomes-Gn; EBG00001442896.
DR   EnsemblGenomes-Gn; EBG00001442897.
DR   EnsemblGenomes-Gn; EBG00001442898.
DR   EnsemblGenomes-Gn; EBG00001442899.
DR   EnsemblGenomes-Gn; EBG00001442900.
DR   EnsemblGenomes-Gn; EBG00001442901.
DR   EnsemblGenomes-Gn; EBG00001442902.
DR   EnsemblGenomes-Gn; EBG00001442903.
DR   EnsemblGenomes-Gn; EBG00001442904.
DR   EnsemblGenomes-Gn; EBG00001442905.
DR   EnsemblGenomes-Gn; EBG00001442906.
DR   EnsemblGenomes-Gn; EBG00001442907.
DR   EnsemblGenomes-Gn; EBG00001442908.
DR   EnsemblGenomes-Gn; EBG00001442909.
DR   EnsemblGenomes-Gn; EBG00001442910.
DR   EnsemblGenomes-Gn; EBG00001442911.
DR   EnsemblGenomes-Gn; EBG00001442912.
DR   EnsemblGenomes-Gn; EBG00001442913.
DR   EnsemblGenomes-Gn; EBG00001442914.
DR   EnsemblGenomes-Gn; EBG00001442915.
DR   EnsemblGenomes-Gn; EBG00001442916.
DR   EnsemblGenomes-Gn; EBG00001442917.
DR   EnsemblGenomes-Gn; EBG00001442918.
DR   EnsemblGenomes-Gn; EBG00001442919.
DR   EnsemblGenomes-Gn; EBG00001442920.
DR   EnsemblGenomes-Gn; EBG00001442921.
DR   EnsemblGenomes-Gn; EBG00001442922.
DR   EnsemblGenomes-Gn; EBG00001442923.
DR   EnsemblGenomes-Gn; EBG00001442924.
DR   EnsemblGenomes-Gn; EBG00001442925.
DR   EnsemblGenomes-Gn; EBG00001442926.
DR   EnsemblGenomes-Gn; EBG00001442927.
DR   EnsemblGenomes-Gn; EBG00001442928.
DR   EnsemblGenomes-Gn; EBG00001442929.
DR   EnsemblGenomes-Gn; EBG00001442930.
DR   EnsemblGenomes-Gn; EBG00001442931.
DR   EnsemblGenomes-Gn; Namu_R0001.
DR   EnsemblGenomes-Gn; Namu_R0002.
DR   EnsemblGenomes-Gn; Namu_R0003.
DR   EnsemblGenomes-Gn; Namu_R0004.
DR   EnsemblGenomes-Gn; Namu_R0005.
DR   EnsemblGenomes-Gn; Namu_R0006.
DR   EnsemblGenomes-Gn; Namu_R0007.
DR   EnsemblGenomes-Gn; Namu_R0008.
DR   EnsemblGenomes-Gn; Namu_R0009.
DR   EnsemblGenomes-Gn; Namu_R0010.
DR   EnsemblGenomes-Gn; Namu_R0011.
DR   EnsemblGenomes-Gn; Namu_R0012.
DR   EnsemblGenomes-Gn; Namu_R0013.
DR   EnsemblGenomes-Gn; Namu_R0014.
DR   EnsemblGenomes-Gn; Namu_R0015.
DR   EnsemblGenomes-Gn; Namu_R0016.
DR   EnsemblGenomes-Gn; Namu_R0017.
DR   EnsemblGenomes-Gn; Namu_R0018.
DR   EnsemblGenomes-Gn; Namu_R0019.
DR   EnsemblGenomes-Gn; Namu_R0020.
DR   EnsemblGenomes-Gn; Namu_R0021.
DR   EnsemblGenomes-Gn; Namu_R0022.
DR   EnsemblGenomes-Gn; Namu_R0023.
DR   EnsemblGenomes-Gn; Namu_R0024.
DR   EnsemblGenomes-Gn; Namu_R0025.
DR   EnsemblGenomes-Gn; Namu_R0026.
DR   EnsemblGenomes-Gn; Namu_R0027.
DR   EnsemblGenomes-Gn; Namu_R0028.
DR   EnsemblGenomes-Gn; Namu_R0029.
DR   EnsemblGenomes-Gn; Namu_R0030.
DR   EnsemblGenomes-Gn; Namu_R0031.
DR   EnsemblGenomes-Gn; Namu_R0032.
DR   EnsemblGenomes-Gn; Namu_R0033.
DR   EnsemblGenomes-Gn; Namu_R0034.
DR   EnsemblGenomes-Gn; Namu_R0035.
DR   EnsemblGenomes-Gn; Namu_R0036.
DR   EnsemblGenomes-Gn; Namu_R0037.
DR   EnsemblGenomes-Gn; Namu_R0038.
DR   EnsemblGenomes-Gn; Namu_R0039.
DR   EnsemblGenomes-Gn; Namu_R0040.
DR   EnsemblGenomes-Gn; Namu_R0041.
DR   EnsemblGenomes-Gn; Namu_R0042.
DR   EnsemblGenomes-Gn; Namu_R0043.
DR   EnsemblGenomes-Gn; Namu_R0044.
DR   EnsemblGenomes-Gn; Namu_R0045.
DR   EnsemblGenomes-Gn; Namu_R0046.
DR   EnsemblGenomes-Gn; Namu_R0047.
DR   EnsemblGenomes-Gn; Namu_R0048.
DR   EnsemblGenomes-Gn; Namu_R0049.
DR   EnsemblGenomes-Gn; Namu_R0050.
DR   EnsemblGenomes-Gn; Namu_R0051.
DR   EnsemblGenomes-Gn; Namu_R0052.
DR   EnsemblGenomes-Gn; Namu_R0053.
DR   EnsemblGenomes-Gn; Namu_R0054.
DR   EnsemblGenomes-Gn; Namu_R0055.
DR   EnsemblGenomes-Gn; Namu_R0056.
DR   EnsemblGenomes-Tr; EBT00001820423.
DR   EnsemblGenomes-Tr; EBT00001820424.
DR   EnsemblGenomes-Tr; EBT00001820425.
DR   EnsemblGenomes-Tr; EBT00001820426.
DR   EnsemblGenomes-Tr; EBT00001820427.
DR   EnsemblGenomes-Tr; EBT00001820428.
DR   EnsemblGenomes-Tr; EBT00001820429.
DR   EnsemblGenomes-Tr; EBT00001820430.
DR   EnsemblGenomes-Tr; EBT00001820431.
DR   EnsemblGenomes-Tr; EBT00001820432.
DR   EnsemblGenomes-Tr; EBT00001820433.
DR   EnsemblGenomes-Tr; EBT00001820434.
DR   EnsemblGenomes-Tr; EBT00001820435.
DR   EnsemblGenomes-Tr; EBT00001820436.
DR   EnsemblGenomes-Tr; EBT00001820437.
DR   EnsemblGenomes-Tr; EBT00001820438.
DR   EnsemblGenomes-Tr; EBT00001820439.
DR   EnsemblGenomes-Tr; EBT00001820440.
DR   EnsemblGenomes-Tr; EBT00001820441.
DR   EnsemblGenomes-Tr; EBT00001820442.
DR   EnsemblGenomes-Tr; EBT00001820443.
DR   EnsemblGenomes-Tr; EBT00001820444.
DR   EnsemblGenomes-Tr; EBT00001820445.
DR   EnsemblGenomes-Tr; EBT00001820446.
DR   EnsemblGenomes-Tr; EBT00001820447.
DR   EnsemblGenomes-Tr; EBT00001820448.
DR   EnsemblGenomes-Tr; EBT00001820449.
DR   EnsemblGenomes-Tr; EBT00001820450.
DR   EnsemblGenomes-Tr; EBT00001820451.
DR   EnsemblGenomes-Tr; EBT00001820452.
DR   EnsemblGenomes-Tr; EBT00001820453.
DR   EnsemblGenomes-Tr; EBT00001820454.
DR   EnsemblGenomes-Tr; EBT00001820455.
DR   EnsemblGenomes-Tr; EBT00001820456.
DR   EnsemblGenomes-Tr; EBT00001820457.
DR   EnsemblGenomes-Tr; EBT00001820458.
DR   EnsemblGenomes-Tr; EBT00001820459.
DR   EnsemblGenomes-Tr; EBT00001820460.
DR   EnsemblGenomes-Tr; EBT00001820461.
DR   EnsemblGenomes-Tr; EBT00001820462.
DR   EnsemblGenomes-Tr; EBT00001820463.
DR   EnsemblGenomes-Tr; EBT00001820464.
DR   EnsemblGenomes-Tr; EBT00001820465.
DR   EnsemblGenomes-Tr; EBT00001820466.
DR   EnsemblGenomes-Tr; EBT00001820467.
DR   EnsemblGenomes-Tr; EBT00001820468.
DR   EnsemblGenomes-Tr; EBT00001820469.
DR   EnsemblGenomes-Tr; EBT00001820470.
DR   EnsemblGenomes-Tr; EBT00001820471.
DR   EnsemblGenomes-Tr; EBT00001820472.
DR   EnsemblGenomes-Tr; EBT00001820473.
DR   EnsemblGenomes-Tr; EBT00001820474.
DR   EnsemblGenomes-Tr; EBT00001820475.
DR   EnsemblGenomes-Tr; EBT00001820476.
DR   EnsemblGenomes-Tr; EBT00001820477.
DR   EnsemblGenomes-Tr; EBT00001820478.
DR   EnsemblGenomes-Tr; EBT00001820479.
DR   EnsemblGenomes-Tr; EBT00001820480.
DR   EnsemblGenomes-Tr; EBT00001820481.
DR   EnsemblGenomes-Tr; EBT00001820482.
DR   EnsemblGenomes-Tr; EBT00001820483.
DR   EnsemblGenomes-Tr; EBT00001820484.
DR   EnsemblGenomes-Tr; EBT00001820485.
DR   EnsemblGenomes-Tr; EBT00001820486.
DR   EnsemblGenomes-Tr; EBT00001820487.
DR   EnsemblGenomes-Tr; EBT00001820488.
DR   EnsemblGenomes-Tr; EBT00001820489.
DR   EnsemblGenomes-Tr; EBT00001820490.
DR   EnsemblGenomes-Tr; EBT00001820491.
DR   EnsemblGenomes-Tr; EBT00001820492.
DR   EnsemblGenomes-Tr; EBT00001820493.
DR   EnsemblGenomes-Tr; EBT00001820494.
DR   EnsemblGenomes-Tr; EBT00001820495.
DR   EnsemblGenomes-Tr; Namu_R0001-1.
DR   EnsemblGenomes-Tr; Namu_R0002-1.
DR   EnsemblGenomes-Tr; Namu_R0003-1.
DR   EnsemblGenomes-Tr; Namu_R0004-1.
DR   EnsemblGenomes-Tr; Namu_R0005-1.
DR   EnsemblGenomes-Tr; Namu_R0006-1.
DR   EnsemblGenomes-Tr; Namu_R0007-1.
DR   EnsemblGenomes-Tr; Namu_R0008-1.
DR   EnsemblGenomes-Tr; Namu_R0009-1.
DR   EnsemblGenomes-Tr; Namu_R0010-1.
DR   EnsemblGenomes-Tr; Namu_R0011-1.
DR   EnsemblGenomes-Tr; Namu_R0012-1.
DR   EnsemblGenomes-Tr; Namu_R0013-1.
DR   EnsemblGenomes-Tr; Namu_R0014-1.
DR   EnsemblGenomes-Tr; Namu_R0015-1.
DR   EnsemblGenomes-Tr; Namu_R0016-1.
DR   EnsemblGenomes-Tr; Namu_R0017-1.
DR   EnsemblGenomes-Tr; Namu_R0018-1.
DR   EnsemblGenomes-Tr; Namu_R0019-1.
DR   EnsemblGenomes-Tr; Namu_R0020-1.
DR   EnsemblGenomes-Tr; Namu_R0021-1.
DR   EnsemblGenomes-Tr; Namu_R0022-1.
DR   EnsemblGenomes-Tr; Namu_R0023-1.
DR   EnsemblGenomes-Tr; Namu_R0024-1.
DR   EnsemblGenomes-Tr; Namu_R0025-1.
DR   EnsemblGenomes-Tr; Namu_R0026-1.
DR   EnsemblGenomes-Tr; Namu_R0027-1.
DR   EnsemblGenomes-Tr; Namu_R0028-1.
DR   EnsemblGenomes-Tr; Namu_R0029-1.
DR   EnsemblGenomes-Tr; Namu_R0030-1.
DR   EnsemblGenomes-Tr; Namu_R0031-1.
DR   EnsemblGenomes-Tr; Namu_R0032-1.
DR   EnsemblGenomes-Tr; Namu_R0033-1.
DR   EnsemblGenomes-Tr; Namu_R0034-1.
DR   EnsemblGenomes-Tr; Namu_R0035-1.
DR   EnsemblGenomes-Tr; Namu_R0036-1.
DR   EnsemblGenomes-Tr; Namu_R0037-1.
DR   EnsemblGenomes-Tr; Namu_R0038-1.
DR   EnsemblGenomes-Tr; Namu_R0039-1.
DR   EnsemblGenomes-Tr; Namu_R0040-1.
DR   EnsemblGenomes-Tr; Namu_R0041-1.
DR   EnsemblGenomes-Tr; Namu_R0042-1.
DR   EnsemblGenomes-Tr; Namu_R0043-1.
DR   EnsemblGenomes-Tr; Namu_R0044-1.
DR   EnsemblGenomes-Tr; Namu_R0045-1.
DR   EnsemblGenomes-Tr; Namu_R0046-1.
DR   EnsemblGenomes-Tr; Namu_R0047-1.
DR   EnsemblGenomes-Tr; Namu_R0048-1.
DR   EnsemblGenomes-Tr; Namu_R0049-1.
DR   EnsemblGenomes-Tr; Namu_R0050-1.
DR   EnsemblGenomes-Tr; Namu_R0051-1.
DR   EnsemblGenomes-Tr; Namu_R0052-1.
DR   EnsemblGenomes-Tr; Namu_R0053-1.
DR   EnsemblGenomes-Tr; Namu_R0054-1.
DR   EnsemblGenomes-Tr; Namu_R0055-1.
DR   EnsemblGenomes-Tr; Namu_R0056-1.
DR   EuropePMC; PMC6624747; 31333602.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001737.
DR   SILVA-SSU; CP001737.
DR   StrainInfo; 125393; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082773
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Nakamurella multipartita Y-104, DSM 44233
CC   Culture Collection ID :: DSM 44233, ATCC 700099, JCM 9543, CCM 4621
CC   GOLD Stamp ID         :: Gi02230
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Actived sludge cultured in fed-batch
CC                            reactors
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   pH                    :: 7
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sludge
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6060298
FT                   /organism="Nakamurella multipartita DSM 44233"
FT                   /strain="DSM 44233"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:479431"
FT                   /culture_collection="DSM:44233"
FT                   /type_material="type strain of Nakamurella multipartita"
FT   gene            176..1849
FT                   /locus_tag="Namu_0001"
FT   CDS_pept        176..1849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: sat:SYN_02051 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76439"
FT                   /db_xref="GOA:C8XHU8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHU8"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACV76439.1"
FT                   /translation="MSHEETDNQLLPVWRSVVADLEPTLSQQQRAWLSLTQPVGLLGST
FT                   ALLAAPSEFAKEAIERSLRDAIATALSRHLGQPIKLAVTVSEEMEPVVEPADRRYPRDR
FT                   PPAAPTDSFPGPVNGSIHGGGPGTPNGSGLNGSTGGVGINGRPGGFRDQGGFGGPHRVG
FT                   FDGNGATDTGFDGPDEDEDDDLDAGDAVATVTEIWPTYSTRRDQAPPNAAQSRLNEKYS
FT                   FETFVIGASNRFAHAAAVAVAEAPAVAYNPLFIWGDSGLGKTHLLHGIGHYAQRLFPGM
FT                   RVRYVSSEEFTNDFINSLRDDRKVAFQRRYRDVDVLLVDDIQFLEGKEGTQEEFFHTFN
FT                   TLYNANKQIVISSDRPPKRLETLEDRMRTRFEWGLITDIQPPELETRIAILRKKAALDR
FT                   MNAPDDVLEFIASRIERNIRELEGALIRVTAFASLNKQAVDLALAQIVLRDLVRDAVSN
FT                   DIDAATIMAVTAEYFNVTLDELCGPVKTKQIAMARQIAMYLCRELTDLTLPKIGATFGG
FT                   RDHTTVMHATKKIRTELAERRQTYDHVQELTARIRDRARR"
FT   gene            2436..3662
FT                   /locus_tag="Namu_0002"
FT   CDS_pept        2436..3662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppf:Pput_0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76440"
FT                   /db_xref="GOA:C8XHU9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHU9"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACV76440.1"
FT                   /translation="MKFRVARDDLADAVAWVAKSLPARPPVPVLGGILLEVSGSTLTVA
FT                   GFDYEVSTRATLTVDTLDELEPDAPGGPAGTDRVLVSGRLLAEITRSLPAKPVDLAVLG
FT                   PKVSIVAGSARFTLPTMPVEDYPPLPQMPAASGTVDSAEFAEAVAQTAIAAGRDDTLPM
FT                   LTGIRVEIDGDRLTLAATDRFRLAVRELGWHPDQENLSTAVLVPARTLADAAKTLGGAK
FT                   QVTVALGEGLLGLDAGDRRTTVRLLDVEFVKYRSLLPTSHTTTVEVPVAALGESIKRVA
FT                   LVTDRGHHLRLQVGEGALTLTAGGDDEGRAEEDLPAEVDGEELLIAFNPSYLLDGLGVV
FT                   HADTVRLSFTTPARPALLVPIVKSDEPAESAEAAAEAAATPDIDADGVGSDEDTPAYRY
FT                   LVMPARLPG"
FT   gene            3747..4652
FT                   /locus_tag="Namu_0003"
FT   CDS_pept        3747..4652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; NADP oxidoreductase coenzyme F420-dependent; KEGG:
FT                   scl:sce3546 6-phosphogluconate dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76441"
FT                   /db_xref="GOA:C8XHV0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV0"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACV76441.1"
FT                   /translation="MQLGLIGLGKMGANMAERLRRDGHQVVGFDRSPQAPRDVDSLEGL
FT                   VAALTTTPRVVWVMVPSGEPTRATVAALGELLSPGDIIIDGGNSEYVDDKAHAAALAPK
FT                   GIRYLDCGVSGGVWGITEGYALMVGGDADAVAVAQPIFDSLKPPTGGFVHAGPVGSGHF
FT                   VKMIHNGIEYGIMQAYGEGYELMKAVDWVTNPDEVMASWQNGTVIRSWLLDLLVRALDA
FT                   DPGLSQIRGYAQDSGEGRWTIEAAIENAVPMPVITAALFARFASRQTDSPTMKVVAALR
FT                   NQFGGHPVGTEGSDASVPIA"
FT   gene            4728..5870
FT                   /locus_tag="Namu_0004"
FT   CDS_pept        4728..5870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: gsu:GSU0002 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76442"
FT                   /db_xref="GOA:C8XHV1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV1"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACV76442.1"
FT                   /translation="MYVRHLALTDFRSWPAVDVPLQPGVNVLVGRNGTGKTNLMEALGY
FT                   LATLGSHRVATDAPLVRSGCTRSILRAAVVSGDRELLLEMEIARDRRNTARINRAPLTR
FT                   PRDLLGVLRTVLFAPEDLALVRGDPTERRRFLDEVLMMRAPRLAGVKADYDRVLKQRNA
FT                   LLKTAGAARRTGDLSTLDAWDEHLVAAGAELIHARLALVAQLRPPVTAAYADVAGADQV
FT                   VDLVYRSTVPLGPDPASAAGTIAVPDRAALAEAMLAELGRMRSKELERGICLVGPHRDD
FT                   LELLLGTDPAKGYASHGESWSFALALRLASFSLLRSDGVDPVLILDDVFAELDAGRRGR
FT                   LAELVAGAEQVLITAAVGADVPGALGGVRLAIGDGTVGPG"
FT   gene            5927..6493
FT                   /locus_tag="Namu_0005"
FT   CDS_pept        5927..6493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   pca:Pcar_2226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76443"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV2"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACV76443.1"
FT                   /translation="MPEDPAPRVPSGSGPSGSAGRGSDLAREALAAARASNAARRKAAG
FT                   RTPRTGSGSAGNLRRRRWSGSGPDAARDPQPLGLTMRSWVKAAGTGADLTKATLFGRWE
FT                   KIVGDEVAQRCSPTSLVDGELVVQAESTAWATQIRMLAPQLLVKINAELGPRTVIRIRA
FT                   KGPAGPSWRFGERHVRGRGPRDTYG"
FT   gene            complement(6560..7174)
FT                   /locus_tag="Namu_0006"
FT   CDS_pept        complement(6560..7174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3545 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76444"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76444.1"
FT                   /translation="MSLDLTVSSASPSVPPSAPSAPALRAVGLAAVGRDLDRLSRVLAE
FT                   PVTAVRRAALVAHIGFLVDQIRVADPDLAERQAGPLSRLRHESRCWSREPGRREALLGT
FT                   VRQAAAALGPAIAARSDVPPPTGRPDPAPPIALRDLPTQHPTALAYRYFWLLDELPPAA
FT                   AATVVGRYRGSVRWVLRNVLSGGYNRRAYLMWFGGGTGPAL"
FT   gene            7832..9844
FT                   /locus_tag="Namu_0007"
FT   CDS_pept        7832..9844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0007"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gur:Gura_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76445"
FT                   /db_xref="GOA:C8XHV4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACV76445.1"
FT                   /translation="MTTKKNEYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEV
FT                   VDNSVDEAMAGYADRVEVILRADGGVTVIDNGRGIPVEMHPKEKKPTVEVVLTVLHAGG
FT                   KFDSDSYAVSGGLHGVGVSVVNALSTRLDVEIHRDGHAYRQSYRYAKPGPLETIGPSSR
FT                   TGSSVTFWPDGEIFETVEFKLETISRRLQEMAFLNKGLTITLRDERRTDVELEEIAESG
FT                   ANAVPVEAEPTTPAKAWKPLERTFHYPGGLVDYIKHLNHTKDPIHPSIVGFESKGETME
FT                   VEVAMQWNSSYNESVHSFANTINTHEGGTHEEGFRSSLTSVVNKYATDKKLLKEKDDKL
FT                   SGEDVREGLAAIISIRLREPQFEGQTKGKLGNTEAKSFVQKACNEWIADWFERNPSEAK
FT                   TIISKAVSSAQARAAARKARDLVRRKGALEIGGLPGKLADCRSTDPSKSELYIVEGDSA
FT                   GGSAKSGRDSMFQAILPIRGKIINVEKARIDRVLRNTEVQSLITALGTGIHDDFDLAKL
FT                   RYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLVEAGHVYLAQPPLYKIKWSKGAHEFA
FT                   YSDRERDGLIAEGERAGRRMIKDEGVQRYKGLGEMNAKELWETTMDPANRLLLQVTLED
FT                   AATADELFSVLMGEDVEARRAFITRNAKDVRFLDL"
FT   gene            10015..12510
FT                   /locus_tag="Namu_0008"
FT   CDS_pept        10015..12510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0008"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: dal:Dalk_0487 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76446"
FT                   /db_xref="GOA:C8XHV5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV5"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACV76446.1"
FT                   /translation="MTGPNSGEHDRTEPVDIQQEMQRSFIDYAMSVIVSRALPDVRDGL
FT                   KPVHRRVLYGMYDSGFRPDRSTVKSSRVVGDVMGNYHPHGDSPIYDTVVRMAQPWSLRY
FT                   PMIDGQGNFGSMGNDPPAAMRYTECRLTQLAMLMLDGIGEKTVDMVPNYDNKTVEPTVL
FT                   PARIPNLLVNGSSGIAVGMATNIPPHNLREVASAVVWFLENPEASPEELLEASMERIQG
FT                   PDFPTGALIVGKDGIADAYRTGRGSIRMRAVVNIEEDAKGRTILVVTELPYQVNPDNLV
FT                   EAIAGLHKDGKIAGIADIADESSDRIGMRLVITLKRDAVAKVVLANLFKHTALQTSFGA
FT                   NMLAIVDGVPRTLRLDQMISLYVAHQVEVIVRRTQYRLDKAEERAHILRGLVKALDMLD
FT                   EVIALIRRSPSAEESKAGLMELLDVDEIQATAILDMQLRRLAALERQRIIDELAELERV
FT                   IADLKDILAKPERQRAIIRDELTEAVDKHGDDRRTRLVPYDGDVSVEDLIAVEDVVVTI
FT                   TRTGYAKRTKTDLYRAQRRGGKGVQGAALKQDDIVAHFFVCSTHDWILFFTNKGRVYRA
FT                   KAYELPEANRNARGQHVANLLAFQPDERIAEVIQIPHYQAAPYLVLATKGGLVKKSELA
FT                   AFDSNRAGGIVAVNLRDDDELVGAVLCDANADLLLISAEGQSIRFHATDETLRPMGRAT
FT                   SGVLGMRFNAGDELLSMSVVYEGAQVLVATERGYAKRTDIDEYPVQGRGGKGVLTIQYD
FT                   RRRGKLVGALIVDLDTEVYAITSGAGVIRTQAREVRKAKRQTMGVRLMNLSEGDSLVAI
FT                   ARNADDADTVDSGPAGGSS"
FT   gene            12723..13046
FT                   /locus_tag="Namu_0009"
FT   CDS_pept        12723..13046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76447"
FT                   /db_xref="GOA:C8XHV6"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76447.1"
FT                   /translation="MLKISLIVAIVMFFVWMIAVGILYLTMGGMGVWSRINDTFSTLTS
FT                   SPDVQAAGKTDLITAGRVFGVTAIVGAINIVLFTALATVAAFIYNAAAAMSGGVELTLG
FT                   ERD"
FT   gene            13125..14000
FT                   /locus_tag="Namu_0010"
FT   CDS_pept        13125..14000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0010"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   ppw:PputW619_2664 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76448"
FT                   /db_xref="GOA:C8XHV7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV7"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ACV76448.1"
FT                   /translation="MGSIFTTIALPVALAIVMFGLGLGLTRQDFGLILKHPKVTLVALA
FT                   CQVIVMPVVCFGLVLAFGLPPELAVGMMLLAAAPGGTSANLVSHVFRGDVALNISLTAV
FT                   NSVLALVTLPVMVNLSAQYFDVQSVQMGSPFQVVRDVFVIVLLPVILGMLTRAWRPGWA
FT                   QRMDRPVRLVSAVILVLVLLGAIAANWDLLRVEFGRLAMITVLFCLISLSVGLLVPRWF
FT                   GATRRQSIATSFEIGIHNATLAIVVAQTVLNSVELSLPAAVYGVLMVPLALGFGALLRT
FT                   RVRLRPDPVV"
FT   gene            14272..14348
FT                   /locus_tag="Namu_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            14272..14348
FT                   /locus_tag="Namu_R0001"
FT                   /product="tRNA-Ile"
FT   gene            14470..14616
FT                   /locus_tag="Namu_0011"
FT   CDS_pept        14470..14616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76449"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76449.1"
FT                   /translation="MKKILLLLAVLGGIAFLVQRRRQAAAAEAALWDEATKPTSTGYPG
FT                   PAS"
FT   sig_peptide     14470..14544
FT                   /locus_tag="Namu_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.562 at
FT                   residue 25"
FT   gene            14660..14735
FT                   /locus_tag="Namu_R0002"
FT                   /note="tRNA-Ala2"
FT   tRNA            14660..14735
FT                   /locus_tag="Namu_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(14767..15525)
FT                   /locus_tag="Namu_0012"
FT   CDS_pept        complement(14767..15525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0012"
FT                   /product="triosephosphate isomerase"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: eca:ECA0867
FT                   putative triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76450"
FT                   /db_xref="GOA:C8XHV9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHV9"
FT                   /inference="protein motif:PFAM:PF00121"
FT                   /protein_id="ACV76450.1"
FT                   /translation="MARLLIGSSLKMYFGHRQTLDWVRAVAAICTEHPATVSGAVEFFV
FT                   IPTFPSIPAVVEIARPAGIAVGAQDLHWADSGPFTGEVSAAELAELGCTLAEVGHAERR
FT                   SLFGETDEMVAGKTHAALRHGLAPVECVGEPDQGPAELAVQVCLDQLERALAPARAAGT
FT                   GGRLIVAYEPVWAIGAPTPAPPEHVRAVCGALREHLRADPLFPDAAVIYGGSAGPGLLP
FT                   TIVDAVDGMFLGRFAHDPQAVRAVLDEVER"
FT   gene            complement(15562..16848)
FT                   /locus_tag="Namu_0013"
FT   CDS_pept        complement(15562..16848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0013"
FT                   /product="Ribulose-bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="PFAM: ribulose bisphosphate carboxylase large chain;
FT                   KEGG: bbr:BB1035 putative ribulose bisphosphate
FT                   carboxylaseoxygenase,large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76451"
FT                   /db_xref="GOA:C8XHW0"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW0"
FT                   /inference="protein motif:PRIAM:4.1.1.39"
FT                   /protein_id="ACV76451.1"
FT                   /translation="MPARSKFGDMFSLSETIRGADYLLATYYLSMPAEADVLGKAAGYA
FT                   VGQTIGTWIEVPGVTDEMRDRHRGRVVKVLEAPPVDLSTQAEATSGYFIQIALPTVNFG
FT                   ASIPMMLATCIGNDISTSVQAKLVDIEIPDSLAQELVGPRFGIEGVRELVGVRDRPLVL
FT                   NMIKPCTGLTPEQGAAIFYDTALGGVDLIKDDELLGNPPFSPVVDRVKAYLAAADRARD
FT                   VTGRDVVYIPNVTDRPDRMLDTARRAVDAGARAVMIAYASAGFGSLQSLAESIGVPILA
FT                   HYAGVTPYFEGPGTGLSAPIALGMLPRLAGGDMVLTITPYGGYPLRRLQYLKMVQQLQL
FT                   SRPHIAPAFPVVGGGVHPGTVQTYVDELGPDIILGAGGAIQGHPDGAAAGADAMRQAID
FT                   AVMAGRSVVEAGQEHPALGRALDRFGTTV"
FT   gene            16936..17670
FT                   /locus_tag="Namu_0014"
FT   CDS_pept        16936..17670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0014"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   sil:SPO1071 glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76452"
FT                   /db_xref="GOA:C8XHW1"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW1"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ACV76452.1"
FT                   /translation="MKPFLLLAIRAEHVAADDEYAAMLRRTGLPEHELVRIRLERQPLG
FT                   GIDLDDWSGVILGGGPYQASDPPETKSATQHRVEAELSALLDEVVARDFPFLGCCYGIG
FT                   TLGRHQGAVVDRTFGEPIGGIRVRVNDAGRSDPLLAGAGPEFGAYVGHKEAIRELPTHA
FT                   VPLASSADCPVQAFRVGTRVYATQFHPELDLDGLATRIEAYRYAGYFPPEEADAVLAAA
FT                   RASGITQTPNLLGRFVELFARD"
FT   gene            17674..18018
FT                   /locus_tag="Namu_0015"
FT   CDS_pept        17674..18018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_0574 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76453"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76453.1"
FT                   /translation="MDLAERVDRAVRRMPPGVRALTASQGDRTVAHHWSPPEPTDLRSL
FT                   TNGYGIWSCGDGRYFGDGTGGQYLVVDPERELAVTVLSGDSHMDAIQDALAPLVRRAAP
FT                   AVSRPPGDGG"
FT   gene            18068..19756
FT                   /locus_tag="Namu_0016"
FT   CDS_pept        18068..19756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0016"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76454"
FT                   /db_xref="GOA:C8XHW3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW3"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACV76454.1"
FT                   /translation="MSDPMSTTDPSRLNRAQRRRSLDRATGDQYDVLVIGAGVTGAGCA
FT                   LDAATRGLRVVLVEAGDIAIGTSSRSGKIFHGGLRYLEQYNFGLVAHAIVERDLQVKTL
FT                   SPHLTRPEPFLYPLSKHWERPYAGAGILLYDIFGLRGRGVPRHRHLTRGGVIRHAPSMD
FT                   PDVITGGIQYYDVRMDDARHTLTVVRTAAAFGAEVITDAPVVELLTAGDQVVGAVITDG
FT                   PGGARHEIRAKVVVNAAGSWAADLQQLAGRHTFDVQPSKGVHLLLRGDAIDAATGILAR
FT                   ASDSVIIARRWWDYWLVGTTDTPWDGDRGSPRPEVDDVEYLLRELNHFLRRKVQPDDVL
FT                   GVYAGVRPLLRPVATGADTDTTSALSRDHSVMPGPDGLITIVGGKYTTYRLMAQDTIDA
FT                   AVATGRLGDVPAGITTTTPLLGAAGWAGLRNRVGALAAEHGLSAAQIERLLSRYGNQIH
FT                   DVLAAGADDPALIVPRPDWAGYLPAELRYAVTAEGALTLTDVMMRRTHLAIELPDGGHD
FT                   AAPAVAELLRPVAGWDGPAADRQVAAYRAAVAADREALHTVQAGR"
FT   gene            complement(19821..21164)
FT                   /locus_tag="Namu_0017"
FT   CDS_pept        complement(19821..21164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0017"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: azc:AZC_1515 amidase; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76455"
FT                   /db_xref="GOA:C8XHW4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW4"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACV76455.1"
FT                   /translation="MNDLVGLGAAFRSGELSPTEHVDDVLARLSGDRLNTVITLNADRA
FT                   RAQASRLADEAAQGHWRGPLHGIAVGVKDLIDVQGLPTRCGSHVLDDAPPADADAPVVA
FT                   ALRAAGAIVVAKMHTQEFAHGPTGDAAATGPAHNPHDPTRITGGSSSGSAAAVAAGYLP
FT                   LALGTDTGCSVRTPAALCGVVGLKPTYGRLSTHGVFPLAESLDHVGFLTTDVAAAQLAW
FT                   SVLGGTADAGARIAGLRVGVLVDDYWRAADPAIDPWATAAVEVLAAAGAEPVAVRTPMI
FT                   EELVAAYPVIVGNEAYTTHAGWLAERGQDYQPLIRERLLGFADRPAREYIGAQRTRHRL
FT                   VAALRAALDGAGGGAGGGGVDVLVLPTTRIRATPIGAPTTRIDGTDVPVRPALLALNSP
FT                   FNLTGWPAVSVPAPVDGLPIGVQVVGVRVAERGVLDVAAALERAWRPA"
FT   gene            21499..21855
FT                   /locus_tag="Namu_0018"
FT   CDS_pept        21499..21855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76456"
FT                   /db_xref="InterPro:IPR041385"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76456.1"
FT                   /translation="MVAEPIGEAKSSGLSAFGRSVPGSTSPVPAAESATGRPADRPRQL
FT                   RIGDRVRSFVDDVCVSVGLTGLVVNVAPPRYGAPARARILWDNETVSMADAHTFEVLVE
FT                   GEATAAQDDDSRVA"
FT   gene            21877..23046
FT                   /locus_tag="Namu_0019"
FT   CDS_pept        21877..23046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76457"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW6"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3510"
FT                   /protein_id="ACV76457.1"
FT                   /translation="MALTHRQLNRATLARQLLLGRERCGVADAVGRVVALQAQDAASPY
FT                   LALWNRIEAFDPDDLTAAYADHRVLKAPLMRITLHAVRAEDYPAFRRAMISSLRASRVG
FT                   DRRFRGLGIAVEQADALVPDLLTFLREPRTNAEIDGWVRQRCGELPAPGVWWALRTYGP
FT                   FVHAPTGGPWSFGPRPAYRAAPAVPLGRHLGGTDQAGDRTGEQAAIRSLIGRYLDGFGP
FT                   AAIADIAQFTLLRRSVIRDAAATMDDLVAMTGPEGGALLDRPPGPLPDPDTVAPPRLLG
FT                   MWDNVLLAYADRSRLIPPAYRRHVIKQNGDVLPTVLIDGQVAGTWRPVDGRIEIGAFHP
FT                   LTEPDWAALEVEAAALHAMLADREPPIYRRFAHWWVKGLPIEQTRRLAG"
FT   gene            23132..25150
FT                   /locus_tag="Namu_0020"
FT   CDS_pept        23132..25150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_0790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76458"
FT                   /db_xref="InterPro:IPR027787"
FT                   /db_xref="InterPro:IPR027788"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW7"
FT                   /inference="similar to AA sequence:KEGG:M446_0790"
FT                   /protein_id="ACV76458.1"
FT                   /translation="MGLQQWAAKLAGPGDQTGLLVAAAIAPGTFEPSLVPRSLPDQAIV
FT                   TGIGTTLSYVLTVATQDSIEALASGLAGRVGRGSAPTRQRRAALLIDLAVIPVGLAAAG
FT                   ALRRRPQESTLRGVARQVAWRTGVTGLGASLFTLTELGLTAADGALGAGGRIARIPLGA
FT                   PVGLGVGLALEAYRRRGLPAEPVTTDAPATEPLRAAVASVGVVGIVSVGALAQRLLADG
FT                   TAALLAGVLPGGRVVWRPMGHVLTLAAVAGAGTVLWHRAIRSIEAGTNVIEPIIDDEGG
FT                   RRWVGEHASGSANSLIPWATLGREGRRHVLLYPRPQPVRDLPVSLPDLAISSVMGEPAA
FT                   AEPALVYVGLDSAPTAQARVDLALAEMDRVGAWDRSLIMLCSPTGSGYLNYCATAAASY
FT                   LTRGDLAIVTMQYSKRPSPLSLFKVKDAREQNRLLWLAISARLRERSGPRPRAVLFGES
FT                   LGAHTSQDVLLHWGTLGPQALGIDRALWIGTPYGSGWMHQVTGEPRPDVDPNLVAMVND
FT                   FEQLQALPESHRATLRYVMVSHDNDGVTKFGADLLTRRPAWLTDARPAVQIVPGASPRG
FT                   IPARLRWRPITSFLHGLMDMKNAQKMQGYRAWAHDYRPDIARFVAQVYDLPATPAQLAR
FT                   IETALQAREEIRDRLLSQHLDAMTPSPDRFVPPAPER"
FT   gene            25256..26371
FT                   /locus_tag="Namu_0021"
FT   CDS_pept        25256..26371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76459"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW8"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1158"
FT                   /protein_id="ACV76459.1"
FT                   /translation="MTGVRVLVGTRKGAFVLTADGSRRDWQVSGPHFAGWEIYHVAGSP
FT                   AEPNRLYASQSSGWFGQVVQRSDDGGRTWAPQPGTFSYEGEVGPHQYYDGTPRPWSFTR
FT                   VWHFEPTREDPDTVYAGVEDAALFRTTDGGASWQELPALRQHRTGPDWAPGAGGMCLHT
FT                   IILDPKKADRIYAAISAAGVFRSDDAGASWRPINQGLHSEGIPDQQAEVGHCVHHVAQH
FT                   PDRPDVLYMQKHWDVMRSNDSGESWTEISGNLPTDFGFPIAVHAHEPDTVYVLPITSDA
FT                   NHVVMDGKLRVYRSRTGGHEWEPLTAGLPQQNCYVNVLRDAMAVDTLDECGLYFGTTGG
FT                   QVYASADSGDSWAPIVRDLPAVLSVEVQTLP"
FT   gene            26368..26676
FT                   /locus_tag="Namu_0022"
FT   CDS_pept        26368..26676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76460"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76460.1"
FT                   /translation="MTTTAIRVILPAHLRELAHVHGEVELDVDGPVTQRSVLDALEAQL
FT                   PVLVGRVRDHQTQQRRGFVRFYACQEDLSHEPPDDPLPAAVAQGQEPFMIVGAMAGG"
FT   gene            complement(26723..27106)
FT                   /locus_tag="Namu_0023"
FT   CDS_pept        complement(26723..27106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76461"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76461.1"
FT                   /translation="MATDPHMVFLGFGKYARSDKIFALEPIRGEDRGEGRRTQVWVDGL
FT                   GNPIIASRTERTILGDMGQERAAQSYLLDEALELAERLAKAAEAGRVDLGDLGRRARHL
FT                   LEAATAAGAERPADPAESQPRLL"
FT   gene            27216..28115
FT                   /locus_tag="Namu_0024"
FT   CDS_pept        27216..28115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0024"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: rpc:RPC_2254 auxin
FT                   efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76462"
FT                   /db_xref="GOA:C8XHX1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX1"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACV76462.1"
FT                   /translation="MGETLLKVLPVMLGFVGGFLLRRFRVAEPRDGDFLFRLVFYVCVP
FT                   ALMFASLSTVQITAALAVFPLSSALFTLVGFVLALLTARRLHWDPTRSAVLMCGCMIAN
FT                   SGFELPFIQALYGAEGVVRIAAFDAMNTALTFSFAYLVAVRGNPNRRRGGGAMIGRLAR
FT                   SPALWAIALGLAVNLIAVPVPAPIHDSLAVFGAATGFIIPLAVGILFQPSGGQVGKAAV
FT                   MVGVRLAAGLLVAVGLVLAFDLQGLDRTIMLLLGIAPIGFSTVTFASLEKLGEKLAVTA
FT                   LSLSLSLSLVLSMVVTVI"
FT   gene            28251..29090
FT                   /locus_tag="Namu_0025"
FT   CDS_pept        28251..29090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dno:DNO_0928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76463"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76463.1"
FT                   /translation="MATVLPRGLALSVVAIVGLAGCSQSTTGTPAAGAPATSSSAGPTS
FT                   SSDPTTSAAVGVAVDAGVVETSVLRPMQVESDDFWEEILALAGSSAGVSAPMSFLAESE
FT                   TLDCGGVALSGTDHFGPTYCAAQDEIVVSATFMADLGASQVLQADGTFVDPADDVGVYF
FT                   LLAHEWGHNIIGELVAEKQADLTLVPSQQVELAADCLAGLMIAGVPRVFAVKDTEAVLG
FT                   YVPVVGERFAGISGSPAARQAAIEVGLAPDYEDRAQFVTGLDQCLSSQAPQLAKALG"
FT   sig_peptide     28251..28352
FT                   /locus_tag="Namu_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.369 at
FT                   residue 34"
FT   gene            29352..31796
FT                   /locus_tag="Namu_0026"
FT   CDS_pept        29352..31796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0026"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: cti:RALTA_B1369 glycogen phosphorylase;
FT                   TIGRFAM: glycogen/starch/alpha-glucan phosphorylase; PFAM:
FT                   glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76464"
FT                   /db_xref="GOA:C8XHX3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX3"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACV76464.1"
FT                   /translation="MPSDLDDVERFTEEFLKRLQFGQGVALPRATKNDLYYALARTVRQ
FT                   QLMARWLETVQRQMQAKAKVVVYLSAEYLLGRQLDNALLASGLTDTAEAAIDGLGLDMQ
FT                   TIRDTEVEPGLGNGGLGRLAACFIDSLATLRIPAIGYGIRYEYGIFRQTFEDGHQVEQP
FT                   DSWLTLGSPWEFPHPEMGVKVPFAGHTEKYLGEDGRERTRWVNDWEVIGVPYNYMVPGY
FT                   RTGNVNTLRLWSARATQAFDLHVFNNGDYLQAVRSQAFAENISKVLYPEDSTPQGKELR
FT                   LQQQYFFVACSLRDFLTNVMGPGFDPRKLPERVIFQLNDTHPVIAIPELMRILVDEKDI
FT                   PWDEALDICRQCFAYTCHTLLPEALEVWPVELLGRLLPRHLEIIFRINDDFLAELREAY
FT                   PDDELRVRSMSIIQEHPERAVRMAYLATVVGAKVNGVAELHSQLLRDKVLSDFSAYWPD
FT                   KFTNVTNGITPRRFIGLANPALTELITDTIGDGWLRDLGRLVELEPHADDPAFLDAFAA
FT                   IKVGNRKRLAGLLERRDGIVLPQDAMYDVMVKRLHEYKRQTLKLLHIVTLYQRLQENPD
FT                   LDIVPRVFLFGAKAAPGYWIAKQTIALINAVGRVIDNDPIVAGRLKVAFPANYNVTLAE
FT                   TLIPAADLSEQISLAGKEASGTGNMKLALNGALTIGTLDGANVEILQAVGEENFFLFGL
FT                   TEPQVHAIYESGYQPREYFQNNPELRKALGAIASGAFSDGNREAFAPIVDSLLHEDRFL
FT                   ALADYQSYIEAQDRVDLAYRDTRAWNRSAVLNVARSGFFSSDRSIQDYLDRIWNASPVD
FT                   AS"
FT   gene            31869..33005
FT                   /locus_tag="Namu_0027"
FT   CDS_pept        31869..33005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0027"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: similar to
FT                   GH18720"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76465"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX4"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACV76465.1"
FT                   /translation="MSRRRTPPTLPVRLPILAAAVALLTLTACSSGGSSGSGESSAAPT
FT                   SAAPVTVAGSVVSTAGSSNEAQIVVPEVVAAQWAALGSGNGVEWVAVAGDGTTSTTPVA
FT                   VADADATSAFTAQLNALQAASPGRDALAGLDAVASPAGSPVWVFSPLLDTQGALDMNLL
FT                   AFDQSPPDVVSAATASGALPDLTGREVNFVVTPVAGQQNALSDVQVGYQHAIWEGIATA
FT                   AGASTVTFYDGTGTGAGTGTIPAVATPDPTDKISSEGSGPTRTCTLPTPALFLPNQAAL
FT                   IDKAATLTALSECVGTVDPSTKISVEGRTAAVPGGDPQGAIDLSTQRATEVAVLLQEVG
FT                   VPGENITSVVGLGDSSPLVQPASDPENRSVVVTFTSTG"
FT   sig_peptide     31869..31997
FT                   /locus_tag="Namu_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.633 at
FT                   residue 43"
FT   gene            33360..34202
FT                   /locus_tag="Namu_0028"
FT   CDS_pept        33360..34202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76466.1"
FT                   /translation="MATREFEVDSTCAAGAGVRSTDANGLMGYPPVETARRAGGDRGPT
FT                   PPASTRSPANPAPAARPARPGNRGEKLRLTVALLLTVGAVVLLGTMDDSSDSAQAGAVR
FT                   CESSDPVADLSPVQSRNARIVTGVARERGLDQPAAEIAVATALAETGLINFANDGTSEL
FT                   YASEINRPLTDIEREVARRSLDYPHDEVGNNLDSIGLFQQRPTTGWGAPEKLIDPASAA
FT                   GLFYDKLLRIENWPSGVPWQVAQKVQSSPSANGEIYQAAYARAVTVVGALWAESGCPA"
FT   gene            complement(34253..34924)
FT                   /locus_tag="Namu_0029"
FT   CDS_pept        complement(34253..34924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0029"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   apj:APJL_2062 inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76467"
FT                   /db_xref="GOA:C8XHX6"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX6"
FT                   /inference="protein motif:PFAM:PF01184"
FT                   /protein_id="ACV76467.1"
FT                   /translation="MTTIVDHPNADLMPDLADPTAGRVAQAREMASAQVQLIADPAPLG
FT                   LAAFALTTFLLSLANSGLMPVAAEPVVLGVALAYGGLAQLLAGMWEFKKGNVFGATVFT
FT                   SYGAFWLSFWAYLTFYAGGIPAEQHGVAAGWLLICWGIFTVLMFLGSLRTTAVLAALFA
FT                   VVVVAFFLLGFGALNGITGLTRAGGFAGLLAGAMAWYLCLAGVLSSTFGRPVLPNKSLV
FT                   G"
FT   gene            complement(35175..36800)
FT                   /locus_tag="Namu_0030"
FT   CDS_pept        complement(35175..36800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0030"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sil:SPO0677 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76468"
FT                   /db_xref="GOA:C8XHX7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACV76468.1"
FT                   /translation="MISSTANDSPLTPLRFLQRSAEVYPTKPAIVYGARRYSYAEFADA
FT                   AQRLAQALRARIEPGDRVVFLAPNVPEMLIAHFAVPLAGGVLVALNSRLAKAEIDYILN
FT                   HSEAKLLFVDAELVATVGNSLAAAPALTGVIEIADAEFGLAASGLDVGQQSYASFLAEA
FT                   DPAAAPLPWTVADERTVISINYTSGTTGKPKGVMYTHRGAYLNSFGEIVHNQFTGDSVY
FT                   LWTLPMFHCNGWCTPWAVTGAGATHVCLRAVRADAVWSALDGLGVTHLCGAPTVCSIIA
FT                   DAGQAHPLDRPMRITTAGAPPSPTVIEKLDRLGVTVVHVYGLTEVYGPFTICEYQREWD
FT                   DLPPADRARRLSRQGVGMLQAESARVVDEQLVDVPADGITIGEIVLRGNNVMAGYFKDD
FT                   AATEQAFRGGWFHSGDLGVMHPDGYIELKDRAKDIIISGGENISTIEVENAVLSHPAVA
FT                   EAAVIGMPSVKWGERPRAFVVVRPGVEVSSAAILDHVKGLIAKFKVPDEVIFVDVLPRT
FT                   ATGKIRKNELRATDPAARVLATAP"
FT   gene            complement(37024..38223)
FT                   /locus_tag="Namu_0031"
FT   CDS_pept        complement(37024..38223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0031"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bur:Bcep18194_B1396
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76469"
FT                   /db_xref="GOA:C8XHX8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX8"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACV76469.1"
FT                   /translation="MTMPTAPDHDSPPTALDTDYYAVFADVPEADRLFWKRARTFAEDT
FT                   LAEVNQAWDQGEYPLHLARRLGELDLLTDGVVGPGLTPMSPLAAGLVNMEISRGDGSMG
FT                   TVIAVQGGLALRSIALFGSAEQQARWLVPLARGEKLGAFALTEPTHGSDSVALETTAVR
FT                   DGDGWVINGCKRWIGNGSVGDVTVVWARDEQGHVRGFLVEQDTPGYRGETIRGKASLRA
FT                   IHQAHITLTDVRVPLDAVLPGTHSFKDASRVLLATRLGVAWAALGHATAVFEAALTYSR
FT                   TRIQFGKPLASFQLVQERLTRMLATLTTMQLTCRHLAALDQAGTLTPTQAALAKYTNTR
FT                   GARELAAIARDMLGGNGILLENHVIRHMADVESLHTYEGTESIQALLIGRDLTGISAFA
FT                   "
FT   gene            38382..38987
FT                   /locus_tag="Namu_0032"
FT   CDS_pept        38382..38987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0032"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sbp:Sbal223_0569 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76470"
FT                   /db_xref="GOA:C8XHX9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHX9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV76470.1"
FT                   /translation="MRISGPIVIDVNSCVGDTFTSVKATCAEVLLDVLEAFVGHLHCGA
FT                   QNGGIDALRTADLTFSQIRTLLTLTQNPEPVPIHEIATSLELSVATAGRNVDQLVRAGL
FT                   VERHEDDLDRRIKRISLSPAGLDLIATFKAGQRRSALRILSAVGVDETRRLIDALRPVV
FT                   EKLGCPSRPHPEASLPETPRPQTPQPSPFPPLRQEIPV"
FT   gene            38984..40609
FT                   /locus_tag="Namu_0033"
FT   CDS_pept        38984..40609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0033"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bur:Bcep18194_B1271 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76471"
FT                   /db_xref="GOA:C8XHY0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACV76471.1"
FT                   /translation="MSPKHAAPEPGAVDGSAPPPQLTKNQLTKNPAPTPVAADDDKLDG
FT                   TVWRIAGVVVLGAIMSILDVTVVSVALPTFQTTFDASYATVAWTMTGYTLALATVIPLT
FT                   GWAADRFGTKRLYMLALTLFLLGSIACGLAWSIESLIAFRVLQGLGGGMLMPLGMTIMT
FT                   HAAGPHRIGRVMAVLGVPMLLGPIFGPILGGWLIETASWHWIFFINVPIGIVALIAAWR
FT                   VLAKDEPSPSESFDFVGMLLLSPGLALFLFGVSTIPEEGTFASAKVIIPLVVGLLLMTG
FT                   FVFHALRRQDHPLIDLHLFKRKQMSVSVITMSLFAIAFFGAMLLLPTYFIQVREESTLT
FT                   AGLLLAPQGIGAMLTMPIAGRLTDKMGPGKFVITGLFLILIGMSVFTQISSTTPIPLLL
FT                   GALFINGLGMGMTMMPIMTAALATLRHAEVARGSTLMNIVQQSAASVGTAVMSVILTNQ
FT                   FLSKPAIQAAKAAQENPAAMANVPPDVLAQAKAQVQEQMAEAFGTTFWVALAILVVTLI
FT                   PAFMLPRKARETVGEEPAAPVVLH"
FT   gene            40892..41938
FT                   /locus_tag="Namu_0034"
FT   CDS_pept        40892..41938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0034"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mch:Mchl_5540 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76472"
FT                   /db_xref="GOA:C8XHY1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV76472.1"
FT                   /translation="MVGGVDTHKDTHTAAAVDTAGRVLGSAQFPTDAAGYRALLRWLRG
FT                   FGTLLLVGVEGTGVYGAGLARLLAAQGVAMVEVDRPDRKARRWQGKSDPVDAEAPARAA
FT                   LARVRTGLPKHRDGRVEALRALRVARRSAVGQRADVQRQIKALIVTAPESLRAQLRALP
FT                   DRELIKVCADQRPDRAGAGDPGTATKIALRSLARRHRALSVEIADLDELLGPLVAQINP
FT                   GLLALKGIGPDVAGQMLVTAGENADRLTNEAAFAMLCGVAPLPASSGRTTRHRLNRGGD
FT                   RAANSALWRIVITRMATDQRTKNYIARRTAQGLTKPEIIRCLKRYVAREVFLALTSASA
FT                   EKRPAKAA"
FT   gene            complement(42022..42525)
FT                   /locus_tag="Namu_0035"
FT   CDS_pept        complement(42022..42525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76473"
FT                   /db_xref="GOA:C8XHY2"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76473.1"
FT                   /translation="MSVAYDVEPWTELMVAVVGAMAALAGLFFVALSINVDEIVRMRRL
FT                   PGRAASTVVMLGVLLLAGMVVLVPGQPLWLLGAEIALMGVTVTIFSATALRPRNDADPQ
FT                   LNAFMYRVQPLLVMLIPCATLIVAGISLAVEAGGGLYWLAATFVTGTFACMTNAWVLLV
FT                   EIKR"
FT   gene            42653..42910
FT                   /locus_tag="Namu_0036"
FT   CDS_pept        42653..42910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lcs; la costa"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76474"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76474.1"
FT                   /translation="MAATVTRRSLRRVRSAGRHTYRSLRRHRMVTLVAAVCAALILTAF
FT                   AATAVGPGGPPGPWGPPAAQAPGHGPMMGGGPDGMGPHRH"
FT   sig_peptide     42653..42793
FT                   /locus_tag="Namu_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 47"
FT   gene            complement(42936..43847)
FT                   /locus_tag="Namu_0037"
FT   CDS_pept        complement(42936..43847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0037"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: avn:Avin_49440 sensory histidine protein
FT                   kinase TctE"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76475"
FT                   /db_xref="GOA:C8XHY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV76475.1"
FT                   /translation="MGWQIAAASAVVVVLAGLTTLALSPLLGRGRPEHGGGPDRDDEIL
FT                   RSTLLVAGVIGVAIAGVAGFLIARRAVAPLGEALARQRRFVADAGHELRTPLTVMHTRA
FT                   QLIARRMEPQDPALPAMRQLLDDSRVLGEIVDELLASAVLTADPGRGEPIEVRALLDEI
FT                   ARSMAVLAQAREVQISVAGPPGVWVTGSRVALRRALAALVDNALGHTPPGGWVQLAVDV
FT                   RGEHVVLAVTDSGEGLAGLDPAELTRRFARGPRAADGPGGRRFGLGLALVQEVASAHGG
FT                   TLTLGPAPTGGARAELVLPIRS"
FT   sig_peptide     complement(43779..43847)
FT                   /locus_tag="Namu_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.878 at
FT                   residue 23"
FT   gene            complement(43955..44626)
FT                   /locus_tag="Namu_0038"
FT   CDS_pept        complement(43955..44626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0038"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bxe:Bxe_A0699 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76476"
FT                   /db_xref="GOA:C8XHY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76476.1"
FT                   /translation="MTATGDKPRLLLVEDDSQLGPLLQEVLDEAYTVDLARDGQAGLHA
FT                   GLTRDYALMVIDRGLPAIEGVDLVRRLRQRGVAAPVLILTARAAVADRVEGLDAGAQDY
FT                   LVKPFEVDELLARLRALLRRTVDEATELDLGGRRLDVTGRRVVGGGQVVDLSGREAALL
FT                   EVLARRPQQVFTRPQLLAAVFDPADDPGSVDTYVYYLRRKLGRDCVTTVHGVGYRLGTI
FT                   S"
FT   gene            complement(44734..46053)
FT                   /locus_tag="Namu_0039"
FT   CDS_pept        complement(44734..46053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0039"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3; KEGG: mxa:MXAN_1010
FT                   N-formimino-L-glutamate deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76477"
FT                   /db_xref="GOA:C8XHY6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY6"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ACV76477.1"
FT                   /translation="MSPAAYFAGHALLPDGPAAGVTFEVAAGRFTAIRTGSRPPAGATR
FT                   LSGVVLPGLANAHSHAFHRALRGRTHRGGGTFWTWREGMYRVAAALDPDSYLALAQATY
FT                   AEMALAGITTVGEFHYLHHAPGGRRYADPNAMGAALIQAAAEAGIRLTLLDTCYLAGGL
FT                   GPPGHLELGPEQLRFTDGDADGWAARVARLADAESVRIGAAVHSVRAVPRAALPVVAAA
FT                   AHGRPLHVHLSEQPAENQAALAFYGRTPTELLDEAGVLGPLTSAVHATHLTASDIAALG
FT                   RTGTTCCLCPTTERDLADGIGPARALLDAGAPLSLGSDQHAVIDLIEEARALEMHERLA
FT                   TLHRGRFSPEQLLTAATRHDSLGWTDAGSLAVGGRADLVAVRTDTARTAGADPAQILLA
FT                   ATAADVDTVVVDGQPVVTGGRHRLGDVGALLGAAIEPLWR"
FT   gene            complement(46106..47761)
FT                   /locus_tag="Namu_0040"
FT   CDS_pept        complement(46106..47761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0040"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: mxa:MXAN_4343 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76478"
FT                   /db_xref="GOA:C8XHY7"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY7"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACV76478.1"
FT                   /translation="MEGARPVRAPRGTSLTAKSWTTEAPLRMLMNNLDPENAERPDDLV
FT                   VYGGTGKAARDWNSFDAMVRTLTTLEADETMLVQSGRPVGVMRTHEWAPRVILANSNLV
FT                   PDWANWPEFRRLEKLGLTMYGQMTAGSWIYIGSQGIVQGTYETFAAIAEKRFNGTLAGT
FT                   LTLTGGAGGMGGAQPLAVTLNGGACLIVDVDESRLQRRVEHRYLDEIAVDIDDAIAKSL
FT                   QAKAQRKAWSVGLVGNCAEVFPELLRRGVDIDIVTDQTSAHDPLSYLPAGVSIEDWPDY
FT                   AERKPEEFTDRARESMARHVEAMVGFQDAGAEVFDYGNSIRDEARQGGYERAFDFPGFV
FT                   PAYIRPLFCQGKGPFRWAALSGDPKDIYATDQAVMDLFPDNDRLQKWMRGAREKISFQG
FT                   LPARICWLGYGERDRAGLRFNEMVASGELSAPIVIGRDHLDCGSVASPYRETESMADGS
FT                   DAIADWPLLNALINTASGASWVSIHHGGGVGIGRSIHAGQVSLADGTALAAEKLARVLT
FT                   NDPGMGVIRHVDAGYELAEQVAADQGVRIPMKEG"
FT   gene            48240..49703
FT                   /locus_tag="Namu_0041"
FT   CDS_pept        48240..49703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0041"
FT                   /product="multicopper oxidase type 2"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 1; KEGG: sde:Sde_0315
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76479"
FT                   /db_xref="GOA:C8XHY8"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY8"
FT                   /inference="protein motif:PFAM:PF07731"
FT                   /protein_id="ACV76479.1"
FT                   /translation="MLTPCPAAVDIGAPQPITTWAYDGLIPGPTWEINPGDVLRVELVN
FT                   DLPTDPAGSGAASAPPSGSSTDPSASSADHSGHDMGGDTMPMDRPHQWTTTNLHYHGMH
FT                   VSPEGNGDDVFLTVEPGERYQYEIEVPADHPGGLFWYHPHRHGGVTQQIRGGMAGAIVI
FT                   RGSIDEVPEIAAAAEQLMVIQAIEVDQNYAVAAPIPDPTSSEAFFPRNQILYPINGGLS
FT                   PTLTMRPGEVVRWRILNAAEGKFINLVADGLEFHVIAWDGLNLAAPEQVSNLFLSAGNR
FT                   VDVLVRAVAPGTVALQCTPSSSQKPGTQGVPGSTDGLPPELVTRPIATVEVAGDPVTMA
FT                   LPTELPAWDQEILPIARTREVTYSVERDGTEFEDFGVDGQQFTATNPPYQVKLDTAEEW
FT                   TVINGLDGKYPQHAHVFHIHVNPFKITKINGQVLDKPLWRDTFILTGTNGDSFTFQTNF
FT                   LDFTGKFVDHCHIVSHEDLGMMETIEVVR"
FT   gene            49700..51337
FT                   /locus_tag="Namu_0042"
FT   CDS_pept        49700..51337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0042"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: sde:Sde_0518
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76480"
FT                   /db_xref="GOA:C8XHY9"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHY9"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACV76480.1"
FT                   /translation="MTERASGAINRRQILQLGATGALTGLLAACTSTETPSGSSTSAGP
FT                   ADATGGSAVPSADPEWTTPTTTAAPTMVPPDPVTEAAVQDLRSRLTGTVLSPLSVDYPF
FT                   TALSTNTRYLDQRPAVIARCRDEADVVTAVNWAREHGLTVAPYGGGHSYAGLSTTSGLL
FT                   LDIGAMNSVTVDLSAGTASVGAAALNGDVLDKTINTPFLLPGGTCLGVGTGGLVLGGGI
FT                   GYNTHWAGLTCDHLTATRVVLASGEVVDADSSQHSDLFWACRGGTGGNFGLNTSFQFEL
FT                   VRAPETVVYFRYDYRGADAATAMLAAVDALAQTAPAGLNMSSSAQATPVGAGGPREAID
FT                   AFVRGQYVGTVDEAQDLLAPFVALSPATSALQERPFWQVQQQVWPSANPAPHSWGDWSR
FT                   YTREALPQDRVARMVDLLAECPVRTDSSNGALWFLGWVGGDVVGKFGRTDTAYVHRGSP
FT                   LLLRPTPVWETSDPASVGQDLLDWTAAQIDIVADVTPQESYQNFPNRLIPNPLQQYFGE
FT                   NLDRLIAVKSTYDPTSLFTNEQGIPVRA"
FT   gene            51410..52216
FT                   /locus_tag="Namu_0043"
FT   CDS_pept        51410..52216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0043"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   bbr:BB0415 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76481"
FT                   /db_xref="GOA:C8XHZ0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACV76481.1"
FT                   /translation="MPREGTGPDFIEALARGLEVIAAFAPGRPVMSLSEVATATGLARP
FT                   TARRILLTLSELGYVRAAAGGFALTPRVLELGIAYVRSMGLWDIARPHLERLVERTHES
FT                   SSIAQLDGSDIVYVARVSVPKIVTLSVEIGTRFPALPTSLGKVLLADLSPDEVDRILAE
FT                   PSRSSVTPRWRPDRDERDAVLREVRARGWALTDEKLALGIRSVAAPLRDGSGRVIAAVN
FT                   VNAHAAETSVEQLIGQHLPLLLATAGEISADFARRAAVPHVTRPAS"
FT   gene            52369..53544
FT                   /locus_tag="Namu_0044"
FT   CDS_pept        52369..53544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0044"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bpa:BPP4114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76482"
FT                   /db_xref="GOA:C8XHZ1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ1"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACV76482.1"
FT                   /translation="MDVPSPTDRPGPLAGIVVADFSRVLAGPYATMLLADLGADVIKVE
FT                   GPGGDDTRSWVPPTRDDVGTYYLAVNRNKRSVVLDLKDTGDRALAHELSARADVFIQNF
FT                   KPGGLARFGLDYESVRGRNERIIYCSISGFGADKGANLPGYDLLVQGMSGLMSLTGAPD
FT                   GPPFRSGISVFDVMTGLHSVIGVLAALHHRDLTGQGQHIETNLLSSALSALVNQSSAYV
FT                   AGGVVPARMGNAHLSLFPYEPLATGDGELIVVAGNDGQFRRLAETIGRPELADDPRFDT
FT                   VGRRNDNREQLRPLLLEALSARTAQEWFGLFTAAGLPSGPINTVQGGVELAESLGLQPV
FT                   VQVGEAQVPSVRNPIRLSATPPDYRYAPPALDEQGEELRRWLREPRRGSDG"
FT   gene            53537..54397
FT                   /locus_tag="Namu_0045"
FT   CDS_pept        53537..54397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0045"
FT                   /product="citrate synthase"
FT                   /note="KEGG: vei:Veis_2009 citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76483"
FT                   /db_xref="GOA:C8XHZ2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ2"
FT                   /inference="similar to AA sequence:KEGG:Veis_2009"
FT                   /protein_id="ACV76483.1"
FT                   /translation="MAEPRPGPAEPPVYPTALGASSLHRITLLGQDLADDVMGSVGFGE
FT                   LAFWLATQRRPTPGQTRVFEAVLAALADHGFTPTAIAARLTYLSAPDSVQGALAAGLLG
FT                   GGSRFLGVTEDCGRFLHEVLIGVEGPLPDDDAGWDQLALTTVTRQRERKQFVPGLGHHV
FT                   HKQGDPRTPRLFAIAAEEELVGPHLALFAAIGRVHPQVLGKTLPLNGAGVCGAALADLG
FT                   LPLELLRAFALLARTAGLIGQLAEELRHPVANQIFLSVDLNNASVPPDPYEPPVLTHES
FT                   GGANG"
FT   gene            54390..55253
FT                   /locus_tag="Namu_0046"
FT   CDS_pept        54390..55253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0046"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: ara:Arad_12298
FT                   2,3-dihydroxybiphenyl 1,2- dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76484"
FT                   /db_xref="GOA:C8XHZ3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ3"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ACV76484.1"
FT                   /translation="MAEIAAVIASTHHPFYLRASTSTGADRPPFADEWVAKVERFRETL
FT                   TAARPDVLVMVGSDHFHQLWLDNMPQFLVGKAPWFDANWYNEEREFGLPRMRLRGQEEL
FT                   AAHILRDGLDRGFDLAFSNELRIDHSVTCPIITLRPQADLPIVPVYTNIFAPPLPQPKR
FT                   FVALGQALREMVESWDSDQRVAIIGTGHLSLELGGPRQFGEHGPDPEFDRKAVEWIATG
FT                   DIAGCLAEVTLDSLHEPGNATHGFMDFMLMMGAAGEGRAADYVDSLDLFHTMEAYFTWY
FT                   PNGVPA"
FT   gene            55255..55614
FT                   /locus_tag="Namu_0047"
FT   CDS_pept        55255..55614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_12299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76485"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76485.1"
FT                   /translation="MSKYLLDKFLFTVDRDPELVERYREDPAGTVAWWEAERANVILNC
FT                   LEAERSTWLAFSDEERRALTEHDHVALFQLGAHPFLTLTLFIAMFERDHGPLEYQLAYG
FT                   AAMKHLTLPYPDITT"
FT   gene            55627..57132
FT                   /locus_tag="Namu_0048"
FT   CDS_pept        55627..57132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0048"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   reu:Reut_B4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76486"
FT                   /db_xref="GOA:C8XHZ5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ5"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACV76486.1"
FT                   /translation="MCPSMTNPQTNPQSDPDSLVLRGGTVLTMDKTHTVLEGADVLVVG
FT                   DSIAAIGVGLDVPAGTIEIDAGGGIVMPGMIDTHRHMWQTAMRGYGADWTLTQYFVWYY
FT                   LEHGRKFRPQDVAAGNRLAALESLEAGVTTVVDWSHGLQTVEHAQAAADALQSVPGRYV
FT                   LAYGNIQAGPWEWTADPAVRAFLERYRDGAGSLNGVRLAFDVTGDPAFPERPAFEVARE
FT                   LGLAVTTHAGVWGATGDDSIRQMYDGGYMQPETVYVHAASLSTDSYHRIAATGGSISVS
FT                   TESEQSAGQGYPPTWQVRRHGIPVSLSMDTSVWWSGDLFSAMRTTLGADRSREHFEAHL
FT                   KGETITHAGLRAEHVVDWATRGGARALGRDDLGSLEVGQKADVVLLKNDHSTVSFPVLN
FT                   PYGHVAFQAQRDDVHTVVVNGALVKRDGRLVDVDLAAVRREIEATVEYLRSELGEPAWT
FT                   AGMYPDQAAVERLENPYQYTDFKSETTTVAREEAFRAELEDRR"
FT   gene            57132..57350
FT                   /locus_tag="Namu_0049"
FT   CDS_pept        57132..57350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76487"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76487.1"
FT                   /translation="MPVDLDGWGTAPQRYGRSAHRTRRREGGPSGVLLARPDTVVARRR
FT                   SHRPADPRGALRAARTQLAGGPVGVSW"
FT   gene            57350..58327
FT                   /locus_tag="Namu_0050"
FT   CDS_pept        57350..58327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0050"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; 1-
FT                   deoxy-D-xylulose 5-phosphate reductoisomerase domain
FT                   protein; KEGG: reh:H16_A0632 NADPH:quinone reductase or
FT                   related Zn-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76488"
FT                   /db_xref="GOA:C8XHZ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV76488.1"
FT                   /translation="MAPPETGPAALLHEPGAAPRYGEHARPAATGEEVLIRVSAAPITP
FT                   LDRLCATGRSYFGAPATPYVPGVQGVGVVEAGPVPAGTPVWFATAAGMQPGDGSMRAWA
FT                   CAPLHDVVALPAGVDPVLVGALGLSAVAAWMAMTGPGELAPGDRVTVLGAGGVVGQAAI
FT                   QLARQAGAARIVAVARSGAAREQALRLGADAAVAIEADDDVDTLAARLTAAADGPVDLV
FT                   LDPLFGIPAAAALRTLRVGGRLVNLGSSAGETAPIDSSTLRSRQLQIRGYTNNELSTAQ
FT                   RREALLHVATQVAAGRLAVEHQPVALADVAQAWDRPGPRVVLVP"
FT   gene            58375..58629
FT                   /locus_tag="Namu_0051"
FT   CDS_pept        58375..58629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0051"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor;
FT                   KEGG: rpc:RPC_1343 Rv0623-like transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76489"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ8"
FT                   /inference="protein motif:PFAM:PF07704"
FT                   /protein_id="ACV76489.1"
FT                   /translation="MVLNIKDPETDRLARELAAEAGESLTVATRRAIEERLSRLRARKR
FT                   ANDPDLGLDEFIRRGRERAVLDERSPDDIIGYDEHGLPR"
FT   gene            58626..59027
FT                   /locus_tag="Namu_0052"
FT   CDS_pept        58626..59027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0052"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   rle:pRL100005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76490"
FT                   /db_xref="GOA:C8XHZ9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHZ9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV76490.1"
FT                   /translation="MSPVVLDTSAVAAVIFGEPDAEAFAAALTRHGGELSISAVTRVEL
FT                   EIVLEARQGSEAVSDAEAMFDRLGVITEPVDAAQAGAAFAAWRRFGKGRHPAGLNLGDC
FT                   FSYALARAAGAPLLFKGNDFAQTDIASAL"
FT   gene            59425..62850
FT                   /locus_tag="Namu_0053"
FT   CDS_pept        59425..62850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0053"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; zinc finger SWIM domain
FT                   protein; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; KEGG: azo:azo0839
FT                   SWI/SNF family helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76491"
FT                   /db_xref="GOA:C8XI00"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI00"
FT                   /inference="protein motif:PFAM:PF00176"
FT                   /protein_id="ACV76491.1"
FT                   /translation="MVGEPAGHGRAHWRGSWPAATATDHGLAWHVGDVVLGRARTVLAH
FT                   GGVLTCTQTRPGELQATVNGTRPWPYQVGVSFVMSGGRVGAFEGECDCPVELDCKHAVA
FT                   ALLHYLGSPDGPGGRALSVIDSGVDSADQSQEIDEDAAPGWEQSLTQLLGASRKPRVDR
FT                   DRVHTLLALQVSVALHPSSGPFGGAGVRIRPIQFNARNRWVSTGVSWRDLRYGYYTAQY
FT                   RPEQLESLRGVADLELRRNPQQALTTWIGLDGPGGSQLWDALADAQQVGIDLLLDGAHT
FT                   PVELSADPAEIALDLVRADTLRVRPILRLGERILDPDTTALIGQPAHGLILGLAADRPA
FT                   TPPITVARLRRPLTADLAGMLDAGTIEIPAPDESRFLAEYLPGLRRRITVLSSDSSAPL
FT                   PEPSPPRAVLTVTRGPGHRVALHWQWQDESGRRRDLDDRRGIIASDRTAMRQTIEALLA
FT                   TEVLPDDAIGSGPDGPQPQTRHLLLGAAAVHFMTSAWPILRSRPELLTELDGPDAELEY
FT                   RPASGQPELDLGGHDDGDDAGSDEDGDETAAARDWFGLSVRVRVDGQDVPFELLFRALA
FT                   GEDSLLILPSGTYLDVADLDGRWNRLRELIEESRAMDDAGPDELRISRHTASRWAELED
FT                   TGLLGPRAAAWRERMRALAVGSGERYAAGPLPAGLQAHLRSYQREGLDWLRERFDQGLG
FT                   GVLADDMGLGKTVQMLGLIAHAREQDPAGPPLLVVAPTSVIGNWVAEAARFTPDLRVVP
FT                   VTTGGGRRGRPLAEVIGGADLVVTSYQLFRLGADEYRELPWTALILDEAQFVKNVQSKG
FT                   FRCARDFPAAVTFAVTGTPLENNLMEFWALLAVAAPGLFPDSRRFTEHYRLPIERGGAT
FT                   ERLDQLRRRAAPFLLRRTKEQVAPELPPKVEQVIEVDLSPRHQQVYQRHLQRERQKILG
FT                   LLQDKRSLDDHRFQILRSLTLLRQLSLDPSLVDESYRDIPSSKLEVAIDRICEIVESGH
FT                   RVLVFSQFTRFLARARDQLHHLGIAHCLLDGRTKDRSAVVEAFRTGVAPVFLISLKAGG
FT                   FGLNLTEADYCILLDPWWNPAAEAQAIDRAHRIGQTKNVIVYRYVARGTIEEKVMALKA
FT                   GKAKLFDDVLGAAADAGRSAGSPLSADEIRGLLE"
FT   gene            63184..64722
FT                   /locus_tag="Namu_0054"
FT   CDS_pept        63184..64722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0054"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; phosphotransferase system EIIC; KEGG:
FT                   ppr:PBPRB0363 putative mannitol-specific IIABC component,
FT                   PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76492"
FT                   /db_xref="GOA:C8XI01"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI01"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ACV76492.1"
FT                   /translation="MTADASAAGTTSKTSSTRVAVQKFGTFLSGMIMPNIAAFIAWGLI
FT                   TALFIEKGPFPIAVIGGFGVDDAGDPNPGLVGPMVRYMLPILIAAQGGRMIYGVRGAVV
FT                   AVVATMGVIMCTPQPMFLGAMVMGPLAAWLMKKLDSVWDGKIKPGFEMLVNNFSAGFLS
FT                   AGLAIASFYVFGPIIEGLSSALGTGVDWLISHSLLPLASLIIEPAKVLFLNNAINHGVL
FT                   TPLGINQSAETGQSILFLLEANPGPGVGLLIAYSIFGTGLAKSTAPAAAIIQFFGGIHE
FT                   IYFPYVLMKPLTLIATIAGGMVGILTLTIFNAGLRAPAAPGSIIAVLIQTPGSSLVGVL
FT                   LSVTLAAVTSFVIASIILKASKKTEESGDLAQATAKMEGMKGKKSAVSGVLTDIEAQKE
FT                   EADEAREAATRSAPIHKIVFACDAGMGSSAMGASVLRNKIKKAGFADITVVNVAIANLV
FT                   DDVDLIVTHQDLTARARDKAPHAQHVSVANFMNSPKYDEIVDELHVTNPQGSSA"
FT   gene            64952..65389
FT                   /locus_tag="Namu_0055"
FT   CDS_pept        64952..65389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0055"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: tau:Tola_0283 PTS
FT                   system, mannitol-specific IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76493"
FT                   /db_xref="GOA:C8XI02"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI02"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACV76493.1"
FT                   /translation="MGDILTASQIKTPGTATNKDEAIREAGQILVDSGAVGPEYIDAMF
FT                   EREKSVSTYMGNFLAIPHGTNEAKDSIKASALSVVRYENPIDWDGNEVRFAIGIAGYEG
FT                   GHLEILGKVAIIFSDMDEVDKLVAAGSSQEIFDLLNAVNED"
FT   gene            65403..66557
FT                   /locus_tag="Namu_0056"
FT   CDS_pept        65403..66557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0056"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: mannitol-1-phosphate
FT                   dehydrogenase; K00009 mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76494"
FT                   /db_xref="GOA:C8XI03"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI03"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACV76494.1"
FT                   /translation="MSPTAVHFGAGNIGRGFVGLILHRAGYEVVFADVAETLIDALQVT
FT                   PSYQVIEVGLDSRTERVDNYRAINSRSHDAELVRELAAADIVTTAVGPTVLKFVAPTIA
FT                   AALLKRSADQPPLAVMACENAINATDVLAGHIREHCSDEEWAAITPKAVFANTAVDRIV
FT                   PAQAADAGLDVTVETYFEWAIESPPFGSNPPEIPDATWVPDLAPYIERKLFTVNTGHAT
FT                   TAYHGRLRGISKLSDALADEQVRAAVEGVLGETKALLVAKHEFSDEAQQAYVDKILTRF
FT                   ANPHLPDTTERVGRQPLRKLSRNERLIGPAAELAERGITPHHLLATVDAALQFDVPEDP
FT                   ESVEMHELLRTLSPAEATERITGLTPEHPLYAEVLAVVGKRVTV"
FT   gene            66660..68906
FT                   /locus_tag="Namu_0057"
FT   CDS_pept        66660..68906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0057"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: Pfkm; phosphofructokinase, muscle; K00850
FT                   6-phosphofructokinase; TIGRFAM: 6-phosphofructokinase;
FT                   PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76495"
FT                   /db_xref="GOA:C8XI04"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI04"
FT                   /inference="protein motif:TFAM:TIGR02478"
FT                   /protein_id="ACV76495.1"
FT                   /translation="MTPPSPAKRRLAVMTSGGDAQGMNPAVRAVVRTALHYNADIYAIY
FT                   EGYRGLIEGGDRIRPATFDDVSGILNRGGTVIGTARSLEFRERSGRLKAVHNLVEKGID
FT                   RLVVIGGDGSLSGADLLRREWSSLINELVETGKIDQETADRHPALMITGLVGSIDNDMI
FT                   GTDMTIGADSALHRIVEAIDSISSTAASHQRSFIVEVMGRHCGYLALMSAIAGGADYVF
FT                   IPENPPAPGWETHLCAQISNVRASGRRNSIVVVAEGAQDSDHNPIDSDYIRQVLEDRLG
FT                   EDTRVTILGHVQRGGAPSAFDRSMSSQQGFAAVEEVLSATADTVPSIIGVQHNRVAKAP
FT                   LMESVAKTHELASLIAAKDYDTALTLRGDSYTELSHVFHSISHALPGVRQKTKSSRIAV
FT                   LNVGGLAPGMNAAARVAIRLGLHRGHTILGVKGSFAGLAEGDVQEMQWGDVEGWSSRGG
FT                   AELGISRKVPTVRDLYAIGRGLETHGIDGLVIIGGWDAFESAHTMWRERDRYEAFKIPM
FT                   ICLPASIDNNLPYSELSIGADSALNLIVDSIDRVRQAGAAQRRAFVVETMGGNCGYLAL
FT                   LAGLSGGAVRVYLHEEGITLKDLSVDVERMVDSFRAGQRLFMVVANEKASPMYTSDFLC
FT                   RLFEQESQDLFDARKVVLGQTQQGGTPSPFDRILGTRLAAHAMDWISNEIDRSRADNAV
FT                   IGTINGSVKVMSMRQAEDLADWENRRPLKQWWMDLRPILDVLAQRLPVEQTRTF"
FT   gene            68975..70141
FT                   /locus_tag="Namu_0058"
FT   CDS_pept        68975..70141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0058"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76496"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI05"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACV76496.1"
FT                   /translation="MQLSGRPLLDNAADQRLFVGRAQEIDRIERSLGAGLNCLLTGVAG
FT                   SGKTSLVRAVMFRAHRAGRRAPRYYVRGGAARTAAQLLAEVVGVVRGGARSAAAAPDGD
FT                   PLTLLDELAEVLEVDALDGLDPDADREDELGQPTRPPGPPVLVIDDVTAAAGAQLFGAL
FT                   RDEVWQLGALWLVTTTPAQALDLVRPPADVFFETRVTLDALDGPEVADLLRRRLDPAGS
FT                   AAVSGEPSIDPAELVDAVLAGRPDTPRRALEAAREWVTNPGVGPSGLTVAQEHRARAEA
FT                   LENVSRPARMLAQELEAIGWAAASDERLLDRLGWTRTRVIQVIGELRDEGLVQMREERR
FT                   GRGRPRKLFRVVPAAEFTPRSDPAGDPVDNPDTTGTLAPGTDPAAVRR"
FT   gene            70222..71208
FT                   /pseudo
FT                   /locus_tag="Namu_0059"
FT   gene            71270..72055
FT                   /locus_tag="Namu_0060"
FT   CDS_pept        71270..72055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0060"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SMART: AP endonuclease family 2; KEGG: pca:Pcar_3071
FT                   endonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76497"
FT                   /db_xref="GOA:C8XI06"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI06"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACV76497.1"
FT                   /translation="MVMLGVHVGAREDDGDPVAEAAASGADGVQVFLADPQGWKTPKAH
FT                   PHAEAMRAAGLTVFVHAPYIVNVATTNNRIRIPSRKLLAAHAKAAAETGASGLIVHGGH
FT                   VLAKDDPQVGFDNWRKVFERQAQEGGFPVPVLIENTAGGDKAMARTLEEIARLWDAVGE
FT                   FDAGFVLDTCHGWAAGLDLSSVVDDIKAITGRIDLVHGNNSRDEAGSGRDRHASFIDGE
FT                   IPAAVLADVVRAAGAPVILETPGGPDERAPEIQFLRSSL"
FT   gene            complement(72298..73722)
FT                   /locus_tag="Namu_0061"
FT   CDS_pept        complement(72298..73722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0061"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   afw:Anae109_1606 FAD linked oxidase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76498"
FT                   /db_xref="GOA:C8XI07"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI07"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACV76498.1"
FT                   /translation="MTIHHLARPRIQDRAVAHSLRGLCAGDVQLPGDPGYDAARQAWNL
FT                   AVDQRPAAVARPADARQTAQVVRAAAAAGLRVAPQTTGHNAGPLGRLDDVVIVRTGAMN
FT                   SVQVDPDRQGIRVGGGTLWLTAVTAAAAHGRAVLHGSAPDVGIAGYSLGGGLGWYARAL
FT                   GLQTNNVTAVEVVTADGALVRADAEQNTELFWALRGGSGNFGIVTALEFRTFPFATTVA
FT                   GMLVWDAAMAEPVLRRWVQWAGDAPDEVTTSLRVMSLPPLPEIPAPFRGRSLLIIDGAV
FT                   LASDARSAEILAPLRDLQPEVDTFARVPVETLSGLHMDPDSPMPSVSDTAILDAMPEAA
FT                   IETFLDLARPGSGSSLMMHELRQLGGALARPHPGAGAMPTMPGAFLAFGGALAATPEMA
FT                   AAGRRDAQAFAAALAPFGSGRTYLNFQENQTETAAGFDPVNYGRLVALKSALDPQGVLL
FT                   GNHPVRRTYEVEDEFF"
FT   gene            complement(73877..74155)
FT                   /locus_tag="Namu_0062"
FT   CDS_pept        complement(73877..74155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76499"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76499.1"
FT                   /translation="MTALLLDIPTDLTNRPTETAADPRAGLPVATERVAGAAFCVDLDP
FT                   GLLSFTRRRIAEHFAVADDQVDVMITSGLLRLSQRLSRVLANRPATC"
FT   gene            complement(74205..74315)
FT                   /locus_tag="Namu_0063"
FT   CDS_pept        complement(74205..74315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76500"
FT                   /db_xref="GOA:C8XIR3"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76500.1"
FT                   /translation="MNSIREMYKAAPDLVVTVASLLGLALVLGVTTLFVS"
FT   gene            complement(74558..75064)
FT                   /locus_tag="Namu_0064"
FT   CDS_pept        complement(74558..75064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0064"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: gbm:Gbem_2817 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76501"
FT                   /db_xref="GOA:C8XIR4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACV76501.1"
FT                   /translation="MKLSAGLLLYRVTRDRSVQDQAVQDQAVQDQVQVLLVHMGGPFWA
FT                   RKDEHAWSIPKGEFEPGEDPAAVAVREFTEELGSAPPDGATIELGSARQSGKTVTVFAR
FT                   AGDFDAGRAVSNTFSLEWPPRSGRFQDFPEVDRAEWFDLPTAASKLVKGQVVFLARLVE
FT                   RVPLT"
FT   gene            75209..76198
FT                   /locus_tag="Namu_0065"
FT   CDS_pept        75209..76198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0065"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pcr:Pcryo_0733 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76502"
FT                   /db_xref="GOA:C8XIR5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACV76502.1"
FT                   /translation="MSAHGAGPGEHPPVVALGDAFTGEKSESTLTVLIAFGANFLVAVA
FT                   KTWAAALTGSASMVAEAAHSWADTGNEIFLMIANRRARRPADPTHPLGYGREAYVWSMF
FT                   AALGLFVAGSAVSITHGLHELFDPEPATDFVIGYLVLGLSFLLEGTSFLQSVRQARREA
FT                   ATVHRDVIAHVLATSDPTLRAVFAEDAAALTGLVIAATGLGLHQATGSATPDAIGSILV
FT                   GVLLGVVAIVLIDRNRQFLVGMQVSEPVRVAIVQALRALPEVSRVTALRVEFIGPRQLY
FT                   LVADVDLTGEDPEPVLALRLRALEARIRESPAVVDCTLSPSAPDEPDL"
FT   gene            complement(76213..76626)
FT                   /locus_tag="Namu_0066"
FT   CDS_pept        complement(76213..76626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0066"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: glo:Glov_2468
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76503"
FT                   /db_xref="GOA:C8XIR6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR6"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV76503.1"
FT                   /translation="MAQRRNTAQRASILQALEGTDEFLSAQELHTALRGSGSSIGLATV
FT                   YRALQDMAGGGDLDTVRTPSGEVLYRQCAQPRHHHHLVCRVCGRTQEVEAPSVERWART
FT                   VAAEFGYSDINHEVELFGVCPACAAPRVEANTG"
FT   gene            76818..77432
FT                   /locus_tag="Namu_0067"
FT   CDS_pept        76818..77432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0067"
FT                   /product="DNJ31; DnaJ-like protein"
FT                   /note="KEGG: DNJ31; DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76504"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR7"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_36125"
FT                   /protein_id="ACV76504.1"
FT                   /translation="MRGWVILAAAALSALVTGCAGGGAAGSGTSAASTITITEGTRTAV
FT                   RSVTVTPEPSAAPAAGAASATAPPATDEPAPVAGTCPYLSDDTVADINGQRTGVTTVIE
FT                   VDPHPICTFTRSDGGWLATVRIVQADSPAAAAAAVDQHVPVESSNPADDPAGWTGGSMA
FT                   TGDGSVYAVAKGSVAVIAEANQPQSIKGRQLAVTAIANLGL"
FT   sig_peptide     76818..76916
FT                   /locus_tag="Namu_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.785 at
FT                   residue 33"
FT   gene            77491..78027
FT                   /locus_tag="Namu_0068"
FT   CDS_pept        77491..78027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0068"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mxa:MXAN_1176 peptidylprolyl
FT                   cis-trans isomerase, cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76505"
FT                   /db_xref="GOA:C8XIR8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR8"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACV76505.1"
FT                   /translation="MSDLYATLHTNRGDIRIELFRFQAPKTVSNFVKLAKGTAKYTTKN
FT                   ASGGTEGPFYDGAIFHRVIEGFMIQGGDPTGTGSGGPGYQFADEFHPELSFNKPYLLAM
FT                   ANAGPGTNGSQFFVTVGPTPHLNRRHTIFGEVADQASRDVVDAIATTRTDRFDRPAEDV
FT                   VINSITIEDPEESAS"
FT   gene            78092..78970
FT                   /locus_tag="Namu_0069"
FT   CDS_pept        78092..78970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0069"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: rso:RS04802
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76506"
FT                   /db_xref="GOA:C8XIR9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIR9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACV76506.1"
FT                   /translation="MAPCTWHPDRLTPLSCSRCGRPACPECLTPASVGFHCRECVAQGQ
FT                   AATRPPRTIAGARLGDKPVVTFALIAVNLAFFLVTALQSRSAMDLSYSELYLRGGLIPA
FT                   EVASGEYWRLLTSGFLHGNLVHLATNMLSLYWLGIPLERILGRGRMLTIYLISLLGASV
FT                   SVLLFSAPVSLTIGASGAVYGLMGALLATFRRLRLDLRPLVVILALNVFITFSYPGLSW
FT                   QGHLGGFVAGAIVGAAMVFPPRASRAAWQWGISIGLVVVLAGLTVVAADRIGAYYCLYQ
FT                   VAGQVSCVPAH"
FT   gene            complement(78948..79400)
FT                   /locus_tag="Namu_0070"
FT   CDS_pept        complement(78948..79400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76507"
FT                   /db_xref="GOA:C8XIS0"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76507.1"
FT                   /translation="MSGDNDFPGPGARTWRPPSGILIGLMVVALAAAAAAVLDTDPMDR
FT                   LVYGLVGVVLLVLALVGRRRRLVAGPRGLLIAGAGGARIVPWSMVRSIECGRTRRMRTA
FT                   TLEIDLVDGELLLYGRLDLGAEPDAVLADLTGWFEGRDDLSGPARS"
FT   gene            complement(79484..79771)
FT                   /locus_tag="Namu_0071"
FT   CDS_pept        complement(79484..79771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0071"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76508"
FT                   /db_xref="GOA:C8XIS1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS1"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACV76508.1"
FT                   /translation="MPKSKVRKKVASSSASASAQANEAAAAAARAHVAAPSSPLYIGIM
FT                   LGLMVLGLVWLVVYYLWGASIPFISGLGNWNFAIGFTLMIAGLLMTMRWR"
FT   sig_peptide     complement(79706..79771)
FT                   /locus_tag="Namu_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 22"
FT   gene            79953..80681
FT                   /locus_tag="Namu_0072"
FT   CDS_pept        79953..80681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0072"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76509"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS2"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACV76509.1"
FT                   /translation="MSKRALGWRVGAVASCLVAGLLIGVLHGYANGQDVGTRSVDLSVV
FT                   VRDAQERVLAADAKAAALQQQIDQAAAGDVSPQVEQARAGVDALEPAAGLVPVVGPGLR
FT                   VSMSDAPRDSDGNYPAGVDPDDLVIHQQDVQAAVNALWAGGAEAMMIMDQRVLTTSAVR
FT                   CIGNTLLLQGRTYSPPFVITAIGDEAKMSAALDAEPGVRLLLQYVDKYKLGYEVTALDE
FT                   VELPAYDGPIRMKAATEAGR"
FT   sig_peptide     79953..80051
FT                   /locus_tag="Namu_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.590 at
FT                   residue 33"
FT   gene            80678..81538
FT                   /locus_tag="Namu_0073"
FT   CDS_pept        80678..81538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0073"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   sde:Sde_0123 sortase (surface protein transpeptidase)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76510"
FT                   /db_xref="GOA:C8XIS3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS3"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACV76510.1"
FT                   /translation="MTAPRGPVTASGGRSVGRTLIRGAGEVLITLGVVVLLFVVYEVYI
FT                   TDLFGERKQAQATVAVDRVWADAEATATVVAQAPDQLATDPRERVPRYDTVTGEGFAKI
FT                   RIPVLGVDYVFTVVEGTDPDDLYIGPGHYPETQLPGEQGNFAVAGHRVSKGSPFNDLGL
FT                   LHSCDAIVVETQDDWFVYRVLPMAEEEATWASTPRARCGGVGVQAGAYAGVYGREITLP
FT                   SDYAQVLPVPTVLSTTVPPDAQRLITLTTCHPQFSDAERMIIHGVLVTSYAKAPGFLPP
FT                   ELAET"
FT   gene            81550..81705
FT                   /locus_tag="Namu_0074"
FT   CDS_pept        81550..81705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76511"
FT                   /db_xref="GOA:C8XIS4"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76511.1"
FT                   /translation="MYAWIWRHLPGPTAARAGISVVLFLAVVALLFFVVFPWLEPYLPF
FT                   DRVTTG"
FT   gene            81727..82389
FT                   /locus_tag="Namu_0075"
FT   CDS_pept        81727..82389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0075"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   kpn:KPN_03746 para-aminobenzoate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76512"
FT                   /db_xref="GOA:C8XIS5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS5"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACV76512.1"
FT                   /translation="MCDAVGVTRILVVDNYDSFVFNLVQYLEQLGAECVIRRNDAVGTD
FT                   EVPALQVDGILLSPGPGTPADAGVTEQMVRWAAGRLPVFGVCLGHQAIAEVYGATVDRA
FT                   EELLHGRTSLVEHHGQGVLTGLPNPFTATRYHSLAVVDGTVPSELEVTARTSGGVIMGL
FT                   RHREHAIEGVQFHPESVLTQGGHRMLANWLGECGDRAAGELVPPLEQDVERLRLSAR"
FT   gene            complement(82468..83613)
FT                   /pseudo
FT                   /locus_tag="Namu_0076"
FT   gene            complement(84213..86243)
FT                   /locus_tag="Namu_0077"
FT   CDS_pept        complement(84213..86243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0077"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG:
FT                   acp:A2cp1_0133 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76513"
FT                   /db_xref="GOA:C8XIS6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS6"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACV76513.1"
FT                   /translation="MTGYLFGDRYQVGDTLGFGGMSEVHRGRDLRLGRDVAIKVLRADL
FT                   ARDPSFQARFSREAQNAASLNHPAIVAVYDTGETKNDSGTIPYIVMEFVDGDTLRDVLK
FT                   KEGPLAPRRAMEIVADVCAALDFSHRHGIVHRDIKPANIMLNRAGAVKVMDFGIARAVS
FT                   DGQATMTATAAVIGTAQYLSPEQARGEAVDARSDVYATGCVLFELLTGEPPFTGDSPVA
FT                   IAYQHVREAPRAPSDVRPGLPKEMDAIVLKALNKNPLNRYQTAADMRSDLVRALSGQAV
FT                   QATPLMSDDERTELMRATPARVGAGSPPLLAPPTRAATDDDWEPEEADRSKRVWGFIGI
FT                   GLLCAALIAGAIWLTLRVISAPPPAALVAVPDLSGMSLEEATAKLRDSRLTLGTVTPTE
FT                   SSDADKDKVVNQRPSSQTQVAQDSAVNLEIGKGVSLIAVPNVVTYTPEEAKKALNAANL
FT                   QYEEVPQSSSDADKGKALAQDPAAQAQVPPGTVVKVTVGTGLQVVQIPDGLVGKSLDEA
FT                   TQILTDAKLQVVSQTADSAQPANEVIAADPAAGTRVQEGTPVTLTVSNGNLMVMPNLVN
FT                   STPAEAVAALQARGWTGGADTLRQTTQEVTNPGLVGAIISQNPSSGSTVPKGTAVRVVV
FT                   GVAPPPPPTTPTTPTPETTTPPATPSPATPPAATPPAAATP"
FT   gene            complement(86395..87543)
FT                   /locus_tag="Namu_0078"
FT   CDS_pept        complement(86395..87543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0078"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: azo:azo3774 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76514"
FT                   /db_xref="GOA:C8XIS7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACV76514.1"
FT                   /translation="MTAPGVMLSQRYRLTRRIAVGGMGEVWAADDVRLARVVACKILRP
FT                   ELTGDPEFLGRFRTEARITASLNHPGICAVYDYGEVSGGNHYLTGTAYLVMELISGESL
FT                   SSVLNRLGRLSVGRTLDVLEQTGHALQQAHGQGLVHRDIKPGNLLITPGGQVKITDFGI
FT                   AKVAHEAPVTRSGMVMGTAQYISPEQAAGRDATPASDIYSLGVVAYECLSGRLPFQSDN
FT                   TVAIALAHVREAPPPLPEDVPAPIARLVMAMLAKDPAARFPNGEALARAAGQLRSGGPE
FT                   PRPPAPRPTLIAPIAPANAARPAAPRSPAPARPTRAAAPTMTPPAVRSAPPPQYRPPPT
FT                   PAPVSRSSGRRTGLSVLLAVLILLLAGLVLVVLNAVFGSMAM"
FT   gene            complement(87562..89043)
FT                   /locus_tag="Namu_0079"
FT   CDS_pept        complement(87562..89043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0079"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: aeh:Mlg_0172 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76515"
FT                   /db_xref="GOA:C8XIS8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS8"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACV76515.1"
FT                   /translation="MKRPLRRLGTAVIVMVVLLLANIAYTQVIKADDYRADPNNKRTLV
FT                   AEYSRQRGQITAAGGVVLARSDPVDDQYSYQRVYPEGAAYAHPVGYYSMRYGPTGIERN
FT                   QNEILSGEAPELIAGQLSDLITGRDPRGGNVQLTLVPAVQQAAYSAMADKGYVGAVVAM
FT                   EPSTGNILAMVSTPSYDPNPLASHSDATQRQAYNDLVNADPSPLLNRAVSAVYPPGSTF
FT                   KLVIAAAALQNGYTPQTTVTGEPTITLPGTGGATLSNFGGETCADAGGEDVTLTQALAH
FT                   SCNTAFAEVAMSLGAPVVRKQAEALGVTGDGVDVGMDVVGSRLGDIPDTAALAQTGIGQ
FT                   RDVAVTPFEMAWVTATIANRGDQMAPHLIAQTTKPDLTVISQTQPESLGQAIPIPVADQ
FT                   LKDMMIESEKQTPLSGSIADLVIASKTGTAEHGTDPKNTPPHAWYVAFAPADNPKVAVA
FT                   VLVENGGDLGVEATGARVAGPVGRSVIAAALAGGS"
FT   sig_peptide     complement(88963..89043)
FT                   /locus_tag="Namu_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.925 at
FT                   residue 27"
FT   gene            complement(89040..90503)
FT                   /locus_tag="Namu_0080"
FT   CDS_pept        complement(89040..90503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0080"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: gur:Gura_3975 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76516"
FT                   /db_xref="GOA:C8XIS9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIS9"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACV76516.1"
FT                   /translation="MSRRPDATAGARPIRTGRTAEFWMLVFAAVVVTSALVIVELNQSR
FT                   TLSWSLAYYGGGYLLALAVAHLLIRRYAPYADPLLLPIVALLNGIGLVMIYRLDLAREI
FT                   SAINRGEEVPTPQASLQLVWTAVALVFFLVVLLVVRDHTVLQSYAYTLALVGVVFLIIP
FT                   ALLPSSLSEVNGAKIWIRVPGLFSIQPAEFAKIALIIFAAAFLVSKRTVLSTAGKKVFG
FT                   LVLPRGRDLGPLLVALLLVLGVLVLGKDLGSALLIFGTFLAMIYVATGRVSWLIIGVLG
FT                   FSAGAYLAYRMFSHVRVRVDIWLDPFADPLGNGYQLVQSLFGLGTGGIFGTGLGAGRPD
FT                   IVPFASTDFIMAALGEELGLVGVTAILLCYLILTARGIRTGLAAKDGFGTLLAGGLSFS
FT                   LALQMFIVVGGVTRLIPLTGLTTPFLSYGGSSLLSNYVILALLVRISDSSRRPPEPVRP
FT                   APTPEVPLDEAHTQMVPAVPAAQRAGGRS"
FT   gene            complement(90500..92059)
FT                   /locus_tag="Namu_0081"
FT   CDS_pept        complement(90500..92059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0081"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: sfu:Sfum_2540 protein serine/threonine
FT                   phosphatases; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76517"
FT                   /db_xref="GOA:C8XIT0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT0"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ACV76517.1"
FT                   /translation="MTHQLAYAARTDRGLVRASNQDAVFAGNTLLVVADGMGGHAAGDM
FT                   ASRLVVNAFVPLDARDPGGDLLRALAKATREGNRSISAVVHDNPELDGMGTTVTALLFD
FT                   GGRLAMAHVGDSRAYLYRDGILHQLTHDDTFVQSLIDDGRITQEEASHHPQRSLLLRAL
FT                   NGTEVDPALTIREVSVGDRYLICSDGLSGVVSAEAIAEALADPDPGAAADALVQFALAG
FT                   GGPDNVTVIVADVMDTGLGDGPTALAAPPLDPDATGPIGALPSIRMTAEMPRIPLPGIP
FT                   EEAAAPAEFMPPDEDITAPIATSGPDPDSPPARRRRRRTTLVLVAVIVVLGVAGLIGSI
FT                   LWVRTQYFVGESAGQVVVYRGVDGSVLGFGLSSVQEGSCQPGLNGCAPLMVEDLVPAAR
FT                   DQVVAGIQAGSLDDARAVIARLAGQMLPICPTVTEPSTTPTAAPTAIPTLTTTPTTVTP
FT                   LVPGASAAPPSTPANPTASPAPSGVSTDTGTALSTTTGTATSGTPLSTRALEPGVTCRV
FT                   PK"
FT   gene            complement(92139..92609)
FT                   /locus_tag="Namu_0082"
FT   CDS_pept        complement(92139..92609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0082"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce2902 GGDEF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76518"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT1"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACV76518.1"
FT                   /translation="MPALILQLTRIGFLVLLCLFVLAAIRVIRTDLRYAGEPRTDGGRR
FT                   RGGQAAVAQVPQGRLQPSTLVVTAGSLAGTRLRLGPGPILIGRAEDSTLVLDDDYASSR
FT                   HARLTQQGQEYYLEDLGSTNGTYLDRVRVTTPTPVPVGVPIRIGRTVIELRP"
FT   sig_peptide     complement(92538..92609)
FT                   /locus_tag="Namu_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.847 at
FT                   residue 24"
FT   gene            complement(92646..93830)
FT                   /locus_tag="Namu_0083"
FT   CDS_pept        complement(92646..93830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0083"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce6476 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76519"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT2"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACV76519.1"
FT                   /translation="MGVIQTFERKLQGAVGNTFARLFGGKVQPAEVADALQREAADHVQ
FT                   HQGAVAVAPNHYKVSLGPTDQQGLSSADESVATALSDMIREYLNQQGWQTFGDISVTLE
FT                   QSQALHTGQFRISSFVDPDVGRRSSQARAGVGRMSQQPGDYGRDSQGRSPDQGDRREPD
FT                   GRSYPGSPNQYGQQPGYGPDQGQANPGYPPQPYDAPGYGQRGWDPQSQQWEQQYGQQPP
FT                   PGYPQQNGPQQNAPQYPSGPGGWDQGGGYQQPGYPQGYPPPDYQQGYGQPGYQNYPQQP
FT                   AQPNWGQNYGVPAAGPQEITATLSVDDGSGRSYQLQRGSNVIGRGQDASFRLADTSVSR
FT                   RHVDIYFDGQSAVLHDLGSTNGTTVNGSSVQTWQLADGDVIHIGHSTVVFSSRY"
FT   gene            complement(94027..94665)
FT                   /locus_tag="Namu_0084"
FT   CDS_pept        complement(94027..94665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0084"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: spe:Spro_0264 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76520"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT3"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ACV76520.1"
FT                   /translation="MRTIRRAGTHELQIQRSRFICALSPAESAEQATAFIEQVRSTHWS
FT                   ATHHCTAFRTGAHGEQQRSNDDGEPAGTAGVPMLQVLTAREITNTVAVVTRYFGGVKLG
FT                   AGGLVRAYGRSVSEALDAIGVFDLVPHTELTVTVEHAAAGRLEHGLRSAGAEITGIDYA
FT                   ARVTVHLLVPTAGRAALGRWLAQFSGGSADLVEGSQSLRAVPPARPDLA"
FT   gene            complement(94800..96166)
FT                   /pseudo
FT                   /locus_tag="Namu_0085"
FT   gene            complement(96172..99417)
FT                   /pseudo
FT                   /locus_tag="Namu_0086"
FT   gene            97344..98744
FT                   /locus_tag="Namu_0087"
FT   CDS_pept        97344..98744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0087"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: eba:ebA6749
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76521"
FT                   /db_xref="GOA:C8XI56"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI56"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV76521.1"
FT                   /translation="MMTKQVEEILDEPHEQIVQRVCAIDVGKDSGTVCVRVPAASGTGR
FT                   RVSKVWDVPARTRAVLGLAAQLSDQGIEKVTLESTSDYWRIWFYLLEAHGLDVQLVNAR
FT                   DVKNVPGRPKTDKLDSVWLAKLTEKGLLRPSFVPSAQVRQLRDYTRMRADLTGDRTRYW
FT                   QRLEKLLEDALIKVTSVASRIDTLSVRDMIEALIAGQRDPRVLAGMARGRMRLKYADLV
FT                   ESLTGQFDDHHAELARMLLHQIDTLTDQIDVLTARIEALLASLPAGNTPDPDRPAPDGQ
FT                   TRPGTRANAPADEAAQRRTPPTAADMIKILDQIPGIGPSNAQVIIAEIGLDMSRFPTAG
FT                   HLVSWTRLCPRTIQSGKRSTTGKTGKGNRYLRAVLGEAAATGGKTQTFLGERYRRLIKR
FT                   RGKLKTIVAIARSILVIIWHLLANPGTTFHDLGVDFNDHRIDIGRRTRNHVRQLEALGF
FT                   NVTLTAAA"
FT   gene            complement(99639..99794)
FT                   /locus_tag="Namu_0088"
FT   CDS_pept        complement(99639..99794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76522"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76522.1"
FT                   /translation="MSTTPRPTKSGAALAFVPQRPAIVAKFRGALTLPARPERFRLFGS
FT                   QAVAIW"
FT   gene            complement(99913..100707)
FT                   /locus_tag="Namu_0089"
FT   CDS_pept        complement(99913..100707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0089"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   rso:RSc2321 dehydrogenase/reductase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76523"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76523.1"
FT                   /translation="MALDLNNLTGRTALITGASSGIGRQFAHEFARRGCDLVLTARSRG
FT                   RLTELADELRHTHGVTALVLPHDLGRPGATADLADKLTTHQVTVDILVNNAGFGAHGDL
FT                   VDTPPERLEAMTALNVDAVVGLTSRLLPGMVERKAGAVINLASTAAFQPVPHMAVYGAT
FT                   KAFVLSFSRALWAETKGSGVAVLALSPGATDTEFFQVADEDAAVGPRRSTAQVVGTALR
FT                   ALAQGRPSVVDGRRNALMAWVSPRSPERLVIGVAERTVRPAR"
FT   gene            100760..101410
FT                   /locus_tag="Namu_0090"
FT   CDS_pept        100760..101410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0090"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rme:Rmet_4723
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76524"
FT                   /db_xref="GOA:C8XIT7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV76524.1"
FT                   /translation="MLAMSTCEDGVMTRAGRASYHHPDLRAALLEHGIALAREGGPEAV
FT                   SLRDVQRRAGVSNSAAYRHYADRAALLDAIAERANADLSGRMQAALDAVPGDLSPVDAA
FT                   RARLRGLGRVYVGFALDEPGLFATAFGDRDKDLLVHQHAGDDPYVLLGRCLDDLVAAGG
FT                   LEPGHRPWSEVAAWSAVHGLAVLLGGGPLRGMAPADREAVIERVLDVLIAGLT"
FT   gene            101478..101560
FT                   /locus_tag="Namu_R0003"
FT                   /note="tRNA-Leu4"
FT   tRNA            101478..101560
FT                   /locus_tag="Namu_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(101840..102853)
FT                   /locus_tag="Namu_0091"
FT   CDS_pept        complement(101840..102853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0020 initiation factor 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76525"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76525.1"
FT                   /translation="MHGDDKLPLGDLICPEPGCRAELVAVEVRKTGTRFLRNRPGTSDC
FT                   GHALGRAQSGGPPSAEHRWLQQRLAEMCGDLGHSAIQEHYESRADVWVHNTPPLAIEVQ
FT                   RWPTAFADRSRARQSTGANVLWLLPESASSQKAAKELFRQPAARVRVFEEGSRHVSATP
FT                   WNPGHSDRVWLSIGATVMRPSADGLTLVSAGNYDAKTFLREVLDGRRRWFGPREVGFKY
FT                   GSGWARPDEVEQMRAARARVKLRVPAPTLQAWPALVATDRLAVADQAPPTDTPPVAAAP
FT                   SIPGPEDFPSRPASGSADAVSQAELTHKVDPPTPSVMSGSTQRGWFRRFRTWLTGV"
FT   gene            103192..104178
FT                   /locus_tag="Namu_0092"
FT   CDS_pept        103192..104178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76526"
FT                   /db_xref="GOA:C8XIT9"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76526.1"
FT                   /translation="MTFAGGFRLAIGLLLTVGTLGVLFTALDPIWNGHPAYPATLLVGT
FT                   AVGLVLIASAFWSQGRPDDLPTGQEVTPARPPRWRRVLRITGRVVGAVLVVVVLAILVW
FT                   LRPFPAGAGARSALTADASVTVVDRPTSIELVPAGTPDTALVFVPGARVDARAYAQILR
FT                   PVAEAGHLVVILKAPFGMAIAQPGQAGGVIEDHPEIGTWAVGGHSLGGVVASWYAQDHP
FT                   DQIDGLLLFGSYSDRDLSARTDLAVESVWGSNDGLTTPDDIDRTRGNLPATTEFTEIVG
FT                   GVHAYFGDYGEQPGDGSPQIDRDQATAEISAAAVDFMNGFGGARSGR"
FT   gene            complement(104183..105820)
FT                   /locus_tag="Namu_0093"
FT   CDS_pept        complement(104183..105820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0093"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: gur:Gura_2738
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76527"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU0"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ACV76527.1"
FT                   /translation="MAYPLFHELGPAQAPMVLSQADFARAFPSEGDYVEFKQGIPESKV
FT                   AEAVAAFSNANGGVVLLGVNDTGRVTGIGSDGETQARIHRAVAAVRDPGRYELHVLQVE
FT                   DRHVLALAVHRRREGFAQMHDGRLLIRRGAMNSALMGNELAVFVSGRALTRFEQTPVNT
FT                   LIGAADPNLVTKLIETFGWGSEGTLARLFEGGLIDTPTERSPLTVAGALYLLPRPADVL
FT                   GKAYIEIFRYRNPGEEYDSRIEFSGPADQQVGDATEHIMKELGSDIVILGLYRHELPRI
FT                   PQPVLREALANAVAHRSYESARQSIRVEIHRDRVTIKSPGGLPEPVTIANMRQQNASRN
FT                   ATVIRILRAMRLAEDAGRGVDVMQDEMAAAMLNQPIFDTDGHHVEVVLPLGSAVSPPER
FT                   AWLAEIERRGSIRPDDRLLLVHAARGELLTNTVARELLGVDSTHARASLGRLKAMGYVQ
FT                   QHGERGGATYSLAHELAPPPGLGLAQDDLRSLVIGLAKSAPITNESVRERTGLDRAAAL
FT                   RLLSELTNDGLLVRHGSRRGTFYTLAEK"
FT   gene            complement(105992..106969)
FT                   /locus_tag="Namu_0094"
FT   CDS_pept        complement(105992..106969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0094"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   scl:sce5223 DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76528"
FT                   /db_xref="GOA:C8XIU1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU1"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACV76528.1"
FT                   /translation="MSDAPGTSGRLLRLLSLLQARRDWPGEVLAERLEVSPRTVRRDVD
FT                   RLRDLGYPVRATKGPDGGYRLDAGAELPPLLFDDEQAVAVAVALQTASASVSGIEEGAL
FT                   RALATVRQVMPARLRGRVDALQVTAVPTDRERPRVDSTVLIAVGSAVRAREVLRFEYER
FT                   PNWTGEERAAEPPRRVEPHQLATWSGRWYLVGWDLDRQDWRTFRVDRMTPKTPTGPRFT
FT                   PRALPGGDVASYLQDAFRGREWPCRGEFVIHAPAAEVHPWAGRQSVVEPLGPELTRVVS
FT                   GSWSWERLAAWVSWWEVPVEIVGPDELRAAATRLGRRFLAAAGS"
FT   gene            107100..108101
FT                   /locus_tag="Namu_0095"
FT   CDS_pept        107100..108101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0095"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aeh:Mlg_2715 daunorubicin resistance ABC transporter
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76529"
FT                   /db_xref="GOA:C8XIU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV76529.1"
FT                   /translation="MIRTRNLTKDFVVSRIKTVHAVRGISLDVEDGELIAVLGPNGAGK
FT                   TTTMRMLTTLIEPTSGSASVAGHDVVTESARVRSLIGYVGQGNGAGHMQRAVDELYSQG
FT                   LIYGLDRRAARRRAGELIEALDLTALATRKVSSLSGGQRRRLDVAMGLVHNPSLLFLDE
FT                   PSTGLDPHNRANLWDHILQMRQRAAIPMTIMLTTHYLDEADSMAGRVVVVDNGQVIADD
FT                   TAEALKADLAGDRVQVGLDGPARVADLATLIARAPGCRDVVIDGATVTARVADGPRTLP
FT                   DVVRAADRADLTVASAQVFRPTLDDVFLSLTGRSLREAELGQPTDETRSPAA"
FT   gene            108191..108934
FT                   /locus_tag="Namu_0096"
FT   CDS_pept        108191..108934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0096"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: aeh:Mlg_2716
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76530"
FT                   /db_xref="GOA:C8XIU3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV76530.1"
FT                   /translation="MMTRELRPVLRDPFSVIFGMIQPLVFLALFGPLLVGSLGGQAQTT
FT                   VGDSVWQWFVPSILVMTALFGTTTVGANLLFEFQTGAHERMLVTPLSRPSLLIGRALKE
FT                   MAPLAAQAVIIVAVMIPFGFTLYPAGALVGFLLLAVFGIGIGSLSYALAIAVRKQEWMF
FT                   WAVQQTVIFPLMILSGMLLPLETGPGWMQVAAKFNPLTYLVNAERALFAGDVGSAAAAW
FT                   GWVAALGTVAVGLAVGIRSMRRSAG"
FT   sig_peptide     108191..108319
FT                   /locus_tag="Namu_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.640 at
FT                   residue 43"
FT   gene            109024..109998
FT                   /locus_tag="Namu_0097"
FT   CDS_pept        109024..109998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0097"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: short-chain dehydrogenase/reductase
FT                   (SDR) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76531"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76531.1"
FT                   /translation="MARIPQALTGAADRVLDALVVPGYSKIGVAARRHWWPADPVPFAR
FT                   RVDVVVTGASSGLGAAAAQGLAALGARIQMVGRKAARLESAADRIRAAVPDAELVVREA
FT                   DISDLGSVRALAATLREELTDLHGLVHCAGLMPPERTLTDEGNELAFATHVLGPLLLTT
FT                   ELRPLLAADGDGRVVFVSSGGMYSAALSDDFDSSQGEYKGVRAYARTKRMQVTLTEQLA
FT                   LTFDRIDDPVVHSMHPGWAQTPGVTDSLPGFDKVAKPILRTPDQGADTIVWLVAAAEPS
FT                   RSSGRFWHDRRVRPTHYLPWQHDDPAIRATLWRESLSRTGATL"
FT   gene            110212..111048
FT                   /locus_tag="Namu_0098"
FT   CDS_pept        110212..111048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76532"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76532.1"
FT                   /translation="MSEKDLARIAALLRKAEGTDNDHEADAFLQAAQRLATLASVDLAM
FT                   ARSHTQRQERRPVPTQRAIVIGESGKRGLRTYVELFLAIGRANNLTCDIARDSTRVHAF
FT                   GFDTDIDMAQTLYASLVVQMVRASDAYIKSGDYAVEKVIKRVAVTTPGRSGGWRQEYQY
FT                   VEKPVHATTARINFQQAFAHRIAARLAQARQETEQQLIAEQPDEQGRGVALVLRNREVE
FT                   LADHYRAHSQARGTWSGTRAAAGQAERSRRAGDRAGRRARLTPEKAIGGQRGAIDG"
FT   gene            111020..111550
FT                   /locus_tag="Namu_0099"
FT   CDS_pept        111020..111550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76533"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76533.1"
FT                   /translation="MGSVGRSTAETAPRDGQRAKVYEAEHLVHRIFDRSAEYPVVQIAG
FT                   SQLVLPPERRFGSVPAVQVYVRRVLDLGWVRATWPRATVPVRVRERAGSTQAHYERAGA
FT                   VMAVPGYRTGSGWALRELVILHELAHHLADQVEPAHGGPFVDRLLTLVDGVIGAEAALL
FT                   MRITMLDAGVAIG"
FT   gene            111641..112648
FT                   /locus_tag="Namu_0100"
FT   CDS_pept        111641..112648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0100"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: abb:ABBFA_003384
FT                   pirin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76534"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU7"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ACV76534.1"
FT                   /translation="MTNVETDPAELVCRSGASGSGAAGPVEILEPRDVPLGGIRAMTVR
FT                   RTLPLKQRSLIGAWCFADHYGPDRVADSGGMDVAPHPHTGLQTVSWLFEGEIEHRDSLG
FT                   SHAMVRPGELNLMTAGQGISHSEVSTPATQLLHGVQLWVALPDAARQIAPSFEHVVPDD
FT                   ARDGDVRCRVFIGSWLGLSSPATVHSPLLGAELVLAPGARTELPLTAEFEHGFLVDSGD
FT                   VRVDGAPVGRAAMAYLPPGTRTVSLSNGATPARLVLLGGEPLREEIVMWWNFIGRSHDE
FT                   VVAFRQQWQDEIAAFAAGSAPVTRFGRVVGYPGRPLPAPEMPAIRLRPRPSPGR"
FT   gene            complement(112654..112746)
FT                   /locus_tag="Namu_0101"
FT   CDS_pept        complement(112654..112746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76535"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76535.1"
FT                   /translation="MAIAIFVNLANRGPARSTTAAGSTPAHPEP"
FT   gene            complement(112786..112971)
FT                   /locus_tag="Namu_0102"
FT   CDS_pept        complement(112786..112971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76536"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76536.1"
FT                   /translation="MVRRFTTIRWVDVTMVFQPAPGDPIRIRRSDGKLFVLPGVGLDRL
FT                   PEILALATQDSAEPRA"
FT   gene            complement(113236..113610)
FT                   /locus_tag="Namu_0103"
FT   CDS_pept        complement(113236..113610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0103"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bmt:BSUIS_A1504 methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76537"
FT                   /db_xref="GOA:C8XIV0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV0"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV76537.1"
FT                   /translation="MTTTRARPALPLTDLAACCSPPPGRVLDPAEADRLAGVLKALAEP
FT                   NRLRLVSMIAANAVGGATCVCDLIEPLGLSQPTVSHHLKVLTDAGLLTREQRGKWAYFS
FT                   LIPGALAAVAAAITPAGVPE"
FT   gene            113701..114483
FT                   /locus_tag="Namu_0104"
FT   CDS_pept        113701..114483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0104"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   rpt:Rpal_4080 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76538"
FT                   /db_xref="GOA:C8XIV1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV76538.1"
FT                   /translation="MATVDEDLRDQVRDRYARAALAVTAPAGAADCCGGGCGATVLDDP
FT                   DAPFGAGRYEPEQTSELPPEAVLASLGCGNPLAVAELRAGERVLDLGSGGGIDVLLSAK
FT                   RVGPTGFAYGLDMTDEMLVLARANAAKAGAANVEFVKGHIEDIPLPDAAVDVVISNCVI
FT                   NLSVDKPAVLAEMFRVLAPGGRIGISDVVAEDHLSVADRAERGSYVGCIAGALSRQEYL
FT                   DGLAAAGFVDADVTFTHEAAPGLHAAIIRARTPRPAGS"
FT   gene            complement(114488..115168)
FT                   /locus_tag="Namu_0105"
FT   CDS_pept        complement(114488..115168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0105"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; regulatory protein ArsR; KEGG: rsq:Rsph17025_1410
FT                   protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76539"
FT                   /db_xref="GOA:C8XIV2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV2"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACV76539.1"
FT                   /translation="MDEQLTRRARMHAALGEPARLAIVDRLLPGDASPGELGAALGLPT
FT                   NLLAHHLRVLQDAGVIGRVQSEGDRRRTYVQLRLDDPLVQALARPIDPASRVPLPTGPR
FT                   VVFVCTHNSARSQLAAASWARVSEIPVACAGTHPAPRVHPGAVAAGRRHGLRLGRARTA
FT                   HIDEVVQPADLVVAVCDSAHEELDPARPRLHWSIPDPVRVGTDAAFDAACDEIDRRVRT
FT                   LAAD"
FT   gene            115257..115664
FT                   /locus_tag="Namu_0106"
FT   CDS_pept        115257..115664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0106"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: arsenate reductase (ArsC); K03741 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76540"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV3"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACV76540.1"
FT                   /translation="MSDRPSVLFVCVHNAGRSQMAAGFLTALAHGQVEVRSAGSMPADQ
FT                   VNPVAVQAMAEVGVDIADQQPKILTTDAVQASDVVITMGCGDACPIFPGKRYEDWKLDD
FT                   PAGQGIDSVRPIRDDIRTRVLALIDELLPAQ"
FT   gene            115891..118062
FT                   /locus_tag="Namu_0107"
FT   CDS_pept        115891..118062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0107"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   dde:Dde_0102 glutamine synthetase, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76541"
FT                   /db_xref="GOA:C8XIV4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV4"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ACV76541.1"
FT                   /translation="MSGSQSRRQAINAVTGYQVPDKDFTEPLGELFGRNTFSPAVMKSR
FT                   LPKSVYKSVMSTIDKGTPLDPTVADVVASAMKDWALENGASHYAHVFYPLTGLTAEKHD
FT                   SFLSPEDSGASMAEFAGKTLIQGEPDASSFPNGGIRNTFEARGYTGWDVTSPAYILENP
FT                   NGNTLCIPTVFISWTGEALDKKTPLLRSQQAMSKQAARVLTLFGHDDIDTVVSYAGAEQ
FT                   EYFLIDRHFYFSRPDLMSSGRTLFGAKPAKGQQFDDHYFGAIPERVLAFMIEVDRELFK
FT                   QGILAKTRHNEVAPGQFEIAPLFEKANLAHDHQQLMMTTLQRVAQRYGMECLLHEKPFA
FT                   GVNGSGKHVNFSIGNGNQGNLLNPGDTPHENVQFLVFCAAVIRGVHKYGGVLRAVVASA
FT                   RNDHRLGANEAPPAIISIFLGEQLADVFDQIAAGALTGSKPAGTLTLGVDTLPPFKADP
FT                   GDRNRTSPFAFTGNRFEFRAPGSSQSISGPMVAINTILADSLDYIATELEALIEGGMEF
FT                   DAAVQKVLKDIITEHGAVVFNGDGYADAWQVEAAERGLPNLKTTVDALPQFDRPEVKDL
FT                   FEKYGVLSNRELASRLEVYLEQYALSVMLEASETLEIAKTKILPAAIRYQGELAGAAMN
FT                   LKAIGMSFDSPTLDAITASVGALTSGITGLETALGIHAGESSMEEAVYAMEKLIPAMAA
FT                   VRAAADELEGLVADDTWPLPTYQEMLHIL"
FT   gene            complement(118225..120639)
FT                   /locus_tag="Namu_0108"
FT   CDS_pept        complement(118225..120639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0108"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: aeh:Mlg_1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76542"
FT                   /db_xref="GOA:C8XIV5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV5"
FT                   /inference="protein motif:COG:COG3973"
FT                   /protein_id="ACV76542.1"
FT                   /translation="MSDSDNPSPDGPPAGRSPADTIEVEPAADPVAQEQAVIDVLYRRL
FT                   DDLRAERVELRDRYISRSDNTPGGRVERDLAYANHAAAVVALNAAEDRLCFGRIDRTDG
FT                   ESMHIGRMGIFDDEGDHRQLLMDWRAPSARPFYVATAANPLGLRRRRYITTRRRRVESA
FT                   NDEYLDLTDPQALAAARASGSGPAGEAELLAALRAPRTGRMSDIVATIQAEQDRIIRTE
FT                   LAGILVVQGGPGTGKTAVALHRAAYLLYNHREQLQQRGVLIIGPNRTFLTYIGQVLPAL
FT                   GENAVVLSTIGDLFPGVSAQAIEDPDTSRVKGRTAMTTVIANAVLHRQALPRTPIAVPF
FT                   DGAPQSRLVLDGAILTPARDRAWASRRPHNQARPVFLRRVIDGLVRQVAARLGTGPDGQ
FT                   SLATPDDLDAIRQDLMEHDGLRVALRDLWPALTAPRLLADLLGSASRLEFAAESLSPRD
FT                   RALLLRADDPAAWTAADVPLLDEAAELLGTLPASTTAADADDRYAAEVLDLLGANDDLD
FT                   PEDVGLHSMVGMVNAQTLSRLHEEVADWTSTAERAAADREWTFGHVIVDEAQELSAMAW
FT                   RMVMRRCPMRSMTLVGDLAQTSDPAGALSWSRMLRPYVRGRFQVEELTVNYRTPAEIMT
FT                   VAEPVLMAIDPNLTAPRSVREAGIRPTHRRVASADLAAQVVDLVREEDDEPGTIAVLVP
FT                   RARYAAVAEAVEQARTGAPGTASANAQPSLFETIDPAPDLRRHVVVLTVMQAKGLEFDS
FT                   VIVADPAGIIAESGRGLSDLYVALTRTTQRLTVVHTGELPSVLARLREPAA"
FT   gene            complement(120732..121712)
FT                   /locus_tag="Namu_0109"
FT   CDS_pept        complement(120732..121712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0109"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   cti:RALTA_B0861 NADPH:quinone reductase; zinc- containing
FT                   alcohol dehydrogenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76543"
FT                   /db_xref="GOA:C8XIV6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV6"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV76543.1"
FT                   /translation="MPATRLAAYVDQRGPADSIRLGRLPVPELGPDDVLVAVTAVSVNP
FT                   VDTYVRSGRYDTPIPLPFIVGRDLVGTVAEIGSAVRDLAVGDPVWANSLGHAGRQGAAT
FT                   ELAVVARDRLYRLPAGVDPELAVAVAHPAVTAYLGWFLRARIRPGWTVFVGGGAGNVGI
FT                   AAIEMATRAGVRVIASARDDHADRCRAAGAQAVVDYRAADLAERIRSAAPNGVDVYWDT
FT                   SGTNDTAVAADVLRPGGRMLVTAARSPVTVNLAPLYTHDVTIDGFVISRASAAEFAQAA
FT                   ELINAMLAAGELTTRITDRLPLAQAAQAHARMESGPVDGRLLLLV"
FT   gene            122308..122601
FT                   /locus_tag="Namu_0110"
FT   CDS_pept        122308..122601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0110"
FT                   /product="transglycosylase-associated protein"
FT                   /note="KEGG: gbm:Gbem_1481 transglycosylase-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76544"
FT                   /db_xref="GOA:C8XIV7"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV7"
FT                   /inference="similar to AA sequence:KEGG:Gbem_1481"
FT                   /protein_id="ACV76544.1"
FT                   /translation="MTITGIISAIVIGAIIGALARLILPGKQDIPIWLTIVVGVVAAFV
FT                   GTFLARALGVPTQTDGIDWLELLVQLVVAVIAVAAVVAFGRRRSGLRSGTRS"
FT   gene            complement(122862..124415)
FT                   /locus_tag="Namu_0111"
FT   CDS_pept        complement(122862..124415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0111"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   scl:sce1510 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76545"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6G3"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV76545.1"
FT                   /translation="MQGRSRDQRELLDAESVVGGLLKPGSVFAFLAAHRREVFPDGMFA
FT                   DLFPSGRGRPSVPADVMASVIVLQALHGLSDADTVDSVTFDLRWKAACGLPVTAAAFHA
FT                   TTLTYWRRRLAASQSPNRIFDAVRQVVDQTGVLAGKSRRALDSTILDDAVATQDTVTQL
FT                   IAAIRRVRREVPGAAEVVGEHCSAHDYDDPGKPAIAWNDQQAREALVDALVTDAHRVLG
FT                   HLPDQELGPKAADAVALLALVAGQDVEPVEGSDGTDGRWRIAQRVAPDRVISTVDPEAR
FT                   HAHKTVHRRQDGFKAHIAVEPDTGLVTACAVTMASGRGNSDAEVGPTLLAQETEKLHVL
FT                   ADSAYGSGSARAELDHAGHIALIKPFPLRSAVPGGFTLDDFTVDPEARTATCPNGVTRS
FT                   ITAQWSVTFGAACRGCPLRAQCTTSDAGRSLKLTEYESLLRAARRQAETEDFQQVYRRH
FT                   RPMVERSISWLVRGNRKVRYRGVAKNDHWWHHRAAAINLRRMLTLGLTRVSGTWTIAPA
FT                   "
FT   gene            124515..125414
FT                   /locus_tag="Namu_0112"
FT   CDS_pept        124515..125414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0112"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rec:RHECIAT_PC0000780 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76546"
FT                   /db_xref="GOA:C8XIV9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIV9"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACV76546.1"
FT                   /translation="MRFGLVGTGPWAGIAHGPGLLACPEVELVGIWGRDPAKAAALADE
FT                   LGLALGAAYPDVDALLADVDAVAFAVPPSIQAELALRAARAGKHLLLDKPIALDVAAAD
FT                   ALEAAVAASGVASLVFFTDRFVDTSRDWFTHVRATGGWRGAWFRWLSTLQAPGNPFGGS
FT                   AWRREQGALWDTGPHALSTLTGALGPVARITAVAGDGDLVTLIVGHESGATSTVVLSQF
FT                   APPAAASFDCTLWGEAGLVPMPPRPDGRIVEIYATAAGELVRSATGGRPTDADVRLGAT
FT                   ITRLLADAQAQLNRPSST"
FT   gene            125448..126965
FT                   /locus_tag="Namu_0113"
FT   CDS_pept        125448..126965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0113"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; KEGG: mxa:MXAN_0278 mercuric
FT                   reductase, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76547"
FT                   /db_xref="GOA:C8XIW0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW0"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACV76547.1"
FT                   /translation="MTSPEPARKAADLAGESDVYDVVVIGGGPPGEIVAQYAIADSTRT
FT                   AVIVEHELLGGECSYWACMPSKALLRPVELLDAARHMPGVASLVAGRTIDVPAVLERRD
FT                   GFTSHHDDKYQVQWANDTGIGVVRGHGRLAGPKQVEVTGADGATRIITARHAVVLATGT
FT                   TASVPDLPGLRAALPWTSRDVTNLHEVPRRVAVVGGGVVACESASWLHGLGVQELTILV
FT                   RGGGLLDRNEPFAGELVAQAFRDAGVKVLLHTGLDEVRRADPAATGEGRTHGGEVTLRF
FT                   GDQTLVVDELVVAAGRTPASADLGLDAVGVDVGASHGFVTTDDQLAVRGVDGQWLYAVG
FT                   DLTGRALLTHMGKYQGRICGAVIAARAEGRPTDGSRFTDLADDGRVPQVTFTDPQVASV
FT                   GRSERQARDAGLDVEAVEYDMAGFAGSSLLRDGYVGRAKLVIDRTTDTLIGATFVGAEV
FT                   AELVHAATVAVVGGVTLEQLWHVVPSYPTMSEIWLKLLEARSAGKAH"
FT   gene            127039..127602
FT                   /locus_tag="Namu_0114"
FT   CDS_pept        127039..127602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: seh:SeHA_C3506 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76548"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76548.1"
FT                   /translation="MTGFLGKWLKMPTLGERLRAQGVRDDLVRAAERTAFGRQTDRELP
FT                   RLAELLTDQEVVIQLVEGRWNKKMGLFALTSRRVLFVPGGDAPYGAEVPLTEVVSVESG
FT                   KAKGMGTVEVRTESSRLQVDQILGTQADTFAANTRAAMTPAGDGPAVYRDPLQELAELR
FT                   ALHAAGAVSDEEFAQRKIRLMDEI"
FT   gene            complement(127643..127864)
FT                   /locus_tag="Namu_0115"
FT   CDS_pept        complement(127643..127864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0115"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: psa:PST_2713 copper-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76549"
FT                   /db_xref="GOA:C8XIW2"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW2"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACV76549.1"
FT                   /translation="MSENTARYRVTGMTCDQCVVAVTEEVRRLEGVRSVDIELRPGDIS
FT                   VVTIVSDAPLLAGAVRDAIDEAGYALAS"
FT   gene            127990..129945
FT                   /locus_tag="Namu_0116"
FT   CDS_pept        127990..129945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0116"
FT                   /product="Neprilysin"
FT                   /EC_number="3.4.24.11"
FT                   /note="PFAM: peptidase M13; peptidase M13 neprilysin; KEGG:
FT                   mxa:MXAN_3160 M13 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76550"
FT                   /db_xref="GOA:C8XIW3"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW3"
FT                   /inference="protein motif:PRIAM:3.4.24.11"
FT                   /protein_id="ACV76550.1"
FT                   /translation="MTASPAADVIVPRPQDDLFRHVNGPWLATAEIPADRSADGAFYQL
FT                   RDEAEKDSRAIIEDAAAAADGAEPGSPVQLIGDLYRSFMDVEAVERQGLAPIAARLTEV
FT                   EGVDSPAALMRTLGRLRRSGVGGAFAIDVDTDPGDPDRYVLNLYQGGIGLPDESYYSDA
FT                   AHADVLSAYAAFLPSILELAGIPESAGAGAAVVELETAVAAGHWDRVRSRDSSQTYNPK
FT                   DRAGLDALLPGPLWDAWLDGLGADPSVLDQVVVRQPDYFTALAALLTPDHLPAWRAWLS
FT                   WQIVRSLAPLGPAELVEKNFDFYGRTLSGTPELRERWKRGVGFVEMAANEAVGRLYVER
FT                   HFPPESKRRMDELVANLLAAYRTEIGKLPWMGEQTRARALEKLDAFTPKIGYPARWRDY
FT                   TALTVAADDLIGNAARAAAFELDRELGKLGGPVDRDEWFMSPQTVNAYYNPGMNEIVFP
FT                   AAILQPPFFDPEADDAVNYGGIGAVIGHEIGHGFDDQGSKYDGRGALQDWWTPADRAAF
FT                   EQLTGRLIDQYSALEPKNTPGHHVNGALTIGENIGDVGGLGIAYQAWRISLGDQSAPVI
FT                   DGLTGAQRFFRSWATVWRLKMREAEQVRMLSIDPHSPAEFRCNQVVRNIAEFHEAFDTR
FT                   PTDGLWLDEQDRVRIW"
FT   gene            complement(129982..131313)
FT                   /locus_tag="Namu_0117"
FT   CDS_pept        complement(129982..131313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0117"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ppw:PputW619_4395 diguanylate cyclase;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76551"
FT                   /db_xref="GOA:C8XIW4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV76551.1"
FT                   /translation="MTALQEFAAAPWRARVWVLLSAVLAVGLALALSIWPDPVWQLTDI
FT                   VTALALVIGSVINVELGRLFEGGRVAQQRPHKALSAWPMAATVLLPTFYLLPVVALIYA
FT                   HARWRGMRVTLWKWCASACFLVCAGAIATIIVTPPGGDGTPPTLTSGLPGVLIMVAAIL
FT                   TFLAVESAMLGMSGWLNTAQDEVWLRRTLADPAFYLTEAGVLTIGALTGLLGANAPWFV
FT                   LLLIPVYGFLQQSVLHRPLQERATRDPKTGLLVFNAWQRLAVEEIRRMSAARRSWAVIF
FT                   ADIDNFRFYNQRHGHLGGDHALEHVAQIITSNVRPKDLTARFGGEEFCILLPDTVAAEA
FT                   ELVAQRLLTSVSAASASLPEPVTVSIGVAVVEAGNTPMELAVVLARADQALYRAKLEGR
FT                   NTVRIAAPAADIDSGVRTTWDAKLNRSAHRAQYSEDGERQRRWG"
FT   gene            complement(131471..132532)
FT                   /locus_tag="Namu_0118"
FT   CDS_pept        complement(131471..132532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0118"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: mxa:MXAN_6257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76552"
FT                   /db_xref="GOA:C8XIW5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW5"
FT                   /inference="protein motif:COG:COG2220"
FT                   /protein_id="ACV76552.1"
FT                   /translation="MTALTRTLGRAARGLPTAIGAGPDEIRPVAEGSSRFDGTSFSNVE
FT                   PAHVFGLRQGLRLLPELLRHRNGHPPMTIPLVTAPPASQAGELAVTWLGHATTLVELDG
FT                   HFVLTDPVWSQRVSPSATIGPARLHPMPIALAQLPALSAVVISHDHYDHLDLPTIRTLV
FT                   STQTAPFVVPLGVGAHLRGWGVPEDRIVELDWTRSTTVGDLEIVCTPGRHFSGRGLRRN
FT                   TTLWSSWALLGPQHRVYFGGDTGYTTAFADIARQWGPFDVTILPIGAYGDQWPDIHLHP
FT                   EEAATAHRDLGGALMIPIHWATFDLALHSWAEPMHRLRAAGTDIRIAAPRPGERVVPND
FT                   ITTTDGWWDVPVE"
FT   gene            complement(132688..133944)
FT                   /locus_tag="Namu_0119"
FT   CDS_pept        complement(132688..133944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0119"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: pin:Ping_2572
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76553"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW6"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV76553.1"
FT                   /translation="MTDSLTRGANTPWTHDRAVVAVQGLSTEASVLAFLVTEDGRVRGD
FT                   HDFVFFNNPTVPGVAIGGHRVEVDLVAVPSDVAKVVVAAVADDADPAPLSARPLSVGIQ
FT                   PGAGPGTQALVTGLTSERAVVLVELYRRAGQWKLRNVSAGWTEGFAALVRAHGVQVDED
FT                   VDDEGSGASEHLAGPAAAPPAPAPPPQAPAPAINLRKPGIEAIDLGKRTGAINLRKGEQ
FT                   VTITKTPRIVATCTWPRATDYDIFALVRYRDGRTETVSTFGTQVDKNDFRLATGDGAVR
FT                   HSGDIGRTQTASKGWRRKKADEPAVGQETIEITLNPQIAAVVPVVYSAQSNGSGSFRRY
FT                   QVAMSIDNGGGDTVTIDASNASADDAVFTCVPGIIINDPDGVRIQFLELYSAQGSENRP
FT                   VVDGELIVKMDAGPVNAFK"
FT   gene            complement(134016..134306)
FT                   /locus_tag="Namu_0120"
FT   CDS_pept        complement(134016..134306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76554"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76554.1"
FT                   /translation="MRMPIADEPAVPPPTGGRPFRRRTVRIAPGEARPYRPADWHDCLV
FT                   VVESGEVLLELDSGARHTCRAGDILWLAGLPVRRLVNPGSVPVVIRTVRRR"
FT   gene            complement(134624..136021)
FT                   /locus_tag="Namu_0121"
FT   CDS_pept        complement(134624..136021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0121"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mpo:Mpop_4643 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76555"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6M8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV76555.1"
FT                   /translation="MRKSTGLYPSLRVDATGKRVVSHGGSVLLALAADRVGLGRGLSAA
FT                   LRPWRKPMAVHDPGKILLDLAISLAIGGDCLADIAQLRAEPAVFGHVASDPTVSRLIDT
FT                   LASDATAALKAIDTARAAARARAWKLAGPAAPNHDRSAKAPLVVDVDATLVTAHSEKQL
FT                   AAATFKKGFGFHPIGAWADHGPDGTGEPLAMLLRPGNAGSNTAADHISVVKAALAQLPC
FT                   TTADRRPGRGVLVRTDGAGGTHEFVDWMARQRVQYSVGFTLTTDITAKVDALPEAAWTP
FT                   AYNADQEPRDGAWVAELTGVLKLKGWPKDMRVIVRAERPHPGAQLKFTDSNGNRLTAFA
FT                   TNTKGGQLADLELRHRRRARCEDRIRNSKDTGLNNLPLNDFAQNQVWIAVVQLATELTA
FT                   WMQMLAFTGTPARTWEPKKLRHRLFSVAARIGRKARRTWLRLSAHAPHRDLLLHGLARL
FT                   RNLPQLT"
FT   gene            136197..138017
FT                   /locus_tag="Namu_0122"
FT   CDS_pept        136197..138017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0122"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; Spore
FT                   germination protein; KEGG: mno:Mnod_0906 amino acid
FT                   permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76556"
FT                   /db_xref="GOA:C8XIW9"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW9"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACV76556.1"
FT                   /translation="MAGSPELHKGLNQRHLTMIAMGGVIGAGLFVGSGAVINDAGPGAF
FT                   LSYALCGVLIVMVMRMLGEMAVANPSTGSFADYARRALGGWAGFSVGWLYWYFWVIVVG
FT                   FEAVAGAKILQYWIDVPLWLLSLLLMILMTATNLFSVRSFGEFEFWFAGIKVAAIVVFI
FT                   VLGGLYVLGIWPNKSMDFSNLWAHGGFFPNGLGAVFSGIVVVIFSMVGAEIATIAAAES
FT                   KDPARSIAKATNSVIVRIAIFFVGSVFLLAVILPWNSNELGQSPYVSAFKVMGLPYVDH
FT                   LMNAVVLTAVLSCLNSGLYTASRMLFVLAARREAPVALITVNGRGVPMWAILTSTVVGF
FT                   LCVIAAAISPDTVFLFLLNSSGAIILFVYLLIAISQLILRRRTSEDKLQVKMWLYPALT
FT                   ILTIAAMLAVLVLMYLEESTRPQLLLSVLAWAVVLVLYAVTKWRGGSVGRDFDAAPADG
FT                   GTRVLVLANETVGAGELIDELRTIDQQGQAQYFVCVPANPVDTGQAEHTGAVWVWQETV
FT                   KAAQGRLDSTLETLRGHGLSADGELGDHRPMVALGAAVTEFKPDRIVIATHPDVHSAWL
FT                   RQDVVDRARKAYPSIPVRHIVAHVTEHPGV"
FT   gene            138075..138665
FT                   /locus_tag="Namu_0123"
FT   CDS_pept        138075..138665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76557"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76557.1"
FT                   /translation="MLKFDGAIAGMGTASGTRIVVGMWPLSPFGPVTDVMLERPDGRRV
FT                   LLAPTDEFADFLRAEYRFDEVRVSPVLRMRDGRKWMIASDDLALTFEVGGRSAWGLLLL
FT                   AVPRTLARSRWWAGTVNPIARAAKGVRTRGRTLAGRREWYCAQDMRHITSVDARFDGVD
FT                   LGELQPVDPAVGFGFSSVPASPSLVRVLSQIAD"
FT   gene            138734..140053
FT                   /locus_tag="Namu_0124"
FT   CDS_pept        138734..140053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0124"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: phosphofructokinase; KEGG: scl:sce2257
FT                   diphosphate--fructose-6-phosphate 1-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76558"
FT                   /db_xref="GOA:C8XIX1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX1"
FT                   /inference="protein motif:PRIAM:2.7.1.11"
FT                   /protein_id="ACV76558.1"
FT                   /translation="MVTLADLQVRQLGECRHESPLAKYIAARRTNDHYVDESDRVLFDD
FT                   TVHLVQDHGVPLTELPTLEPGGPRRQVFFPPGRTKVGIVTCGGLCPGLNDVIRGLVMEL
FT                   NTHYGVTDVVGFRNGYAGLVPAHGYEPIALTTERVASINMQGGTILGTSRGAQDSEVMV
FT                   DRLVELGIDILFVIGGDGSIRGASKIAAVARGRGLDLSVIGIPKTIDNDIPFIGQSFGF
FT                   QTAFTVAAQSIAAAQVEAQSAVNGVGLVQLMGRHAGFIACYAALANHHADFVLIPEVPF
FT                   ALDGESGFLAALQRRVAERGSAVVVVAEGAGQDLMADRAGTDASGNRKLGDIGRYLEAA
FT                   IVGHYRALGRELTLKYLKPSYSIRSVPAKAFDSVYCVRLAQAAAHAGMAGRTDMVVGRR
FT                   HNRFVHVPIDIVVSHRNEVAPDGDLWLSVLESTAQPPEMR"
FT   gene            complement(140061..141086)
FT                   /locus_tag="Namu_0125"
FT   CDS_pept        complement(140061..141086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0125"
FT                   /product="Glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="KEGG: oan:Oant_1604 putative glutathione S-
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76559"
FT                   /db_xref="GOA:C8XIX2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX2"
FT                   /inference="protein motif:PRIAM:2.5.1.18"
FT                   /protein_id="ACV76559.1"
FT                   /translation="MVDSTGVGQGAFERDSRYITTRITRDGQDGYPVEPGRYRLVVSRA
FT                   CPWANRATIVRRLLGLESVLSLGVCGPTHDERSWTFDLDPGGVDPVLGIKRLQQAYFAR
FT                   DPDYPRGITVPAIVDERTGAVVTNDFPQLTLDLSTQWTEFHRPGAPVLYPEPLRAEIDE
FT                   VNRRVYTEVNNGVYRCGFAGDQDAYDKAFTRLFDALDWLEDRLRERRFLVGDTITEADV
FT                   RLFTTLARFDPVYHGHFKCNLRKLAEMPVLWAYARDLFQTPGFGDTIDFVQIKRHYYQV
FT                   HTGINPTGIVPDGPDLANWFTPHGREALGGRPFGDGTAPPTPPVDEMRTADWTIERDGA
FT                   R"
FT   gene            141222..142319
FT                   /locus_tag="Namu_0126"
FT   CDS_pept        141222..142319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0126"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   mpo:Mpop_4527 glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76560"
FT                   /db_xref="GOA:C8XIX3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX3"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACV76560.1"
FT                   /translation="MARTVGVEEELMLVDPVSGTPASAGDVVHEAAVEALGAAADHLVE
FT                   REFKMEQTEIGSTPTIDVAALGTELLAVRRTVAAAAGSTGVHVVAVATNPFTVNPTLTK
FT                   NERYARMAEMFGIIAAQQLTCGQHIHVAIESPEEGVAVLDRIRGWLPLLVAMSANSPYW
FT                   QGQDTGYASYRSIAWGQWPTAGPTESFGTVEGYHRAISDLLATGAAMDDGMIYFDARLS
FT                   ASYPTLEIRVPDVCMDVRDSTLIAALARALVDTAATQWRHGHPVDPIRIEVLRGAAWRA
FT                   ARFGLQGDLLDHRTRELVPAWAMIDALVQHVLHALRANGDLDFVLAGIEDLRRRGTGAQ
FT                   VQRTEFARRGLLMDVVQLAAQRTLE"
FT   gene            complement(142339..143292)
FT                   /locus_tag="Namu_0127"
FT   CDS_pept        complement(142339..143292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0127"
FT                   /product="Ku protein"
FT                   /note="KEGG: afw:Anae109_1008 Ku family containing protein;
FT                   TIGRFAM: Ku protein; PFAM: Ku domain protein; SMART: Ku
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76561"
FT                   /db_xref="GOA:C8XIX4"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX4"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACV76561.1"
FT                   /translation="MRSIWKGSVAFGLVNVPVKLYSATEEKDIRFHQVHAQDGGRIKYK
FT                   RVCDLDGEEVPYADIAKAYESDDGRTIMLTDEDFAQLPASSSREIDVVSFVPSDQVDPV
FT                   LYDKTYYLEPASTSTKAYVLLRQTLEQTDRIAIVNFALRQKTRLAALRVRDDVLVIQTL
FT                   LWPDEVRAAEFASLEESVSIKPAELKMASMLVDSFADDFHPEDYTDEYREELQQLIEAK
FT                   LEGGEAFETPEKPDEGEDAEVVDLLAALQRSVERHKKAGASTGDDSGDGADDSPKKSPR
FT                   TSSAKTRTKATDETGDQDKDEAKPPTRRRSPARKTG"
FT   gene            143350..145845
FT                   /locus_tag="Namu_0128"
FT   CDS_pept        143350..145845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0128"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; DNA ligase D, 3'-phosphoesterase domain protein;
FT                   DNA polymerase LigD, ligase domain protein; PFAM: ATP
FT                   dependent DNA ligase; ATP dependent DNA ligase domain
FT                   protein; DNA primase small subunit; KEGG: rpi:Rpic_0501 DNA
FT                   ligase D"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76562"
FT                   /db_xref="GOA:C8XIX5"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX5"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ACV76562.1"
FT                   /translation="MAADSATVEVDGHRIALTHLRKVLYPASGTTKSEVIAYFAEVAHA
FT                   MIPHLADRPVTRKRWPDGVTTAPFFHKDLPKGTPSWVPRRTIRHSDGPKDYPLVDSPAT
FT                   LAWLGQIAALELHVPQWTFGSAAASVAGGDGEITEAVFDAVHPNRLVFDLDPGPGVELV
FT                   DCAHVARAVRERMGGAALVPVTSGSKGIHLYAWLDGSLTSDDASAYAREIAEAIEQDMP
FT                   DLVVSRMAKSLRRGKVFIDWSQNNGSKTTIAPYSLRGREHPTVAAPRTWEELADPELRH
FT                   LEYTEVLELLAAAPDPMQGLEDGDNDGAETRGGSRRRGRGPDTKLDTYRSMRSADKTPE
FT                   PVPEPGLLPQGDDDTFVIQEHHARRLHYDFRLERDGVLVSWAVPKGVPESTGRNHLAVH
FT                   TEDHPMDYADFAGEIPHGEYGGGTVSIWDRGTYATEKWREDEVIIVLHGGKARGRYALI
FT                   RTGGKNWLMHRMKDQSPQPKQYDDHRPATPTAPVTARPAPARSTRPEPPKDLRPMLATA
FT                   GSVEDVADERRWRFEGKWDGIRAIATVGPSGLTLRSRLGNDVTPTYPELAVLAELLDGH
FT                   SAVLDGEIVALQDGRTSFHEMQKRMNVQRARDVARVMRDVPVQFWIFDVLNLDGISLLD
FT                   KRYDDRRRILEALPLTGGVCLVPPQLAGPARDALRGSADRQWEGIVAKLGDSTYQPGRR
FT                   SHSWLKIKNFLDLEVVVVGWSPGTGRREGTVGALLLAVPDGAGGLRYAGKVGTGFTDAI
FT                   LDQLMQALAPLRADRSAVADTIPRADAAGAIWVRPELVGEVKYGQWTPERRLRATSWRG
FT                   LRPDKTVADLIAGSAPPPS"
FT   gene            complement(146034..146342)
FT                   /locus_tag="Namu_0129"
FT   CDS_pept        complement(146034..146342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0129"
FT                   /product="protein of unknown function DUF1272"
FT                   /note="PFAM: protein of unknown function DUF1272; KEGG:
FT                   bbt:BBta_0568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76563"
FT                   /db_xref="InterPro:IPR010696"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX6"
FT                   /inference="protein motif:PFAM:PF06906"
FT                   /protein_id="ACV76563.1"
FT                   /translation="MALELRPNCEGCDKDLPPAATDAMICSYECTWCSACVDRLRNVCP
FT                   NCGGGFVPRPIRPATEWRPGLSVAQRPASTRRVHMSFSWVQAQELSAALAGIDPAAR"
FT   gene            146442..146729
FT                   /locus_tag="Namu_0130"
FT   CDS_pept        146442..146729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0130"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   aav:Aave_2936 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76564"
FT                   /db_xref="GOA:C8XES2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C8XES2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACV76564.1"
FT                   /translation="MAKPYPKEFRDDVVAVARKGQATLTQIAKDFGISEGSLANWMKQA
FT                   DIKDGRRPGLTDVDRAELRELKKRNRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            146750..147631
FT                   /locus_tag="Namu_0131"
FT   CDS_pept        146750..147631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0131"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mrd:Mrad2831_6485 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76565"
FT                   /db_xref="GOA:C8X867"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C8X867"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACV76565.1"
FT                   /translation="MAATGAPIRVPVAVTLRVLGLSRAGYYKWLSDPVCQRDYDDAHLI
FT                   DKLYDLHGDDATLGYRFLTDELEDEHGIQVGENRVHRLCRIAGITASHHKKRSKTGSTG
FT                   PAPHDDLLAVVDEHGVVRHEFLADAPNKVWLWDISEHPTREGKLYICAIKDVWSNKIVG
FT                   YSIDSRMKSSLARAAMRNAIALRSPAGTVCHSDRGGQFRAKRTQRLLANNDLVGSMGRS
FT                   HGAGDNASMESFFSLLQKNVLNTRRWDTRDDLRLAIVTWIETKYNRRRRQRALGKLTPV
FT                   EFEMIYKAAEAA"
FT   gene            147803..148243
FT                   /locus_tag="Namu_0132"
FT   CDS_pept        147803..148243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0132"
FT                   /product="CdfA"
FT                   /note="KEGG: dat:HRM2_48610 CdfA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76566"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIX9"
FT                   /inference="similar to AA sequence:KEGG:HRM2_48610"
FT                   /protein_id="ACV76566.1"
FT                   /translation="MIDVERTFEVRQPVSVVVDYLKDFSRAEEWDPGTKSCTRTDSGPV
FT                   QVGSTWHNVSVFKGKETELEYRLAEFDTGRLRFQGENKTASSTDTITVQATDTGSAITY
FT                   HAQIEFHGLAKLATPFLKSEFEELGDKTVAQMTSVINGLPRA"
FT   gene            148263..148661
FT                   /locus_tag="Namu_0133"
FT   CDS_pept        148263..148661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76567"
FT                   /db_xref="GOA:C8XIY0"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76567.1"
FT                   /translation="MTADAFTRAPFGPLKWAALAVAAVGILVVLMWSDQGWLGPTVGYA
FT                   LVIGLVGSVPMGRVIGKHPRTAQLSGGLLIIALAVCVMVSSQSREWGQGVFIALMGILI
FT                   LVQGIFPRLRTWRLGKDPNRTRPPFTAR"
FT   gene            148707..148907
FT                   /pseudo
FT                   /locus_tag="Namu_0134"
FT   gene            complement(148908..150110)
FT                   /locus_tag="Namu_0135"
FT   CDS_pept        complement(148908..150110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0135"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: scl:sce8961
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76568"
FT                   /db_xref="GOA:C8XIY1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY1"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACV76568.1"
FT                   /translation="MRVLISGAGIAGPSLAWWLQRYGFACTVVERSPTLRTEGQNVDIR
FT                   GAAREVVRRMGLDDEVAARSTGEQGTRFIDGAGHSVAEFPVTHSDTEGATAEREILRGQ
FT                   LASLLYEQTRGAADYRFGHRIAEVRDGEREVTVSFDQGGSESFDLVVLAEGVNSRSRDS
FT                   IVNTAITERSLGLTIAYYSVERSAADDDWWRWYNALGGRTISLRPDNLGRIRVSLSFLS
FT                   DARVDSDPDLGSPKDELTERFRDAGGPAGRVLAGLADADDLYVERLRQIRADRWSNGRT
FT                   VLLGDAAWCATPVSGMGTSLAVVGAYVLAGELAAHVHHQDGLAAYERVMRPYVDQAQDL
FT                   PPGTPRLAHPRSRPGLAAFRTALRLAGSPAFAPVRRRMFAPPADRLQLPDFRHLETTRS
FT                   S"
FT   sig_peptide     complement(150060..150110)
FT                   /locus_tag="Namu_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.754 at
FT                   residue 17"
FT   gene            150395..150598
FT                   /locus_tag="Namu_0136"
FT   CDS_pept        150395..150598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76569"
FT                   /db_xref="GOA:C8XIY2"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76569.1"
FT                   /translation="MMTGLIVLAALLLVVGLLWYLWRHRTGSLARGIAAAGATYNEFNG
FT                   QGRPPEMSTSATLDGRDRPPAV"
FT   gene            complement(150635..151072)
FT                   /locus_tag="Namu_0137"
FT   CDS_pept        complement(150635..151072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0137"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rle:RL2545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76570"
FT                   /db_xref="GOA:C8XIY3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76570.1"
FT                   /translation="MAIKLENVAIAVRDLEATIAFFTDLGLTVLGRDTVSGEWTDTAVG
FT                   LDGNHAKIAMLQTPDGNGRLELFEYIHPDAIETEPTQPNEIGMHRVAFSVDDIDEALAI
FT                   AARHGCHPLRGVATYEDIYKLTYVRGPSGIIVMFAQELTRG"
FT   gene            151150..152610
FT                   /locus_tag="Namu_0138"
FT   CDS_pept        151150..152610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0138"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: kpe:KPK_0932 cobyric acid
FT                   synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76571"
FT                   /db_xref="GOA:C8XIY4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY4"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ACV76571.1"
FT                   /translation="MLARDLQARGLLIAGTSSDAGKSLVTAGICRFLARQGLRVAPFKA
FT                   QNMSNNSMVCADGSEIGRAQYLQAQAAGAVPESAMNPVLLKPGSDRRSFVVVRGRPAGT
FT                   LESGEFASGRRHLAQAAFAAYRELAGRYDVIVCEGAGSPTEINLRAGDYVNMGLAQEFS
FT                   LPVVVVGDIDRGGVFASLYGTVALLDAADQALIRGLIINKFRGDVDLLRPGLDRIAQLT
FT                   GVPVLGVLPWLTEVWLDGEDTLQVGRWGAPIGGPEPRLRVAALRFPRLSNVTDLDALAC
FT                   EPGVEVTMTADPGTIRAADLVVLPGSRATVADLTWLHASGLADAVRQAAGRGTPVLGIC
FT                   GGFQMLARTIDDPVESGAGPVSGLGLLPVDVAFAPDKRLGTPAGDWQGHQVRGYEIHHG
FT                   VATVAPGGGDESFLGGVRVGSVWGTMWHGAFENDDFRRAWLRTATEGRFHADAAAPGFG
FT                   ARREAMLDRLADAVAEHLDTDALLALTR"
FT   gene            complement(152664..153377)
FT                   /locus_tag="Namu_0139"
FT   CDS_pept        complement(152664..153377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0139"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   pag:PLES_26381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76572"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY5"
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /protein_id="ACV76572.1"
FT                   /translation="MTKRVLGAAFALALTLGLAACGSSSTGTATRSTAPSTTSETAATA
FT                   AGNGSAAVESTEHNAVDVMFATMMIPHHEGAIEMSELALAQASTQPVKDLATQIKAAQG
FT                   PEIEQMQGWLVAWDATMPMMSTGADADSGMGGHDMGSMGGPQETAASPSVDDFGMGQMM
FT                   QMSDADMDALRAATGVEFDKLFLQQMIAHHQGAIEMAEVEIARGQNPATLALAESIKSG
FT                   QTTEIAQMQQMLAAL"
FT   sig_peptide     complement(153297..153377)
FT                   /locus_tag="Namu_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.674 at
FT                   residue 27"
FT   gene            complement(153455..153877)
FT                   /locus_tag="Namu_0140"
FT   CDS_pept        complement(153455..153877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2637 protein of unknown function
FT                   DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76573"
FT                   /db_xref="GOA:C8XIY6"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76573.1"
FT                   /translation="MTTGRQSPVRWALLLAVIAGIFAMHVLTPGDGPGHGSLPTAAGTH
FT                   HGMTADPMAEPVMAPEAFVTAWVGAEPPSSEHGDMAGCILFLVVGGVLLLLAALARRNA
FT                   TVTAPGPVSARRALFDMRRRGPPRGRPRLALGVIRV"
FT   gene            complement(153901..154887)
FT                   /locus_tag="Namu_0141"
FT   CDS_pept        complement(153901..154887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0141"
FT                   /product="lyase-like protein"
FT                   /note="KEGG: reu:Reut_B3680 putative hydrolase
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76574"
FT                   /db_xref="GOA:C8XIY7"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY7"
FT                   /inference="protein motif:COG:COG4257"
FT                   /protein_id="ACV76574.1"
FT                   /translation="MDGSSNSDRAAGPQLRIGSFADPAGELASLTGIIQGPDGCMWFAS
FT                   PGTDRVGRLDPTTGVIRTFLDPAGELRGPANLFPGADGRIWFTCPGADRIGRIDPSAAD
FT                   PQATLTAVSAPGIANPVAIKSAADGRIWVSLRAASALASIDPFADDPGGSVRVITHPSL
FT                   DLPAAIFPAADGRLWFTTTGRPGIGSLDPLDPDPGRSIRMFAPPGEPALRAWAMDEAGR
FT                   LWLTTRNPGGIARFDPADPSGTWRHFTGPAFDAPDGNTLGPDGAIWLVDTGRNALLRVD
FT                   PESGTVEDHHSPSIAAPFDLKPGPGASLWFTNRGAPTLGRLEFVAGP"
FT   gene            154945..155838
FT                   /locus_tag="Namu_0142"
FT   CDS_pept        154945..155838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0142"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="KEGG: mrd:Mrad2831_1538 precorrin-6A synthase
FT                   (deacetylating); TIGRFAM: precorrin-6A synthase
FT                   (deacetylating); PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76575"
FT                   /db_xref="GOA:C8XIY8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY8"
FT                   /inference="protein motif:TFAM:TIGR02434"
FT                   /protein_id="ACV76575.1"
FT                   /translation="MRTLEIIGIGMGDPEQLTLQAVAALGRVDVVLLVDKGETTRDLVD
FT                   LRAQMMARHGRPDLRVVPIPDPRRDRQSPDYQGAVRDWHQRRVLAYEQALLDHVAPDGC
FT                   AGILVWGDPALYDSTIRIVDGIRERGIVPLAVHVRPGISAVQALAAAHGVVLHGIGEPV
FT                   VITTGRRLAEAIAGGAPTVVVMLDGDLECRTCTGRGLEILWGAYLGDPRQTLIRGPLDE
FT                   VIDEIVAVRARLRARHGWIMDTYLLRSSVPTGAVAAGTGAGAVSAGTGRGAVRAATTIT
FT                   TSAAAVIAAPAQIGEV"
FT   gene            complement(155676..156896)
FT                   /locus_tag="Namu_0143"
FT   CDS_pept        complement(155676..156896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0143"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: bpt:Bpet4515 putative
FT                   transmembrane efflux protein of the MFS type; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76576"
FT                   /db_xref="GOA:C8XIY9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV76576.1"
FT                   /translation="MPAGLIALALGGFGIGLTEFTIMGLLPEVAADFGVSEAAAGWLIT
FT                   GYALAVIVGALGLTAATTRLPRKRVLLGLLVLFVIGNAISALAPTYSVMMAGRIVAALC
FT                   HGAFFGIGAVVAADLVAPARKAGAVAIMFTGLTAANVLGVPLGTFIGQQFGWRATFWSI
FT                   TVIGLVAFVGVLALVPQDRGRHVPTRLRDEVGALRDRQVWLSMAVTVLGFGGMFGAFTY
FT                   IAYTLTEVTGFASSTVPWLLVLFGAGLLVGNVLGGRFADRALDRSLIVILAGLVLVLVG
FT                   FALAATSPWGTVVMIFLMGGFGFATVPGLQTRVMTYAAQAPSLASAGNIAAFNLGNALG
FT                   ALAGGLTIGAGLGYTSPIWAGAAITAAALVVMVVAARTAPRPVPALTAPAPVPAATAPV
FT                   GTEDRSR"
FT   gene            157017..157469
FT                   /locus_tag="Namu_0144"
FT   CDS_pept        157017..157469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0144"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ade:Adeh_4108 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76577"
FT                   /db_xref="GOA:C8XIZ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV76577.1"
FT                   /translation="MGIGDDAVQVRAQGWRTLASLHGLIESRLERALGAAADLSVVEYT
FT                   VLDALSRQDGWHMRMQQLSRAAALSPSATTRLVNRLEDRGLLTRILCADDRRGIYTELT
FT                   AAGRDLLDQARPVHDDVLRQALAEAAGVPELTPLVRALHEADVSVG"
FT   gene            complement(157689..161327)
FT                   /locus_tag="Namu_0145"
FT   CDS_pept        complement(157689..161327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0145"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: bph:Bphy_3152 cobaltochelatase, CobN subunit;
FT                   TIGRFAM: cobaltochelatase, CobN subunit; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76578"
FT                   /db_xref="GOA:C8XIZ1"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ1"
FT                   /inference="protein motif:TFAM:TIGR02257"
FT                   /protein_id="ACV76578.1"
FT                   /translation="MPRLALLSTSDTDLLSARASGADWALANPARLDVAADLPALLDDV
FT                   DLVIVRILGTARSWQDGLDALTARGLPTVVLGGEQVPDAELMRLSTVPIGIAAQAHQYL
FT                   TEGGAANLRQLHAFASDTVLLTGEGFDPPVTIPGWGYLDRADVADQSRKSRVGILIYRA
FT                   HHTSGNTAFVHALADAVDATGDAVGVPMFCSSLRTAPPDLLAALGTLDALVVTVLAAGG
FT                   TTPATASAGGDDDGWDVSALAALDIPILQGLCLTWSREAWAGSDDGLSPLDVATQVAVP
FT                   EFDGRIITVPFSFKETDPSDDAGLPRYVADPERCARVAAIAAAHARLRHTPAADRRVGL
FT                   VLSAYPTKHSRIGNAVGLDTPVSAIRLLRAMRDAGYQVGDLPGLGILDPVEGEEPDTTA
FT                   GNTLIHALIAAGGQDEEWLTSEQLSGNPVRISAARYREWFAAFPDELQEAVVQAWGPPP
FT                   GELFLDRSADPEGEIVLATLQAGNVVILVQPPRGFGENPIAIYHDPDLPPSHHYLACYR
FT                   WLEHEFGAHALVHLGKHGNLEWLPGKNVGMAATCGTDAALGSVPLIYPFLVNDPGEGTQ
FT                   AKRRAHAVIVDHLIPPMARAESYGDIARLEQLLDEHSTIAAMDPAKLPAIRAQIWTLIQ
FT                   AAKMDHDLGLADRPQDAEFDDFIMHVDGWLCEIKDAQIRDGLHVLGQAPAGSQRVDLVL
FT                   AMLRAAQVWGGRSNALPGLRSALGLKDDADLGTVDAIEAQARALVQAADAAGWAVEAIP
FT                   MVVESQLGQADPAIGRILEFAATEIVPRLAATTDELTSVLHALDGGFIPAGPSGSPLRG
FT                   LINVLPTGRNFYSVDPKAVPSRLAYDTGVAMADSLVARYRADTGEFPRSVGLSVWGTSA
FT                   MRTAGDDIAEVLALIGVAPVWDEASRRIADLQVIPAAELGRPRIDVTVRISGFFRDAFP
FT                   HVVTMLDDAMRLVAALDEPDEINYVRAHTRADLAEHGDERRATTRIFGSAPGAYGAGLL
FT                   PLMESGNWRDDADLAQVYTAWGGFAYGRGLDGAAATEDMQINYRRIAVAAKNTDTREHD
FT                   IADSDDYFQYHGGMVATVRALTGQAPRAYIGDSTNPDAVRTRSLTEETARVFRARVVNP
FT                   RWIAAMRRHGYKGAFEMAATVDYLFGYDATAGVVADWMYESLAQTYVLDEQNQAFLKHA
FT                   NPWALRGIVERLTEASDRGLWAEPDPDLLAELAQVYLDVEGDLEDS"
FT   gene            161568..162581
FT                   /locus_tag="Namu_0146"
FT   CDS_pept        161568..162581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0146"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: scl:sce4174 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76579"
FT                   /db_xref="GOA:C8XIZ2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76579.1"
FT                   /translation="MTTTEEARAAVLGATRPEDVFGPAGIDDATRRAARRTFRRIAFLV
FT                   HPDRAGEATAFARLEQLYRDWQAVAAPAATAGPVVITGRVDSYVVDELIAQGSVASVYR
FT                   GGGVVLKIARRSASNPLLDGERRAYRALGEMLRDQEWLRPYYPRLVDVAALGDPSGPPR
FT                   QVNVFAELTGFVTLAQVRRAFPEGLDGRDWAWMYRRLLRAVAGAHLAGVVHGAIVADNV
FT                   LIQPDEHGVVLAGWSFATPVGRPLPALTKSGQYPPEALAGRPVDGKADIHQLHTLMLDL
FT                   LAPTEDAQRAYARLCRQDNPRMRPTAAALLEEYDELIGRLYGPRHFRPFTVPTTAV"
FT   gene            162610..163584
FT                   /locus_tag="Namu_0147"
FT   CDS_pept        162610..163584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avi:Avi_7551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76580"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ3"
FT                   /inference="similar to AA sequence:KEGG:Avi_7551"
FT                   /protein_id="ACV76580.1"
FT                   /translation="MGHGAWDDNAYRAAATFRRATGKADFAYSAQMRHRPARQWKAAPE
FT                   LDPHGVTVREARDGADHPNSTPIVVLFDVTGSMGVVPQIMQRRLAELLGLLQRKGYVQD
FT                   PQIMFGGIGDADCDRVPLQVGQFESDNRMDEQLRTMFLEGGGGGQKSESYELATYFIAR
FT                   HTATDAWDKRGRKGYLFLIGDEMNKRGLRAEYIRRVIGDQVGEDLSTEAIYREAQQRWE
FT                   TFFVLPRQTAYYDDRQVNEHWRNLLGERLLRLEEPEAVCELIALTVGLLEDSIDLGEGL
FT                   ADLADVGSPHGATVGQALATLGARTVDTPAALPGGLDVADDLR"
FT   gene            163581..164903
FT                   /locus_tag="Namu_0148"
FT   CDS_pept        163581..164903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0148"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: rlt:Rleg2_3717 adenylosuccinate synthase;
FT                   PFAM: adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76581"
FT                   /db_xref="GOA:C8XIZ4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ4"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ACV76581.1"
FT                   /translation="MIPDDQSVIVVGLGFGDEAKGATVDFLCSAGNVAGVVRFNGGAQA
FT                   AHNVVVDGRHHTFRQFGSGTLAGVPTLLSRFALVEPIGLAGEAEELAALGVPDPLSLIT
FT                   VDPDALITTPVHVAANRTREDARGAGRHGSTGLGIGETVWYDLATTRRAQAGERVENLV
FT                   APATATGRALRVRDCLEPVTLRRRLDELVRFYEPLLAAGAHGHDGVEAMADLLTAFVGA
FT                   VRIAPAGHLNELASRGRLVFEGAQGVLLDEWRGFHPHTTWSTTTPANAQALLAEAGLPR
FT                   GYVLGLTRAYTTRHGAGPLPTEDPALLAVAEPFNGSGIYQGGWRAGHLDLVALRYAVEA
FT                   IGGVDGLAVSHLDVVDDPGTPAVRAVGAYETPRGLTDRLPVGAFGDLAHQQELTDLMHR
FT                   ASGTGRELRDSRDAVVTLERALGAPAQVLAFGPGRADRKVA"
FT   gene            complement(165052..165669)
FT                   /locus_tag="Namu_0149"
FT   CDS_pept        complement(165052..165669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0149"
FT                   /product="NUDIX hydrolase"
FT                   /note="KEGG: aeh:Mlg_0745 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76582"
FT                   /db_xref="GOA:C8XIZ5"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ5"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0745"
FT                   /protein_id="ACV76582.1"
FT                   /translation="MEPTSHVSVDVLVLRYDRALRQLRLGLHERTLEPFAGWPALPGVL
FT                   LLRGERIRDAAARALAKVQLTARGSGQLITFDEPSRDPRGPTLSVATWAVTDDIGTARW
FT                   SGWDERPPLAFDHDRIVTDCRPLLAGMLWRDPSFTRLLTGAEFPVTDALALHQALTGAA
FT                   PDRGNLNRTLATIPGLHRTDRQASTGRGRPSTIWAWSPSPTP"
FT   gene            165830..166744
FT                   /locus_tag="Namu_0150"
FT   CDS_pept        165830..166744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76583"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76583.1"
FT                   /translation="MSPRSGPSRGRRTRRCAVLLVAATTVALGLTAGPTAPPAAAGLPD
FT                   LQQVVDDEVMQASEQGIEQSVAVVDRATGAMVASAGGRDQYISESIVKLFTVAYYEVQN
FT                   AGHPDPALSARLRTMIVESDDAIQSALWSTAIVPAMAARYGLSDTENGPRTDSQDWGWE
FT                   LITADDEATFLYRMANDPLVAPLLMDAMAHVQPVGADGFDQDFGLNALPGDHGSKQGWT
FT                   DIGAGPPLQIHSVGWTDRYFVAILQTSDTADDDALRDQSTATATAILAAESGLSPGFLR
FT                   LRAGVVDVAWSLVDAVTGTATGR"
FT   sig_peptide     165830..165955
FT                   /locus_tag="Namu_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.796 at
FT                   residue 42"
FT   gene            166793..168019
FT                   /locus_tag="Namu_0151"
FT   CDS_pept        166793..168019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0151"
FT                   /product="nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein beta-
FT                   component ferrodoxin domain protein; KEGG: msl:Msil_3267
FT                   precorrin-3B synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76584"
FT                   /db_xref="GOA:C8XIZ7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ7"
FT                   /inference="protein motif:PFAM:PF03460"
FT                   /protein_id="ACV76584.1"
FT                   /translation="MTSRADPDRCPGVLRPHAAQDGALLRIRIPGGRIGAAALRALSQA
FT                   STEYADGDVGLTSRANLQLRAVATTADDTVAPGLVDALATAGLLPHPTHDRVRSIACSP
FT                   LTGLIGGHADLRPLIDELDAALCAAPELAALPGPFRFGLDDGRGDIGVDADLSAQALDA
FT                   THARIWVGGLSGPRVPLPEVVPTLIELAHRFVRQCATGRPAWHVRELPRGGAELLAGPE
FT                   VTPAARLGPGAPAPLGALAQADGRATVSVLAPLGRLTPAQAGALADAANGGELVVTPWR
FT                   GVLVPDLDPAAAALVIDTLIAVGLVADGGSPWRGVTACAGAPRCARGTGDTEALARQVV
FT                   AASTRSVSAGPVHVAGCARSCGRPSVAHTLAVIDRRRVHIQGPADPADDQPLDHAAAAV
FT                   AATRAGASR"
FT   gene            168016..168663
FT                   /locus_tag="Namu_0152"
FT   CDS_pept        168016..168663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0152"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   pmy:Pmen_4572 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76585"
FT                   /db_xref="GOA:C8XIZ8"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ8"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ACV76585.1"
FT                   /translation="MTTRPLRRYAYCADGPEIYRESFAIVRAETDLSGIPADARHLAVR
FT                   MVHASGQPDLVQDMRFHPDLVSAGRATLLAGAPLFVDSMMVSAGITRSRLPAGNEVICH
FT                   LRDHRVEQLAAAWGTTRSAAAVSLWGDELEGAVVAIGNAPTALFHLLEWICEGGPRPAA
FT                   IIGVPVGFVGSAESKQALIEHEAGIPYLVVTGRRGGAAIAASAVNALAGGPS"
FT   gene            168660..170201
FT                   /locus_tag="Namu_0153"
FT   CDS_pept        168660..170201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0153"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase;
FT                   precorrin-2 C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   sme:SMc03191 precorrin-2 C(20)- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76586"
FT                   /db_xref="GOA:C8XIZ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIZ9"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ACV76586.1"
FT                   /translation="MTAPGRLYGVGLGPGDPELMTVKATRLIGSADVIAYHSGTHGRSI
FT                   ARSIAVDLLPPGVIEEPLVYPVTTGPSSHPLGYRGAVDDFYDESAQRLGEHLAAGRTVV
FT                   VLCEGDPMFYGSFMYLHDRLSPRFPTQVVPGVTSVAAATAAAAMPLVRQQDVLTILPGT
FT                   LPVPELARRLADTQGAAIMKLGRTFPAVREALRQAGRLDEALYVERASTRGQALIPVKD
FT                   VDPATVPYFSIIIVPGDGRDRVAPVRPVTDAAAELLVVGLGPGPQGWVTPEVTAALAGV
FT                   DHVVGYAPYVNRVAQREGLQRHASGNTVELDRARLALTLAAAGERVAVVSGGDAGVFGM
FT                   AAAVFEAAEDPQYRAVPIRVLPGVTAAQAVAARAGAPLGADYAVVSLSDRLKPWSVIED
FT                   RLRHIARADLALAIYNPASRGRTRQLADALAVLRQEREPDTVVVVGRDVGRDAESLRCT
FT                   TLAELDPATVDMKCLLLIGAGGTRRTPAGQVWTPRWVPAETDAPVTRLDASGHGG"
FT   gene            170191..170553
FT                   /locus_tag="Namu_0154"
FT   CDS_pept        170191..170553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0154"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   ppf:Pput_3698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76587"
FT                   /db_xref="GOA:C8XJ00"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ00"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ACV76587.1"
FT                   /translation="MAGKRFPNWVYGRGADPDPRFSLANERTFLAWIRTSLALIAGGIA
FT                   VHAFHLQVPDELGTVAAIALVGLGIAAAVSGWLGWMRTERSLREGTPMHGAGLATGMTV
FT                   VFLLVVILLAVGIFVL"
FT   gene            170579..170914
FT                   /locus_tag="Namu_0155"
FT   CDS_pept        170579..170914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0155"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   esa:ESA_03954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76588"
FT                   /db_xref="GOA:C8XJ01"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ01"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ACV76588.1"
FT                   /translation="MSTPELFDRGLQPERTLLAWRRTCLALAAAMAVVIKLLAFESDTA
FT                   TVLLAVVGLAVPAVAWLLAAGRYRRSHRRLTRADRDPELPAGGSATAVAALAAVLFGGL
FT                   ALMLVLR"
FT   gene            171108..171971
FT                   /locus_tag="Namu_0156"
FT   CDS_pept        171108..171971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76589"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76589.1"
FT                   /translation="MTARRVHRQHGDSTEDVGPSPGSVARPGTRADSLPALQRLAGNAA
FT                   VRSLLTGAGRPGVRTSVPGLPPVQRTPAGGPNPLPAAPTLTEGQYAAWLRRHPRYEPRV
FT                   GGTWEPDFLVKRYTPAWFAAQGYVFGLRLGPFGNVDIDVWIDDRGAGREYRVIRWTDGA
FT                   GSAGSGPDPGGADKDHPKPGDQESKLSDREKGTDLPVSIDPNADYDKLFGRPVGRTENI
FT                   DAAFGEGTMVLHEDGSLVLHLKEGGQYVFRPVPGGRYVVYDPKGRRLSQVYTLPASDVP
FT                   DVDDDL"
FT   gene            complement(171983..172744)
FT                   /locus_tag="Namu_0157"
FT   CDS_pept        complement(171983..172744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0157"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mpo:Mpop_0969 precorrin-4 C11-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76590"
FT                   /db_xref="GOA:C8XJ03"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ03"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ACV76590.1"
FT                   /translation="MTVHFIGAGPGAADLLTVRATRLLAAAPVCLYAGTYVTADVLAHC
FT                   PDGAELIDTAGLTLEEIIDALVAAHRAGHDVARLCSGDPSVYSALHEQTRRLDAAGVPW
FT                   DVTPGVPAYAAAAALLGRELTVPGVTQSVVLTRTQARSTPMPATEELERFAATGSTLVL
FT                   HLAITRTRELVRRLIPFYGADCPAAVVSRATQADELVLRDTLAGIADLVEAAGLRQAAV
FT                   IMVGPALAGPAAGPDPIESHLYSAERCRDRT"
FT   gene            complement(172741..173997)
FT                   /locus_tag="Namu_0158"
FT   CDS_pept        complement(172741..173997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0158"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: bxe:Bxe_B1246 precorrin-6Y C5,15-
FT                   methyltransferase (decarboxylating); TIGRFAM: precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating), CbiT subunit;
FT                   precorrin-6y C5,15- methyltransferase (decarboxylating),
FT                   CbiE subunit; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76591"
FT                   /db_xref="GOA:C8XJ04"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ04"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ACV76591.1"
FT                   /translation="MDVAVDVGLDVKDVGVDVVGLGADGWDGLSPHSRAVLTRAAVVIG
FT                   GARQLALLPEQPGQRRLHLPTPLRAGLLDLLDSSDSPAGPVAVLASGDPLLSGIGGTLV
FT                   ELLGAARVRIHPAVSSVSLAAAEMRWPLAGVDVVSLVGRDLATLRRVLSPGRRVLALSA
FT                   DERTPAAVAALLTEAGFGPSRLTVLGDLGSPQQSRIDLIASDFRGPVSRLNILAIDCVA
FT                   VPGTPPRPLVGGLPDDAFDHDGQLTKRDARASALARLAPAPGQLLWDVGAGAGSVAIEW
FT                   SRVDPRCRAVAIERDPARAARIGGNAAALGVPGLVVVTGAAPAALADLPAPDAVFVGGG
FT                   ATVPGLLDSCWAVLGSGGRLVVHGVTLETERLLVDWHARVGGELIRLSVERVEPLGSFR
FT                   GWAPARPIVQWAVTKESTG"
FT   gene            174301..176418
FT                   /locus_tag="Namu_0159"
FT   CDS_pept        174301..176418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0159"
FT                   /product="Magnesium chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: rso:RS03742 chelatase protein; PFAM: von
FT                   Willebrand factor type A; ATPase associated with various
FT                   cellular activities AAA_5; SMART: von Willebrand factor
FT                   type A; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76592"
FT                   /db_xref="GOA:C8XJ05"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ05"
FT                   /inference="protein motif:PRIAM:6.6.1.1"
FT                   /protein_id="ACV76592.1"
FT                   /translation="MDTRTSREAAAAAMRTFPFTAVVGSDDMALALILTTVSPEVGGVL
FT                   VRGEKGTAKSTMVRALAGLLPAVDVIEGCRFSCDPADPDPACPDGPHPAGAPATTRPAK
FT                   LVELPVGATEDRVIGSLHLEKALTAGVTEYEPGLLAAAHRGLLYVDEVNLLHDHLVDLL
FT                   LDAAAMGRGTVEREGVSIAHAARFVLVGTMNPEEGELRPQLLDRFGLTVEIAAPRDPAV
FT                   RAEVVRRRLAYDADPDTVAARYADAEADLARRIRSARTGLPTVVLGDGALTKIAQVCAS
FT                   FEVDGMRADLVTARAAVAHAAWHGRRYVTREDIRAAARLALPHRRRRNPFDAPGLDEEL
FT                   LDRILGDDEPDPPPPGPEVDPSPQAPADAGSEPADGPRTEAGSDADSGSDFDSGSDLER
FT                   VEEPATAQAADPATEPDRASNPTPATGPAPAGTVSGTGQPFRPKLFTVAGVGAGEPGRR
FT                   SRAITSNGRTVGATPFVGRGGAVHLTATVRAAAPHQRRRGRTGPGLLVGRDDLRLAVKQ
FT                   GREANLVLFCVDASGSMAARARMEAVKAAVLSLLTDAYQRRDKVGLVTFRGGAADLALP
FT                   PTSSVEAAARRLEMLPAGGRTPLAEGLLCAAHTLRVERIRDPRRRPLLVVVTDGRATSG
FT                   PDAVARSRRAATALAAEGIAALVLDCETGRFRMGLAARLAEHLQADYVPITDVAASVLT
FT                   TSVARHRARVA"
FT   gene            176418..177035
FT                   /locus_tag="Namu_0160"
FT   CDS_pept        176418..177035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0160"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: met:M446_2429 cob(I)alamin
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76593"
FT                   /db_xref="GOA:C8XJ06"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ06"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ACV76593.1"
FT                   /translation="MPQAQPLVVPADGLTTRQRRNRALLMVHTGDGKGKSTAAFGMALR
FT                   AWNQGWSVGVFQFVKSAKWRIGEQSALEALDGVHAQTGAGGPIEWHKMGSGWSWLRRDA
FT                   DTADDYAAEAAEGWAEIKRRLAAGAHRLYVLDEFTYPMKWGWVDVDDVVATLAGRAEGQ
FT                   HVVITGRAASPRLIEAADLVTEMTKVKHPMDAGQKGQRGIEW"
FT   gene            177040..179586
FT                   /locus_tag="Namu_0161"
FT   CDS_pept        177040..179586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0161"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; aminotransferase class
FT                   I and II; KEGG: dal:Dalk_0444 cobyrinic acid a,c-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76594"
FT                   /db_xref="GOA:C8XJ07"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ07"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ACV76594.1"
FT                   /translation="MTSLPRVVIAAPASGHGKTTVAAGLMAALVRAGHVVSGHKIGPDY
FT                   IDPGYHALATGRPGRNLDPHLVGEDRLVPLLLHGAAVPRPADIAVVEGVMGLFDGAIGR
FT                   DGFASTAHVATVIDAPVVLVVDVSASARTIGAVVHGLRGFDPAVRVAGVILNKAGSARH
FT                   AQEARDAVERIGVPVLGVLFRDDGISAPSRHLGLVPVAERDDAAVVLDRLAGQIAARID
FT                   LAAVVRIARSAPDLAAAAWAPPPRVPIDGPAPVIAVAGGRAFTFRYAETEELLAAAGCR
FT                   PVVFDPLAGEALPDGTAGLYLGGGFPEVHAAELAGNAALRASITAVIGRGLPTVAECAG
FT                   LLYLCRSVDGAPMLGVIDAAATMTARLTLGYRAAVAPSGSVLAGAGQAVTGHEFHRTTV
FT                   DPGSGATPGWLIDGAGHGFALDPAGTGTPTVHASYLHTHWAGQPELAARFAAAAHAWTG
FT                   SESPTARIRPCPPHTLHPNPPPVTPEPNLLHHGDLEVGPGLLDFAVNVRSAAPPGWLAE
FT                   TIAATIADLGHYPRAQAATEALAWRHGRPAEQVLPTAGGAEAFTLIARALRPRRPVVVH
FT                   PQFTEPEAALRAAGHVVDRVVLRAADGFTLPDGAVPADADLVMIGNPTNPTGVLHPAAR
FT                   LRALLRPGRVVVVDEAFMDAVPGEPETLAADQVPGLLVLRSLTKTWGIAGLRAGYVVGD
FT                   AELIARLAEHQPPWSVSSPALAAITACCADDAVAEAALLASAVDGPRAVLIDGLRRLGL
FT                   SVPGHPATPFVLADTAPVIPSGAPPGWIRDALRERGIAVRRGDTFPGLGPTWIRVAVRD
FT                   AHLIGRLLDTLSDVLTASPHPPNGVDHGKNAVLPGR"
FT   gene            179647..180804
FT                   /locus_tag="Namu_0162"
FT   CDS_pept        179647..180804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0162"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: xac:XAC3340 siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76595"
FT                   /db_xref="GOA:C8XJ08"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ08"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ACV76595.1"
FT                   /translation="MGGVTGASGFGALLPVAGRAVLITGGEEGALGRIAALREAGADLH
FT                   VVAPTVAASVLDLAERGLLRWDARPVEPADVAAAWLVVLAGAPEVDAAVRGWAEQHRTF
FT                   CLDDPADPAEPTAPARGSAGVGQVILVGGGPGDPGLITVAGLAAVRAADVVVTDRLAPL
FT                   AVLDQVRPGTEIVDVGKIPRGRFTPQEQINAILVEHARAGRTVVRLKGGDNFVFGRGGE
FT                   EWQACAEAGIPVRVIPGVSSAVAVPALAGIPLTHRTANQGFTVITAHVPPGDPRSTLDY
FT                   AALARSGTALVIMMGVATLGAVAAELIGHGLDPATPAATVADGGLPEQRVVRGTLASIA
FT                   DDIAVAGLKAPAITVVGSVAAFDPSAGGAPVEAPGGPAPGGAGPR"
FT   gene            180969..181190
FT                   /locus_tag="Namu_0163"
FT   CDS_pept        180969..181190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76596"
FT                   /db_xref="GOA:C8XJ09"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ09"
FT                   /inference="similar to AA sequence:KEGG:RPC_2504"
FT                   /protein_id="ACV76596.1"
FT                   /translation="MSQAAAASIPVPTLAIPVIPVRQILPWAMFVGLLALIALYFVSSE
FT                   QGAFAVFAGTGIHEWVHDGRHLLGFPCH"
FT   gene            181204..181995
FT                   /locus_tag="Namu_0164"
FT   CDS_pept        181204..181995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_1536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76597"
FT                   /db_xref="GOA:C8XJ10"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ10"
FT                   /inference="similar to AA sequence:KEGG:AZC_1536"
FT                   /protein_id="ACV76597.1"
FT                   /translation="MLTARTFLVRGLLAGLIAGIVTFGVAYVIGEPPVDAAIAIEEAGS
FT                   PAADSHDMAGMTQGEGHSHGDEAEVSRSTQSTWGLATATILFGVALGGIAGLAAAFACG
FT                   RLGRLGPRASCVVVAATGFVAIYLVPFLKYPPNPPAVGNPDTIGPRTAWYFGMLAVSVV
FT                   VAVAAIVLARRLAPRLGSWHAGLAAGGGALAIVLATAWLLPTVDEVPAGFPADLLWQFR
FT                   MSSLAVQFTLWAVLGIALASMIGVVTDRTAQAARPLTGAAA"
FT   sig_peptide     181204..181296
FT                   /locus_tag="Namu_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.488 at
FT                   residue 31"
FT   gene            181992..183029
FT                   /locus_tag="Namu_0165"
FT   CDS_pept        181992..183029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0165"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazolephosp
FT                   horibosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="KEGG: lhk:LHK_03224 CobT;
FT                   TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazolep
FT                   hosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76598"
FT                   /db_xref="GOA:C8XJ11"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ11"
FT                   /inference="protein motif:TFAM:TIGR03160"
FT                   /protein_id="ACV76598.1"
FT                   /translation="MSPVVPPSAEVAAQARHWVDSLAKPVGALGRLEDVGIWLAACQGC
FT                   CPPEPLRDIRVVVFAGDHGVAAHGVSAYPSAVTAAMVRLFHTGRAGVAVLARQHGVRLR
FT                   VLDIAVDDDLVGLPADVGAHKIRRSSEPIHLSDALTVAQVRAAVGAGRAVAEQECGSGA
FT                   QLLISGDMGIGNTTPSAALIAAMLGLPAEDVTGRGTGIDGAALAHKRDLIAQALSRMGD
FT                   RRAAPLDPVDLLAGLGSADIAASAGFMARSADLGVPVLLDGVVSVAAAMVADLLAPGAA
FT                   RWFAAGHRSTEPAQSAALAKLGLEPLLDLGMRLGEGSGAVAAVPLVRSAVLILREMAQL
FT                   ADVVG"
FT   gene            183026..183793
FT                   /locus_tag="Namu_0166"
FT   CDS_pept        183026..183793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0166"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="PFAM: cobalamin-5-phosphate synthase CobS; KEGG:
FT                   mpo:Mpop_0846 cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76599"
FT                   /db_xref="GOA:C8XJ12"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ12"
FT                   /inference="protein motif:PFAM:PF02654"
FT                   /protein_id="ACV76599.1"
FT                   /translation="MNPTADGLRLAVGTLTAVRVRPPGRVDRPTARVAMVLAPVAVLPL
FT                   GGLAAAVGGLGALAGLGPLVVAALTIGAVALGSRGLHLDGLADTADGLGSGYDRTRALE
FT                   IMRRGNVGPMGVTTLVVVLVAQIAATAAMLARPGGFVLVGVLVCLSRSALLLACARGVP
FT                   PARPDGLGAMVAGVVPRAGTVAGLLVTAGIAAAVVPIAGSAWWWGPLAVLVAGLAVAGL
FT                   LTRCVRRFGGITGDVMGATIEIALLALLVVLSR"
FT   gene            complement(183783..185042)
FT                   /locus_tag="Namu_0167"
FT   CDS_pept        complement(183783..185042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76600"
FT                   /db_xref="InterPro:IPR013495"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ13"
FT                   /inference="similar to AA sequence:KEGG:sce2124"
FT                   /protein_id="ACV76600.1"
FT                   /translation="MSAPSPEPVVALREPPWPRILRLARARLERTGGALTGSLTVKDPT
FT                   EAERKLVIGLTGSHRPPGVRSVRLPLAALDAALHRAFALSLTDAVIAVDGPLRDRPAER
FT                   DQDAAARQTAVRQARERAGRLLDQPWFEPWLDDLIADGTVTRLVHRGDAGHLAQAVDVL
FT                   ALLPATGVALPVLAERATGHTKALSGSPVAGLVLRALARAHGVDAPTTAAQRRARWQAA
FT                   GVIVDDLASQVLVLGVRPLEHHAVASWLHGAAELGIPFRLTLHQLTAAPVTLTAPRVFV
FT                   CENPAVLRAAVGEWSPAHPPLICSEGVPSAACHRLVAGATGVVHWRGDFDWTGLRTTAE
FT                   AITRYRARPWRMSSDDYQRGLAATGLPTEPLRGAPAASPWDPALESLMATTGRAVMEER
FT                   MVDILLADLAECGREKPLSG"
FT   gene            complement(185051..189280)
FT                   /locus_tag="Namu_0168"
FT   CDS_pept        complement(185051..189280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76601"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ14"
FT                   /inference="similar to AA sequence:KEGG:sce2125"
FT                   /protein_id="ACV76601.1"
FT                   /translation="MTDSGATEPRTDRFRPTRCGVVNLWDYRDDEFVFADGRLVLRGPN
FT                   GSGKTKALEVLFPFVLDGRIEPRRLNPFAGDERTMKANLLYRGQEAAYGYVWMEFRRAG
FT                   NPAGEVVTIGAGLRAQRHHERVSRWYFVVDGQVGVDFSLIGEDDRPLTKRQLEAEVDHL
FT                   PATMAERPLAHRTAVDARLFGLGIGRYEQMLTLLLTLRRPQLAKNLDPKGLSRALADGL
FT                   RPLDEHLVDEAAHSFSDMENVQRTLSGLVQADAAAAAFLVGYTTYLRTHARAEADRLTV
FT                   RLEAIDAARVSLTAALAARDRAAAARDAAQQHLSATRDRLQEATSRLDSLKASSAYRDR
FT                   EQLNRLADATADLGRAANRDAQARDQAEADSAQRERTRAGTAAAYEDALSAVSRRAAEL
FT                   SEAARDAGIDWDTNDQVDDEHLDQRVAARITAREDDVAAVRVAMAGVAEAARERDLAQR
FT                   RLDRAQERLEAVESALMAAQAAVVAERDRVQLVLADWISSRGPLLDSLAGAPRLADTVH
FT                   AALVDSVDRAGESGSTPLSAVLDAQIADARQTRRDEVRRLGDTLNLLGDQLAAIRADRT
FT                   RVAEEQDQAPPAFAARTGRRDGRVGAPLWALIDFAPGIDDDTAAAVEAALEAANLLDAW
FT                   IGPDGSADPGESDAVLLPLPAEQRPRVSPLGTLLVAETDGALGISTIEAVLASIAVGEP
FT                   SGSGPGAAPTIDRLGRFRQGLQLGAHRKAHAEYIGATARSRRRAQRLAALDRQIADVLA
FT                   QVDATGAAIGALQAMLDAVDQARSALPTTGPLTTAIRRVERESAAARAVHGEVDNARSD
FT                   LDQAIAAHHHRHHALLGLAAARSMPAEPDLVDGIAAAVALFGRAGAELGGARTTATERR
FT                   RARDTAVEELIRARDRLAEAAEQAELSRTGHRAREEELRTLRAAVGVAVDELDGQIDRA
FT                   TAEHRDARTAERVAEQAHGDARDAAGERRGAAQGAVDSLANAVVEAQRDCLRLRPYCRP
FT                   DVADVLRLSTTPAWPTAREQWPDPTALVATATDALPADADHIIDALPAAVTTLLREVLA
FT                   ATGDLRPNESSLKSSRTRVAASLTLLQDQLASAGHDFRPDWEPVEDVIVVKVSDEQGYT
FT                   SIGDFARRIAAARREQEALLSESEQRILEDALLGRLAQQIHERTTEARDLVAEMNREMR
FT                   GRRMSSGATVGISWAQADNLDPAQREVARLLEREASALSVDELAIMRAHFAGRIKDLRA
FT                   QREDRPYPDILAEALDYRGWRTFVLTLVGPDGQEDRLTQARHSTLSGGEQSVSLHLPLF
FT                   AAAHVMLSSAEPHCPRLLALDEAFAGIDDAGRSELLGLTTQFDLDLFMTGYDLWATYPT
FT                   VPGCAHHDLAHSALEHAVSSLLLVWDGSEILSDAGITEAGDDLAAALGSPGSRRRPSDG
FT                   SGLLGPD"
FT   gene            complement(189310..190710)
FT                   /locus_tag="Namu_0169"
FT   CDS_pept        complement(189310..190710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76602"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76602.1"
FT                   /translation="MNSPLDQPSGAAVTLLERAAYQRAARVLLTWPLITASYPNAEALP
FT                   LVRRWAVPLRTELADLFGYRLELTSTTARLSRVRDAFDASQPALAGAQLDRPFDRRRYA
FT                   YLCLALAVLGRAGTQIALSELAERVAAEAERIDGLELSLDRHPDRSGFVDAAGWLEARG
FT                   AIRLADGSARRWVDDPSVGEALYDIDRDVLRALYRPSPVLQHIGTARALLHRPQGVSRD
FT                   TRRRESAQRVRRALVEQPVVYYADLDAADRGMLRAPGPTAEVAEMTGLSIERRSEGVAL
FT                   LDVSGMFSDRRFPGSGTRAQMALLLANRIADRVVDPDQAPLTELTADTARSERWVNSLD
FT                   AALPRANLVAQLAEDGDDREPDGVESDDNDDENDHAAPTAYPFLEDGWLRAAVGDLIGT
FT                   YGTALSAAFVADPDRLLQTALELLAELEMVIRVPGGVLARPLLARYRNAVVTVRPTDRP
FT                   AGLFDLED"
FT   gene            complement(190707..192260)
FT                   /locus_tag="Namu_0170"
FT   CDS_pept        complement(190707..192260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76603"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ16"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3863"
FT                   /protein_id="ACV76603.1"
FT                   /translation="MSEPDAIPATFNPGFTDSERLRLFAFTTAEKSISYLWVLRAMERS
FT                   RANYVVLQHAAEVSASLASLAQDHPSGAVPALAPDEVNPLLDQLYGWQVLDRSYDGARA
FT                   ATLAEYRNRHYVYQFNQAGYRAYRAVEDVLGARLDDATLSRLVLPELLTDLLDLAAANR
FT                   AGDADLVYRKLNRLDSVLGEMAERAARFYLMLSDLSKSTDSSAELFLTHKDALIAHLRE
FT                   FSTELARFAPRLTAAVQAVRDSGVDRLVELAAEADERIFRSPADRLQDWRQRWDGLVHW
FT                   FVAVPGETHRSEADRLQDATISAVAAVLALLRRVTEARLGGVNRESQLRHLAAWFAATT
FT                   DLPSAHALFVAAFDLSRPRHVSVVHPDPELIPTRRTWWEADPVELSRTLVESGKQGSPG
FT                   PPARLDRNEAGRRRLRATQLADRSARTGAAGSLTSSPLAGRILSEPETALLFSLLDVAL
FT                   GARVPVSGRVPATGSTLGVRLTLVPQEQSTAVETVRGVLRLDRMALTVSASGPDRVGSR
FT                   "
FT   gene            complement(192290..192832)
FT                   /locus_tag="Namu_0171"
FT   CDS_pept        complement(192290..192832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0171"
FT                   /product="Adenosylcobinamide-phosphateguanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   kpe:KPK_0933 cobinamide kinase/cobinamide phosphate
FT                   guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76604"
FT                   /db_xref="GOA:C8XJ17"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ17"
FT                   /inference="protein motif:PRIAM:2.7.7.62"
FT                   /protein_id="ACV76604.1"
FT                   /translation="MTSTRRTLVTGGVRSGKSRVAENLLADRPAVSYLAPGPVPDRSVD
FT                   PEWADRIDAHRAQRPSHWRTVETTDLARALGQERAAVLIDCLGTWVTAVVDQLGTWDRR
FT                   LAEWQPDFDRQLDDLERAWRSHPGPLVAVTNEVGWGVVPEHRSGRTFRDLLGRVNQRIA
FT                   AASDDVLLVVAGRTLRL"
FT   gene            complement(192849..194024)
FT                   /locus_tag="Namu_0172"
FT   CDS_pept        complement(192849..194024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0172"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: Os10g0456500;
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76605"
FT                   /db_xref="GOA:C8XJ18"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ18"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACV76605.1"
FT                   /translation="MSAAFLEGLSGVDDDVAAALAEPLIDHHVHGCFTGELDRAGFEES
FT                   LNEATADPIPAFMTQFDSQLGFAVRRWCAPQLDLPPAVDADEYWHRRSTMTPELLARAM
FT                   LPAAGVSTWLVDSGFWTDRLCPPRQLAHWAGGVAGEVLRLESLAETLLAEGISGPSWAQ
FT                   EFRARLAAAGPAVVAAKTVAAYRCGLDIDWSRPSDAAVGRAAAPLPGSPTVRVDDPTII
FT                   AFGVHAAADAGLPVQIHVGLGDRDLDLRTADPLLLVPLLHARRTVPIVLLHCYPYHRAA
FT                   GYLAQAFGHVYLDVGLAINHLGVRSVELVAESLELAPFAKQLYSSDACGPPELHLLGAV
FT                   LWRRGMARTLGRWVREGDWSATDAARVARMIGADNARRVYRLPADGPSWAA"
FT   gene            complement(194021..195379)
FT                   /locus_tag="Namu_0173"
FT   CDS_pept        complement(194021..195379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0173"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76606"
FT                   /db_xref="GOA:C8XJ19"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ19"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ACV76606.1"
FT                   /translation="MIESSTRFVGGSVPSTAARLHDRSVRLLVGTAVDYAGVIRAKSVP
FT                   VERLSDFVTAGMGASPSWLAFGVDMSIAFTARFGVVGDLRLRIDPAATTVLESGVAWAP
FT                   ADFCEQDGTPFVGCPRARLRAVVDALGAAGLAARTGTELEFVLTRPDGAARIGPTWQGY
FT                   GARPLLDIAPLLTDLTDSFDGAGMPLEQLHAEYGADQFEISLPPADPLTTADRTVLARL
FT                   LIGRAAARHGCGVSFSPVPFAGGAGNGAHLHLSLTDGEGPLLSGGAGPHGLHPAGGAAI
FT                   AGLIDGLPGVQAVLAGSAVSSTRLRPGNWAGAFACWGLENREAAIRLVAATPGNPHGAS
FT                   VEVKVVDASANPYLAAAALLGSALDGIERQLALPDEVPVNPVELTAERRSALALAADQA
FT                   AALAALDRSSLARRLLGDVVVDGTLAVRRHELQAYSGADPDVVAAAFRQAFSG"
FT   gene            195460..196410
FT                   /locus_tag="Namu_0174"
FT   CDS_pept        195460..196410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0174"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: bja:blr3257
FT                   cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76607"
FT                   /db_xref="GOA:C8XJ20"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ20"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ACV76607.1"
FT                   /translation="MKSTSARALGLLLGYGADLMLGDPRRGHPVAGFGRLAAALERRTY
FT                   RDSRAAGAGHTAVLVIGTVSAGIAAERVAHRSPIIRVALTAAATWAVLGGRSLRREANA
FT                   VATRLAAGDLPGARRQITHLVGRDPATLDQAGIARACVESVAENTSDAVVAPLLWGAMA
FT                   GVPGLLGYRAVNTLDAMIGHRSPRYARFGWAAARLDDAANLVPARLSAALAAGLAPTVG
FT                   GSVRAARRAVRRDAGHHPSPNAGPVEAAFAGALGRTLGGVNVYGGTVEDRGTLGDGPAP
FT                   RTTDIARAVRLSAAVGAGALAVAAGWAFSIGPRAR"
FT   gene            196435..197328
FT                   /locus_tag="Namu_0175"
FT   CDS_pept        196435..197328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0175"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   mlo:mll7342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76608"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ21"
FT                   /inference="protein motif:PFAM:PF04248"
FT                   /protein_id="ACV76608.1"
FT                   /translation="MSLTTGTSPVGPRPAGRFNKPMPDSAGLFYLEPCRPRIRGQSGDV
FT                   IVVDSTAASLLHEHGQLPVLYFPVDDVRTDLLEPNGTRAHSPGKGEATGLRLSVGDRVV
FT                   QDAGWRFDQPEWDALAGLIAFYLPAMTQWWQEDEPMPGHARDPYHRIEVLDTSRRVRVL
FT                   VEGRVLADTTRARALFESGLPTRWYIPPRDVDASLLADSATRTTCAYKGQARYVSMRVR
FT                   PDQPDDKQPDLAWIYDEPLPDAARVAGYVCFWNERVDLEIDGEPVPRPVTEFLGGPTPL
FT                   LGLLPPAMLERPRPAD"
FT   gene            complement(197335..198081)
FT                   /locus_tag="Namu_0176"
FT   CDS_pept        complement(197335..198081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0176"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="KEGG: met:M446_2443 precorrin-6x reductase; TIGRFAM:
FT                   precorrin-6x reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76609"
FT                   /db_xref="GOA:C8XJ22"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ22"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ACV76609.1"
FT                   /translation="MPAPAVLILGGTGEARDLAARLLAAGVPAVSSLAGRVRDPALPAG
FT                   EVRIGGFGGAAGLADYLHAHRIRAVVDATHPFAQAISASAAVACRRTEVPLLRLARPGW
FT                   TGHPLAPTWQWVDDYAQAATAARGDRVLLTTGRTTLRAFADLAAPFVLVRLVEPATGPL
FT                   PAGWAVVTSRGPYTVAGEQALMREHRIEVVITKDSGGAMTQAKLVAADRVGARVVVVRR
FT                   PAPPAGVANVNDVARAVDWARRRIDR"
FT   gene            complement(198098..199426)
FT                   /locus_tag="Namu_0177"
FT   CDS_pept        complement(198098..199426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0177"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dde:Dde_2162
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76610"
FT                   /db_xref="GOA:C8XJ23"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ23"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACV76610.1"
FT                   /translation="MARESGLNRQILRLAVPALGALLAEPIFLLVDAAIVGHLGVAQLA
FT                   GVGIASVILGTLVGLSVFLAYGTTAQVSRALGAGRPADALTFGIAGLYLAVIIGVAVLA
FT                   VGWPLAPWLIDLFGGTTAVADFGIVFLRWSLLGLPAMLAVLATTGVLRGLQDTRTPLYV
FT                   AGAGAMVNMGLNVLLVYGIGLGVAGSAIGTALTQTAMAAVLVVIVARGARRLGVALTPH
FT                   AGHIRGAGRAGVPLFVRTLTLRAAIIVTTAVAARQGVTVLAAQQVVMSIWNFLALGLDA
FT                   LAIAAQALTGKALGEGDQAAARRFTGVMLRWGVGAGVAIGIVVLLIHTFAGAAFSPDPE
FT                   VRTAVGAALIVVAVSQPLCGWVFVLDGVLIGAGDGVYLAWAGVLTLVVYLPAAWAVAMW
FT                   APGGSAGLVWLWVAFSIVFMGARAVTLGWRYRGDRWLITGAVR"
FT   gene            complement(199443..200831)
FT                   /locus_tag="Namu_0178"
FT   CDS_pept        complement(199443..200831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0178"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   rle:RL3006 putative L-2,4-diaminobutyrate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76611"
FT                   /db_xref="GOA:C8XJ24"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ24"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACV76611.1"
FT                   /translation="MTDEPGSVADLIRTAAEAVIDYRAGLPHRPVAGPADRAALLAALG
FT                   GPLPAGPTSPDRVIDDLVVAADPGLVATAGPRFFGFVIGGSLPAATAADILAVGWDQVA
FT                   FNAISSPAASVVEEVAGGWCKQLLGIPASASVGFGTGAQSANTVGLATARHQVLAAAGW
FT                   DVERDGLAGSPRVRVVASVERHATVDRSLRLLGLGNASVRPVAAGPQGAIDINDLAKVL
FT                   ADEPTMPTIVVLQTGNVNTGACDDLRAAIGLARTVEHSWVHVDGAFGLWAAACPQTRAL
FT                   TDGIELADSWCTDAHKWLNVPYDCGLVFCADPSAHVAAASYSAAYLTGAGTAGSPSDYV
FT                   LESSRRARGFAVWAALRELGETGVADLVARCCALARRFADGLAAGGVEIVNDVVLNQVL
FT                   ADFGSDERTDAVIDAVQREGTCWLGGTTWRGRRLMRISVSNHSTTEDDIDRSVAAVLRL
FT                   AAGL"
FT   gene            complement(200875..201324)
FT                   /locus_tag="Namu_0179"
FT   CDS_pept        complement(200875..201324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0179"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: xop:PXO_02640
FT                   low molecular weight heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76612"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ25"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACV76612.1"
FT                   /translation="MLGFDPFRDMDRLASRLSNLPVPNGRTPAFMPMDLFRAGDHYILT
FT                   ADLPGVDPGSIDIGIDNNTLTIKAERTARSEDSVQWIASERFTGSFLRQLSLGDGIDTD
FT                   GISASYENGVLTVTIPVADKAKPRRVQIRTGGDRTVVEPQAVAAS"
FT   gene            complement(201564..202778)
FT                   /locus_tag="Namu_0180"
FT   CDS_pept        complement(201564..202778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0180"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: scl:sce7667 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76613"
FT                   /db_xref="GOA:C8XJ26"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ26"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACV76613.1"
FT                   /translation="MAPRSPTARGALAIRQSNLREHNLGLVLRIIVDASTPPSRADIAA
FT                   TTGLTRATVSSLADALIEAGLVTELPPVMSQRAGRPAVPLVAAAGTLAAVGMEINVDYL
FT                   SVRVIDLAGRVLHQQVRAANFRHSDPATVIPELVGLFRTATGAVDPGVQIAGAGLAIPG
FT                   LVDRPTGPVRLAPNLGWRDVDVAKVFRAELGAAQLAMVLDNEATLAARAESDALRAHGP
FT                   HTFLYLSGEVGIGGALVLDGSVFGGRHGWSGEIGHTVIDPDGPRCRCGATGCLEQYAGK
FT                   DALMRAAGLDVSLPIEQLQLAAAAGDPAAVAAFAMGSRTLGTAIANAVNLVDVETVVLG
FT                   GLYAGLYDQLVSGIEQVLQERVLAAPWSPMRVRAAVVREAAAVTGAASAVLSQVIDHPS
FT                   GWMHQ"
FT   gene            202850..204043
FT                   /locus_tag="Namu_0181"
FT   CDS_pept        202850..204043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0181"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: smd:Smed_2789 xylose isomerase; TIGRFAM:
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76614"
FT                   /db_xref="GOA:C8XJ27"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013453"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ27"
FT                   /inference="protein motif:TFAM:TIGR02631"
FT                   /protein_id="ACV76614.1"
FT                   /translation="MVRAATPDDRFSFGLWTVSWQARDPFGDATRPALDPVEAIGKLAE
FT                   AGAWGVTFHDDDVVPFGSDDATRDRLITAFRDACTEHDVTIEMVTTNLFTHPVFKDGGF
FT                   TSNDRSVRRFALRKVLRNIDLTAELGAKTFVMWGGREGSEYDGSKDVNAALDRYAEGVD
FT                   TVAAYIKSRGYDIKIALEPKPNEPRGDIFLPTIGHALGFIAKLEHGDIVGLNPEVGHEQ
FT                   MAGLNFTQGIGQALWAGKLFHIDLNGQRSIKYDQDLVFGHGDLLSAFFTVDLLENGFPN
FT                   GGPRYDGPRHFDYKPSRTDGFDGVWASARANIATYLLLKERALAFRADPEVQAALEASG
FT                   LSELAVPTLAAGESIEDLLADESAFESYDADKAAEHSYAFVHLNQLAVEHALGARLS"
FT   gene            204229..204630
FT                   /locus_tag="Namu_0182"
FT   CDS_pept        204229..204630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76615"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76615.1"
FT                   /translation="MATASNVNLTLLRNVANANATVTYTVNWSAFDQASNLQYVESVRF
FT                   IGDDTGQDGDTGPVGDDPISIGLNFSTLLSANGQATTSRTRSFTFPWANLNEDDVPILG
FT                   NTDDEIRAVVTLMPQLPVTVTTESNLVTV"
FT   gene            204944..205978
FT                   /locus_tag="Namu_0183"
FT   CDS_pept        204944..205978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0183"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: ppf:Pput_3233 alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76616"
FT                   /db_xref="GOA:C8XJ29"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ29"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV76616.1"
FT                   /translation="MATMQDVANLAQCSLSTVSYAINNTRPISAATRQRIEQAMRELDF
FT                   RPNQIARSLASRRSNILALTFPGTENTLGSTIMEFVTGAAQAARERGFHLVVWPYAPAQ
FT                   ADEMLQMSRQGLADGIIVMEVRRDDPRVRLLDEHQFPLTMIGRAEDGTDSRCVDVDFEQ
FT                   TAEAAVAHLAELGHTDIVLLNHSADSRDHGYGPTLRIAEGFHRVMGRRGLTGQVLWCDE
FT                   TPAAGRRAIDELTGRWPAVTAMVAMNEHAVIGAVGGLAGRGIAVPQTFSVLSIVTSPLM
FT                   AQMAEPALTILHSPGADLGRLGVQNLLDQLDGRRPAPAPTLLPCRWEAGRSTGPVPPVI
FT                   HRPR"
FT   gene            206125..207477
FT                   /locus_tag="Namu_0184"
FT   CDS_pept        206125..207477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0184"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ara:Arad_3410 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76617"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ30"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV76617.1"
FT                   /translation="MFRRRSRTTTIAAAAAAVAVSLTLAACSGSSSSGSGSSPEAGSGS
FT                   AAAETGTLKLWHYESANGAMGIAWDKAIEIFKTEHPNVQVDFERKAFEQIQQNAGMILS
FT                   SDEGPDIMEYNKGNATAGLLASQGLLTDLTEQAQSRGWADKLAPSLQTTARYDERGVMG
FT                   SGNWYGVPNYGEYVMVYYNKDAFSANNIAVPTTMDEFTAAMDTFVAAGTTPICMAGAEY
FT                   PAGQLWYQLALTQADRSFVDDYQLYKNPVDFQNGPTAKGAELFDQWVQKGYLAKDSASL
FT                   KAEDMGTAFIGGKCPIMISGSWWFGRLKDEIKTFDWGTFLFPGAKLSLGSSGNLWVVPQ
FT                   ASQNKDLAYDFIDITMRPEVQNLLGNSGGIPVAADPSAITDPQSAELIKNFNTLAGNDG
FT                   LAFYPDWPVPGFYDVLVSAFQSAINQSKTPAEVMTAIEGPYTEGVASVQAG"
FT   sig_peptide     206125..206271
FT                   /locus_tag="Namu_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.365 at
FT                   residue 49"
FT   gene            207606..208553
FT                   /locus_tag="Namu_0185"
FT   CDS_pept        207606..208553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_3407 sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76618"
FT                   /db_xref="GOA:C8XJ31"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ31"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV76618.1"
FT                   /translation="MTDLAAHDADSPRTPAPARQRRGGYWWYLVPGAIGFVAVILGPLV
FT                   YNVYLSLTKWSGVGSPRFIGLTNYIRLMGDSVFWTSFKNSVAMIIAMVVIPTLIGLILA
FT                   SVLFDYLGKRFGAASISVLRAVFYLPQVLPVVVAGIVWGWILRPDGAFNAMLDAVGLSG
FT                   FTRDWLGDPNTALPMVMLVMVWVQIGYPVVIFMSALGRVDPEIYEAAEIDGAGYWARFT
FT                   AITLPQIRPETFVVALTCTIAALKVFGPIYALTRGGPENATNVPSYFAYYTFFKKLDVG
FT                   YGAAIATVLTIIIVLVAVGIMRWQAHSEKKELSA"
FT   gene            208550..209464
FT                   /locus_tag="Namu_0186"
FT   CDS_pept        208550..209464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0186"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PB00113 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76619"
FT                   /db_xref="GOA:C8XJ32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ32"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV76619.1"
FT                   /translation="MSVPVLARAGDTVSAGQRQADRRAVRARDRFHRGPGRWIVLAIIV
FT                   AGAALMLVPFALMLLNAFKSPADYSTNGPLSWPTEFYTKGLTTYWTESDYPLKLWNSTL
FT                   IAGTVAVAAVLISLLNAYAIGVGRVKGRLWIVALFLLGNMIPQEALVYPLYFLAKEVGL
FT                   YNTKLVVIIIFTVIQSAFGTYLLASVLGTFPKALLEAAALDGASRWQILWKVVFPIVRP
FT                   TLSVLLIFFFIWTWNEFFIPLVMLIDNATQTVPVALASLQGDRLMDAPTTNAGALISLI
FT                   PAVIFFLIFQRTLTRGVTAGAIK"
FT   gene            209480..211807
FT                   /locus_tag="Namu_0187"
FT   CDS_pept        209480..211807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0187"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   esa:ESA_04154 alpha-xylosidase YicI"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76620"
FT                   /db_xref="GOA:C8XJ33"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ33"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ACV76620.1"
FT                   /translation="MRFSDGYWMVREGFQVRTARQVRDVEATPTELSVLAATRTINSRG
FT                   DTLNTPTATITLSTPAEGVIRVRIEHHAGARDPGPEFALPGATERRPQIRIEADHASLD
FT                   AGGLTARIRRDGPLRLDFEAGGRVLTGADATSVGLATGPDGTPYVFAQLGLDVGEVVYG
FT                   LGERFGPLAKNGQSVDIWNADGGTSSEQAYKNVPFFWTNRGYGVLVNHPELVSFEIGSE
FT                   VVSRTQFSVTGEHLEYLVILGPTPKEILRRYTALTGRAPRVPEWTFGLWLSTSFTTAYD
FT                   ERTVSSFIDGMAEREIPLSVFHFDCFWMREFRWCDFEWDPRTFPEPEAMLARLKARGLR
FT                   VCVWINPYIAQRSALFEEGRAKGYLVTRADGSLWQWDLWQAGMALVDFTNPAAAQWYAG
FT                   HLERLLDQGVDAFKTDFGERIPTDVVWFDGSDPDRMHNYYTHLYNRTVFELLERRRGRG
FT                   EAVLFARSATVGGQQYPVHWGGDCDSTYASMAETLRGGLSLAASGFGYWSHDIGGFEGT
FT                   PDAGVFKRWLAFGLLSSHSRLHGSDSYRVPWAFDEEAVQVARRFTRLKMTLMPYLLGAA
FT                   RQVTEEGTPMIRPMVMEFPDDPATEYLSTQYMLGDALLVAPVFHPDGDVRYYVPAGTWT
FT                   GLLDGRTVVGPRWVHERHGFDSLPLLVRPGSVIPIGARSDGPEYDYADGVALHLFDPAA
FT                   LTDRTVRVPTAGGAAVEFRIRREGRQLTVFGPDPAEHSWSVVCAAAEKADGSASTRAAE
FT                   SASVCMTLPGPVAEPLPPRKDS"
FT   gene            211807..213225
FT                   /locus_tag="Namu_0188"
FT   CDS_pept        211807..213225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0188"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="KEGG: hch:HCH_06907 beta-glucosidase/6-phospho-beta-
FT                   glucosidase/beta-galactosidase; TIGRFAM:
FT                   beta-galactosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76621"
FT                   /db_xref="GOA:C8XJ34"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ34"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ACV76621.1"
FT                   /translation="MTSTPRTFPEDFLWGSATASYQIEGAVTEDGRGPSIWDTFSHTPG
FT                   KTMNGDTGDVADDHYHRWSADLDLIKGLGLQAYRFSLAWPRIQPTGSGAVNAKGVDFYS
FT                   RLVDGLLERGVKPVVTLYHWDLPQALEDEGGWTNRDTALRFADYAAHVAGALGDRVEMW
FT                   TTLNEPWCSAFLGYASGVHAPGRTDGEAALRAAHHLNLGHGLAGRAVREVLGADTKLSV
FT                   TLNLHVTRPVDPDSAADRDAIRQLDAVGNRVFLGPMLDGAYPADLLADTASVTDWSFVR
FT                   DGDEAACAVPIDVLGINYYSTSRARRHTGDGPMEHADGHGDTGFSPWVGADDIEFLRQP
FT                   GPYTAMGWNIDPSGMLELLTDISTRYPSVPLMVTENGAAFYDTVSEDGHVHDADRVAYL
FT                   HGHIDAVGQAIDAGADVRGYFLWSLLDNFEWAWGYDRRFGIIRVDYDTQERTVKDSATW
FT                   YSRLIATRELPPVD"
FT   gene            complement(213265..214209)
FT                   /locus_tag="Namu_0189"
FT   CDS_pept        complement(213265..214209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0189"
FT                   /product="alpha/beta family hydrolase"
FT                   /note="KEGG: scl:sce2214 alpha/beta family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76622"
FT                   /db_xref="GOA:C8XJ35"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ35"
FT                   /inference="similar to AA sequence:KEGG:sce2214"
FT                   /protein_id="ACV76622.1"
FT                   /translation="MTALHEGRLQPDVYDDDDILLPLLDHAPHAALRLPDGRAMAWAEY
FT                   GSPRGLPCVLVPDTGSSRLAPGWLLHDSALPAAIRLLAIDRPGIGASDPIGFGGTEQPA
FT                   EDLRRLVETLAVGRVAVIGIGRGADDALAFAARYPTLVTSVSAVSVRLPGRQSRRRSLL
FT                   HPRGRTGQSWAGPLACWVRTAGKDADLTLESTWRRMLDRLDPKAAEVLGDRWMESDFRD
FT                   SVAADAAQINPDWTAPARSVTSPAWVLDPGAIRVPVEAWHGKHESGTTLAAVQDFAADL
FT                   PGWTVRAAPGSSAVLGSWTGILGVAAAGFLGAN"
FT   gene            complement(214441..215235)
FT                   /locus_tag="Namu_0190"
FT   CDS_pept        complement(214441..215235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0190"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /note="KEGG: bxe:Bxe_B2634 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76623"
FT                   /db_xref="GOA:C8XJ36"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ36"
FT                   /inference="protein motif:COG:COG2141"
FT                   /protein_id="ACV76623.1"
FT                   /translation="MTITRPIRIGIQLQPQHADYAQLRDALLRAEDLGVDIVFNWDHFF
FT                   PLTGDPDGKHFECWTMLGAWAEQTERVEIGALVTGGGYRNPDLLADMARTVDHISGGRL
FT                   IFGIGGGWFEKDYDEYGYDFGTPGSRLSLLGDGLARITARWERLNPPPVRPIPVLIGGG
FT                   GERKTLRHVARYAHIWHAFGGPDTQARKAAILAEHCAVVGRDPNEIERSTAAPRWGSPD
FT                   AQALLDLGVTLFTIGVSGPDYDLSVIPEWVKWRDSRNADRGQ"
FT   gene            complement(215309..216961)
FT                   /locus_tag="Namu_0191"
FT   CDS_pept        complement(215309..216961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0191"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mlo:mll5046 putative FAD-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76624"
FT                   /db_xref="GOA:C8XJ37"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ37"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACV76624.1"
FT                   /translation="MADADLVVVGAGLAGLVAAAEAADAGRSVVVLDQEGSAALGGQAW
FT                   WSLGGLFLVNSREQRRLRIKDSFQLAWEDWSGSAGFDRPEDHWPREWARAYVEFAAGEK
FT                   RSWLKAQGIGLFPVVQWAERGGYEVGGHGNSVPRFHLTWGSGPGVVDPFVNRVLAHVRD
FT                   GRIRLRYRHRVTELIVDGGRVIGVSGEILEPTTAERGAPSSRAVVGDFAVTASAVIVCS
FT                   GGIGANHDLVRRYWPGGPDAAPAQMLSGVPDSTDGLMLDVAERAGGRVINRDRMWHYPE
FT                   GVHNHAPVWSGHGIRILSGPSPLWLDAFGRRLPAPLFPGFDALGALRHIVGTGHSHSWF
FT                   ILDLDTIGPEFGLSGSEQNPDFAQRSLKLLLTTRAGGKITPPVRAFLDRGVDFLTAPTV
FT                   PELVAKMNALVGADLVDADEVERLIRLRDHQVRTGLGKDPQLVAVAGARRYLGDRKMRV
FT                   APPHELLADGHGPLIAVRLTVITRKTLGGLETDLSARVLAPDGQVVPGLYAAGEAAGFG
FT                   GGGMHGYRALEGSFLGGCLFSGRIAGRAAAGAV"
FT   sig_peptide     complement(216893..216961)
FT                   /locus_tag="Namu_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.758 at
FT                   residue 23"
FT   gene            217318..218706
FT                   /locus_tag="Namu_0192"
FT   CDS_pept        217318..218706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0192"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: rfr:Rfer_3471 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76625"
FT                   /db_xref="GOA:C8XJ38"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ38"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV76625.1"
FT                   /translation="MRFRALLALGAAVVVVGYVVVLLRPTDPDLPQVLVEPGFLMLAAL
FT                   VLLADLYPLVPSMRDVRSKVTYSWSAALSLAAVLAFGPVAAVLFLLSGCTAALSRGRAR
FT                   WWLVALNTVAMGLIGLTMAALSRFADTFDPLMPPGAWPLACWGLLMGALVVGMAAGMTG
FT                   WAQFELGVHEWRAQRAWFNKSVRIWGVSLIAAPLLASLALYGWWALPSMAVVIISLNRL
FT                   SSTMYRSTAASRTDPLTGLANRLRLTRVLSGRIADLGPGEEVALLLVDLDGFKQVNDTH
FT                   GHLVGDQVLGTVAARLQAAAGPVDLVARYGGDEFAIVLAPGLTTERIGRAAQEYRDALA
FT                   EPIVVGDLTIRIGGSVGIATTADPATDVLGLLAKADLDMYRMKRDHGRRVERRGQGRVE
FT                   PAAPDIETAAAAPAAAPPVRPPMWSVSVQGGASAPVDGWPGVRWSSSSGGVALAPGQRA
FT                   RTAV"
FT   sig_peptide     217318..217371
FT                   /locus_tag="Namu_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.333 at
FT                   residue 18"
FT   gene            218703..220055
FT                   /locus_tag="Namu_0193"
FT   CDS_pept        218703..220055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0193"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: bja:bll6547 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76626"
FT                   /db_xref="GOA:C8XJ39"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ39"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV76626.1"
FT                   /translation="MTEHNPMTAPLRRIPVRFRWWLAGCLVALVAAFSLLHAFAPGPDV
FT                   PEIMRQPGALLLLALIVLADLHPALPWMRSTNPFDEFIFSTPLAIAALLVFGPHAAIMF
FT                   VIAGFAMTVALGMRWWRVVLNAALWGVQGAAAAGVLAVVWAAAGWDNEVPAEAMIPMTI
FT                   VLAVIIEGLNIALVMTSQCLAGATTPRAYLADWRSQVAIGTLDLTAPIPAALAAAQPAL
FT                   LPLLAVAMVAAQAGLSAVTSRTAQAGTDPLTSVPNRAYLLARIKSRLAGTEDARDPVTV
FT                   LLVDLDRFKQINDELGHLVGDRVLVEVARRLEESTRSSDVVARFGGDEFAVLLSGGSGQ
FT                   RNAQEVAARIRTAVARPIHLDGRSVQVGVTIGWALAEGHDTDPLALLHRADARLYAAKA
FT                   ARSPAPAPLAEPLPARPEASPVTDFRGPIWSGTSVRSSQAHDGDASAATAS"
FT   sig_peptide     218703..218819
FT                   /locus_tag="Namu_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.987 at
FT                   residue 39"
FT   gene            220144..220485
FT                   /locus_tag="Namu_0194"
FT   CDS_pept        220144..220485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0194"
FT                   /product="acetyltransferase-like protein"
FT                   /note="KEGG: bpt:Bpet3331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76627"
FT                   /db_xref="GOA:C8XJU4"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU4"
FT                   /inference="protein motif:COG:COG2388"
FT                   /protein_id="ACV76627.1"
FT                   /translation="MSDQSTQDLANLEPLGAGPTRTREIEHLKSHGRFALMIDGREVAV
FT                   VDYRRLPGKWNIVHTYTEPASRGYGVASDLIREVLNAAREEGVTVIPTCPYVAWWIGEH
FT                   RDYEDLVAT"
FT   gene            220485..221945
FT                   /locus_tag="Namu_0195"
FT   CDS_pept        220485..221945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0195"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mxa:MXAN_2875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76628"
FT                   /db_xref="GOA:C8XJU5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU5"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACV76628.1"
FT                   /translation="MPSRGSEDRSGPEQAPDDGAGADATNGLGSEAALDAAIDDALAEL
FT                   HGTAGHDAAGRDGAGRPVAASPSAAAGDASEVLGSGPDGHAADGSGDPTQTERRRRSRA
FT                   GLRTAVQTLTARMVSERAVQAAAAASASAEAAQAAVEQGRGRDRPSPFQWGFFGGLGVL
FT                   IAYITFLVLDSIRDTLVMIAIATLLAIGLDPLVSAMTKRGLRRGAGVAVVFLGLLLVIA
FT                   AAIYAIIPPIINEVGSFVATVPTLINDLQTNDTVQGLDQRFGLLEALRNSNIVQSLGSG
FT                   AAGGILSASFTVATVFADLLIVLILTLYFLAGFPRIKAAGYRLVPASRRVRVSDLGDRI
FT                   LKQMGGYLSGATIIAIQAGLVAGIFSSIIGLPYPWAIGLGAAVLDFIPVVGPIIVGVSI
FT                   TLIGFTQGLGIGIISGVFYLCQHLFEAYWLYPRVMRRTVNISTGGVVVAILIGASLLGV
FT                   TGAILAVPVAAAIMLIVREVIMPMQERS"
FT   gene            221942..222895
FT                   /locus_tag="Namu_0196"
FT   CDS_pept        221942..222895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0196"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mno:Mnod_6760 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76629"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76629.1"
FT                   /translation="MNQKGTPGGGGAANRWRSIGLPDQIGRRAIVTGANTGLGFAAAKA
FT                   LAGAGADVVLAVRDLDRGVAAAQRIRDALDEAKVRVVHLDLARLASVADFAATQCAQGP
FT                   VDILINNAGLMLVPRREFTADGFEAQMGVNHLGHYALVAGLLPALEQAPAARIVGVTSL
FT                   AARRARRLDQRLGLDGDYRPMGAYSQSKLAVGLFAVELDRRLQAAGSRARSLLAHPGWS
FT                   ATAVAQPEDGAGRKVVFSRRATALLGSSPASGARSEVAAATFPDLPGGSLVGPHFLVRG
FT                   APRARPAPKAMTDPAQAGWLWSRSAELTGVEPLPGS"
FT   gene            complement(222915..223649)
FT                   /locus_tag="Namu_0197"
FT   CDS_pept        complement(222915..223649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0197"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   mlo:mll3323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76630"
FT                   /db_xref="GOA:C8XJU7"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU7"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACV76630.1"
FT                   /translation="MSFPVAGAGVIGSGPARLFRRVLLLLVVSTLVTVGLAGPALAHTT
FT                   LIGSDPADGAVLTAAPTTVTLTFDDPLADFEPVLTVTGPDGVTYQSGSPTVDGTRLSNA
FT                   VNALPVAGTYTVAYRVVSDDGHPVEGTLSFTLAAQAIAPAPAPATSTGTSPAAGSSTAA
FT                   GATTPSSAATSTVSSTAASAVSSTAGTTSTDSVAPAGNSSTGWSAWQWLLVVLFVALAF
FT                   LATLVVRRRMEASARARSGERN"
FT   sig_peptide     complement(223521..223649)
FT                   /locus_tag="Namu_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.943 at
FT                   residue 43"
FT   gene            complement(223693..224244)
FT                   /locus_tag="Namu_0198"
FT   CDS_pept        complement(223693..224244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_03626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76631"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU8"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_03626"
FT                   /protein_id="ACV76631.1"
FT                   /translation="MALRRKSGKKAASGSTGTSAAKSGTSSRGRRAAGSAGLVGVLSDP
FT                   KALRRMLLAAKIVGPAVAAGTLRASTGVRGVLDERRARQLGVPVEDVAIYRGPAGTVQA
FT                   RIVGLRTALNDLRSRRGTDPAVARFVDRTTARLGELSAATTATASMPSTTRRSALRAVA
FT                   ADLDDVDAQLMAHLVGPRAA"
FT   sig_peptide     complement(224173..224244)
FT                   /locus_tag="Namu_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.420 at
FT                   residue 24"
FT   gene            complement(224323..225084)
FT                   /locus_tag="Namu_0199"
FT   CDS_pept        complement(224323..225084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0199"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_0899 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76632"
FT                   /db_xref="GOA:C8XJU9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJU9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76632.1"
FT                   /translation="MELTGSSALVTGAASGLGAATAAALAGAGAAVVGLDLAVAWDRAP
FT                   APPAGVIALPGDVTAPEQVQTAVERAGRDGPLRVAVNCAGLGTAGRILSRSGVHELDMF
FT                   ARVIQVNLVGTFNVLRLAAAAMADTDPLDADGQRGLIVNTASVAAFDGQIGQAAYASSK
FT                   GGVVGLTLPAARDLAQYGIRVVTIAPGIIDTPMLAGITPEFRATLSAGVPHPSRLGRPD
FT                   EYAQLVLAIAGLDYLNGEVIRLDGALRMPPR"
FT   sig_peptide     complement(225004..225084)
FT                   /locus_tag="Namu_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.569 at
FT                   residue 27"
FT   gene            225145..225654
FT                   /locus_tag="Namu_0200"
FT   CDS_pept        225145..225654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c0253 glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76633"
FT                   /db_xref="GOA:C8XJV0"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76633.1"
FT                   /translation="MNTDSNPDQTEHRHARRLAVLEARVDELDAAARRARSLGPILLLV
FT                   LANVTPLIVATPRNDPGEGFTLFQVLRGALDGGGPASLWFVLLTIAGLASAVAAARLGG
FT                   AAPSRGTRWFAQGVAAVLLVGLLVVTILAASAGSRSASFTAVSPAAVLAAAAAVWLIIG
FT                   ARSTRP"
FT   gene            225775..226728
FT                   /locus_tag="Namu_0201"
FT   CDS_pept        225775..226728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0201"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: mxa:MXAN_7405
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76634"
FT                   /db_xref="GOA:C8XJV1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV1"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ACV76634.1"
FT                   /translation="MFLLRKPILALSGNTAVRDALTSTSLTASVVDRFIAGETTADAVA
FT                   AVSRLRPDGLQVSLDHLGEDTTDRATADATVEAYLQLIEALAAAGQVAGAELSVKLSAV
FT                   GQALIASPDLPAGGNAYALAGARRITDAAYAAGARVNLDMEDHTTVDQTLEVLFELRRA
FT                   HPDVGVAIQAMLLRTPKDLAELTGPGSRVRLVKGAYHEPAEVAYTDPAQIDLAYVRAMK
FT                   LLMHGKGYPMIASHDPRLVAIADRLAADAGRSPDRWEHQMLYGIRPDEQRRLVAAGKQV
FT                   RVYVPYGSDWYGYFTRRLAERPANLLFFLRSLTSKG"
FT   gene            226787..228415
FT                   /locus_tag="Namu_0202"
FT   CDS_pept        226787..228415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0202"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   scl:sce4459 1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76635"
FT                   /db_xref="GOA:C8XJV2"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV2"
FT                   /inference="protein motif:TFAM:TIGR01236"
FT                   /protein_id="ACV76635.1"
FT                   /translation="MDAVTHPPLPVNEPVLNYAPGSPERATLLEALAGFTGPMELGAVI
FT                   DGAVREPGGAPFTVVAPFDHGRVLGTSAHAVQDDARAAVAAALAAAADWRAMDFDSRAA
FT                   ILLRAADLLVGPWRARINAATMLGQAKTAYQAEIDSACELADFWRFNVHFARQILAEQP
FT                   IANAAGIWNRTDHRPLEGFVYAVTPFNFTAIAGNLPTAPALMGNVVVWKPSTTQQLAAS
FT                   LTMQLLIEAGLPPGVINMLPGTGPEISEVVLAHPELAGIHFTGSTRVFQQLWSAVGANI
FT                   GGYRSYPRLVGETGGKDFVVAHPSADVDVLRTALVRGAFEYSGQKCSAASRAYLPASLW
FT                   PALKDGLIEQTEALTVGSVEDLTNFTSAVIDDRSFGRLKAAIDRAHATDSVTVLAGGRY
FT                   DDAQGYFVRPTLLLGTDPRDEAFCTEYFGPILSLYVYPDAEFDAVLREVDQASPYALTG
FT                   SIIARDRAAVARASAALRYTAGNFYINDKPTGAVVGQQPFGGARASGTNDKAGSAANLL
FT                   RWTSPRSIKETFVAPTAVGYPHQAQ"
FT   gene            complement(228484..230463)
FT                   /locus_tag="Namu_0203"
FT   CDS_pept        complement(228484..230463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0203"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="KEGG: mca:MCA1237 sensory box protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; GAF domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76636"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACV76636.1"
FT                   /translation="MPSKQSLEELVTQAATDLMGVTAVSLRGATQNLLRELVDYFGVDT
FT                   SFLRRNDHQIHASLLVAEWPPRIDVPDPDPLALVYFEGADPTFAASETLSHVTITRPGE
FT                   LFGAEVDDSDYQELVRRASGVQIGVSLAVVPMLGTHDTMGVLGFVKYGDREWTDAEINA
FT                   LRAVAGLLAQLQARVDAEERLRHQAFHDELTDLANRRFLVEEITQRLEPGTGDPVGLIF
FT                   MDVDRLKALNSFFGHAAGDQYLQILAGRLRERISARHMVARLGGDEFVVIMGGPTDEAT
FT                   ARALAEKLRQVANQPILVGGEEVSRAVSIGVALGQPGQTSASELMNQADQAMLEAKSRG
FT                   GNEIGVFSAQMRRANEIRTDIELHIGTAIRHGALVLHYQPEVDLRDGRILGVEALVRWP
FT                   NPTLGLLQPGAFIDVVEATNLAGELGRWVLGQACRQLREWQLHYPERRLGMSVNVSPAQ
FT                   LITLDFVATVAKTLADHELDGQWLTLEITEQALVRDTDQALATLRGLQRIGVKIAIDDF
FT                   GTGYSSFAQLKSLPADVLKIDRGFVRDLGTDFDDLAIVQSIIGLARSLGLDLVAEGVET
FT                   EIAASTLVDLGCTRAQGFLFAGPRPPAEIEQMIQTGVCPPMVDLDSGDTVETAALRVLR
FT                   PAAGFDGPAAPTTAARRFHPPGGG"
FT   gene            complement(230484..232619)
FT                   /locus_tag="Namu_0204"
FT   CDS_pept        complement(230484..232619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0204"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   afw:Anae109_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76637"
FT                   /db_xref="GOA:C8XJV4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV4"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACV76637.1"
FT                   /translation="MPIPESPAFSAVIFDRRDPAQSQEIDRLIASGITLRDAVVPTDDL
FT                   RRLRPALTDDELDEPPRWAYFAWQHSIVRILGPGLYRRVRLDRNRIKITGDEQERLSSR
FT                   RIGIAGLSSGYSIALALVLEGLCGHLRLADFDTLELSNLNRVPLGLFEVGVNKAVAAAR
FT                   RISELDPYLSLEVLTDGVTATNADEFIDGLDMLLEQCDSFDMKVVLRDSARRQRVPVVM
FT                   QTNDRGLLDVERFDLEPDRPLFHGLVDVDALTDVAELTPEQKTPLLLKIIDARQMSDRG
FT                   AASLIELGRTVGQWPQLGSETLFGAAMVAAVARRIGLGRPLPSGRLRTDPDDLLALLAE
FT                   PTPDPVPPGPAAPAELRPDADPLTTILHAASRAPSGGNTQPWRFRAGAARLIIEPAPTP
FT                   SRMDVAGRGSLVAAGAAAFNARVAAAARGTLGPWHIHADQSPVNVEIDLTEGGFDPDLA
FT                   ALYQPMVARTANRSPGRRRELAAPVVAALTAAAAAEGAVLRLISDLPRLRALGEVLGEA
FT                   DRIRFLSGGLRQDMLDELSRPGLDRPDIGIDVRTLGLGAATSLLDLVARPPVMQTLRSL
FT                   SGGSMFRDMTAARVTSASAVGVVVIDGDRVEDYVRGGAAMERVWIAATTAGLGVVPLSP
FT                   AFLYARTPADLATLAPDSTGELADLQGRMNEIVGIAESQAPVLIMRFVHDPQEAPRSLR
FT                   RPLSEVVISSENTVGTN"
FT   gene            complement(232640..233350)
FT                   /locus_tag="Namu_0205"
FT   CDS_pept        complement(232640..233350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76638"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76638.1"
FT                   /translation="MRQGGVLGHYLDPASGARFVYARPEDQPELWNAYLDGAAENYRRF
FT                   GVEHVLEYDDIRTGAGTTLFVAVLDRSGQVVAGVRAQGPYTDVDDAHALMEWAGRPGTA
FT                   ALREGISARIDEGLLELKAGWVSADSPDRHALTPALARTVFHIFRLIGVRYALCTVADH
FT                   AVRRWQSSGAQIGQDVAPVAYPDPRYRTVPIWWDRETMLAASDASHLLLLAHEQEMFEL
FT                   SLNPDVRPGTPAAA"
FT   gene            233751..234710
FT                   /locus_tag="Namu_0206"
FT   CDS_pept        233751..234710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0206"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="TIGRFAM: L-lactate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: scl:sce5245 L-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76639"
FT                   /db_xref="GOA:C8XJV6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV6"
FT                   /inference="protein motif:TFAM:TIGR01771"
FT                   /protein_id="ACV76639.1"
FT                   /translation="MTDISLRRNKVAIVGAGSVGATLAYASLIRGVAHDVVLYDMAKAK
FT                   VEAEVLDLRHGLQFCPPADVDGSDDVAICANADVIAITAGAKQKPGQTRLELAGINVDI
FT                   CRKLIPALLDVAPDAVIVMVTNPVDVLTYAALKFSGLPKNRVLGSGTVLDSARLRQVIA
FT                   RKLNVASQSVHAFIAGEHGDSEFPLWSSASIGTVPVLDFAAPDGTTLDEEQEAQIAHDV
FT                   VNAAYSIILGKGATNYAVGLAGARVLEAILRDENGVLPVSSLLDGFHGITDVCLSLPSL
FT                   VNKSGVASMLDVPLSDREVEQLKASAAEVKSVQASLGL"
FT   sig_peptide     233751..233831
FT                   /locus_tag="Namu_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.965 at
FT                   residue 27"
FT   gene            234964..236292
FT                   /locus_tag="Namu_0207"
FT   CDS_pept        234964..236292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0207"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   dol:Dole_0349 cyclopropane-fatty-acyl- phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76640"
FT                   /db_xref="GOA:C8XJV7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV7"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACV76640.1"
FT                   /translation="MALLTPTRRHPTPWPAAGVWPGLFDVPKVPVHAAIARRLAAAAVR
FT                   TLPMSLEFPDGSRWGAGGPALQLVRPDNFFARLGADGLIGFGEAWMTGDMTTGGWRVSA
FT                   DRQDPAGALDPAAANAATDELAAVLEVLAHRMSVLVPRPLQALRHTWQSRPPRPEENTP
FT                   TGARENIHRHYDLSNDLFELFLDPSLTYSSAWFEPGDDLDTAQVRKIDAILDLARMRPG
FT                   MRVLEIGSGWGALAMRAARTRDVHVTTLTLSEAQRELALRRIADAGLSQRIDVLLEDYR
FT                   VHAAREAGSYDAVVSVEMIEAVGERYWPDYFGAIDRMLAEGGRLSLQAITMAHERLLAT
FT                   RNGYTWVHKYVFPGGALPSMTAIDQVVTEHTRLRIQETRRLGHSYVPTLEQWRHRFNDR
FT                   LPQVQALGFDETFIRMWNFYLAYSQAGFAADYLDDLQIGFARQ"
FT   gene            complement(236327..237358)
FT                   /locus_tag="Namu_0208"
FT   CDS_pept        complement(236327..237358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0208"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; NADP oxidoreductase coenzyme
FT                   F420-dependent; Ketopantoate reductase ApbA/PanE domain
FT                   protein; KEGG: gsu:GSU0006 glycerol-3-phosphate
FT                   dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76641"
FT                   /db_xref="GOA:C8XJV8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV8"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACV76641.1"
FT                   /translation="MTAVRALRRQPKVAVIGSGSWGTSVASIIARHSPTVIWGRSAEVV
FT                   DQINTGHTNERYLPGYALTPSLTATTDLARAVEPADILIMAVPSHGFRGALDDLAPFLR
FT                   PWAPVVSLVKGLEQGSRKRMTEIVDEVLPGHPAGVLAGPNIAREVAAGYAAAAVIAMPD
FT                   QHLAAQLGELFRTKYFRIYSSSDVTGVEIAGSLKNVFAIAVGMGDGVGSGDNTRAMVIT
FT                   RSLREMTKLGTAVGGQSETMTGLAGMGDLVVTCTSKFSRNRHVGEEIGRGVPVPQILAG
FT                   MKQVAEGVKTASVVMEMAAEYGVDMPIAREVDAVVNHGSTPERAYRGLLNEAPGHEVHG
FT                   AGW"
FT   gene            237597..238625
FT                   /locus_tag="Namu_0209"
FT   CDS_pept        237597..238625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0209"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; PFAM:
FT                   phospholipase/Carboxylesterase; KEGG: mrd:Mrad2831_6025 PHB
FT                   depolymerase family esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76642"
FT                   /db_xref="GOA:C8XJV9"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJV9"
FT                   /inference="protein motif:TFAM:TIGR01840"
FT                   /protein_id="ACV76642.1"
FT                   /translation="MTFFRLGTRRVEGSVGEQGSAPGLIDPPAQRGQAQGQRERRTFTG
FT                   PDGSRAYSLYVPPALGASAASAAAASAAAAAARAGGPWPLVVMLHGGAQTAADFAVGTD
FT                   MDCLADHYGFVVAYPEQSTQANPGGYWNWFRPQDQQAGAGEPGILAGIVAEVMAQLPID
FT                   PGAVFVAGLSAGGAMAAVMAAAHPELFTAVGVHSEVGYRAAADAGSAFGVMQSGGAPDT
FT                   HGPVPMIVFHGTRDSTVAAVNAHQVVQAALAGDHTGLQETIDVVPAEDGRRGYTRTVHR
FT                   DAAGRTMVESWLVEGGGHAWFGGQPAGSYTDPAGPDASVELVRFFLSHRDRHRAGHRGA
FT                   GS"
FT   gene            238680..239564
FT                   /locus_tag="Namu_0210"
FT   CDS_pept        238680..239564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0210"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="PFAM: DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; KEGG: hch:HCH_02013 formamidopyrimidine-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76643"
FT                   /db_xref="GOA:C8XJW0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW0"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ACV76643.1"
FT                   /translation="MPELPEVTALAAFLTEHAGGQRITAVSVAALNVLTTYDPPASALV
FT                   GRTVTGAGRHGKFLDLVTAPGPDASPGTPDALHLILHLARAGWLRWSDAISPRPPKMGG
FT                   PIALRVALSGGGGFDVTEAGTKKSVTAAVVTDPRAVPGVARLGPDALDLDRAALAQVLA
FT                   TQTGRIKNVLTDQRVIAGVGNAYSDEILHTARLSPFATAAKLSPDELDRLYDALATVLT
FT                   DAVLRSVGGQAARLKGEKRTGLRVHARTGLPCPVCGDVVAEVSFADRSFQYCPTCQTGG
FT                   KKLADRRLSRLVK"
FT   gene            complement(239574..240158)
FT                   /locus_tag="Namu_0211"
FT   CDS_pept        complement(239574..240158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0211"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: pfs:PFLU3678 putative protein-tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76644"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW1"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACV76644.1"
FT                   /translation="MTGFRVLMVCTANHCRSPMAEQMLRDAAARRVGEGVWSVGSAGTH
FT                   IPGPWPLHPHAATVLAARLPAVQPHTSQPLSAAAITAADLILTASRRHRGEVVKTVPSA
FT                   IGRTFTIRQFARLCDAVPPLSTGGADVDRADPGDPGRRLVTEAKLARSSLQPVPGEQED
FT                   LPDPMGGSLADFELCADRLQDAITRILRPLS"
FT   gene            complement(240226..241656)
FT                   /locus_tag="Namu_0212"
FT   CDS_pept        complement(240226..241656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0212"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; KEGG: avi:Avi_2476 soluble
FT                   pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76645"
FT                   /db_xref="GOA:C8XJW2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW2"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACV76645.1"
FT                   /translation="MDSFDLVVIGSGPAGQKAAIAAAKLGHRAAVVDRGHMMGGVCINT
FT                   GTIPSKTLREAVLYLTGLSQRELYGEAYRVKEDITIGDVASRIAHVVNREVDVVRNQLT
FT                   RNHVVVLPGTATFVDPHTIRVAAADGTSRLLRGEKIVIAAGTKPARPDSVDFDGETIVD
FT                   SDQILSIDKVPASMVVVGAGVIGIEYASMFAALGTKVTVVESRATMLPFCDDEIIEALK
FT                   YHLRSLAVTFRFSETVLEVQKHPAGTLTVLQSGKKIPADTVLYSAGRQGVTDELNVQAA
FT                   GVPASNRGKVEVNENFQTEVEHIYAVGDVIGFPALAATAMEQGRRAAYHAFDEPVGKLG
FT                   DLQPIGIYSIPEISFVGRTEGQLTAERVPFEVGVARYRELARGAILGDSYGMLKILVHA
FT                   ESRELLGVHVFGTNATELVHIGQTVMGCGGTVDYLVDAVFNYPTLAESYKVAALDAVNK
FT                   MRAIAKVTQTGVYRPLPE"
FT   gene            241827..242156
FT                   /locus_tag="Namu_0213"
FT   CDS_pept        241827..242156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0213"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: rfr:Rfer_3913 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76646"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW3"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACV76646.1"
FT                   /translation="MSTPIPEVTVDQVPADAVLLDVREDDEWAAGHAPGAVHVPMTQLA
FT                   DRLDDLPDGNPVYVICRSGGRSARATAYLNQQGWDTVNVAGGMGSWARAGRPLEADGDA
FT                   APEVI"
FT   gene            242190..243146
FT                   /locus_tag="Namu_0214"
FT   CDS_pept        242190..243146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Cpsf6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76647"
FT                   /db_xref="GOA:C8XJW4"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76647.1"
FT                   /translation="MSVDRPGAPPVGRATVCPRCRVRQPDNGGDRCAHCGYLRHRWVAH
FT                   PPPGGPPRRSAPPARPPYAGPPSYRGRPPRWAFPPVVWQDADPGPAAPPRRDPSGGLRL
FT                   AAGLAAATAALGLIAAAAEFWRFTLLLQGRTMVLSGATVRASDLFVAAAGAGVVVFGLA
FT                   ALLAAAVAVTRTYPVAARRLGMAPARSSTAVLARLLVPGWNLYGAGQIVTEVDRMLRAK
FT                   DAPADRPWRASRLTIGWWVSWVVSAALMLTALARGLGGSLQAIADTVELHILVDLAGAV
FT                   TAGLGAAMLLRFAGRLRRRPPIPTGWIVQAPAPTRGR"
FT   gene            243187..244143
FT                   /locus_tag="Namu_0215"
FT   CDS_pept        243187..244143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0215"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   mxa:MXAN_5345 preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76648"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW5"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACV76648.1"
FT                   /translation="MSKKNRRAGGTALAENGAQESSPENPRRPCPCGSGRRYKACHGSA
FT                   DAADLIVTRPFAGLAAETELIALREFLPAASAPLTLIEPRADIPSVTVASVLPGAAAAL
FT                   TRSDRSILLGMQVQTHTGDLSRDLAAALEWALAAEPSSVLSVIGRATVGNRYGDLIVDE
FT                   PLDVTVYDDFSWWLEEEIVPGSEVALSLERANAAIMPTARVADLPGAYWVDAGERAHLR
FT                   WVRPEDEPPLMAALARLHVADQLDLGSGSRYVGSFRAHGRLVPVWDLDRDAHPSEWDEP
FT                   ARAFADRLAAALAVDEPLTDAERRARDGILGRQFTLR"
FT   gene            complement(244163..244996)
FT                   /locus_tag="Namu_0216"
FT   CDS_pept        complement(244163..244996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0216"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   dal:Dalk_0566 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76649"
FT                   /db_xref="GOA:C8XJW6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACV76649.1"
FT                   /translation="MTSGAPPNPPPPASIPPGSDPDGFLAARPYTARSLWVELVVVFLI
FT                   TLGTSGLSSLVSLIDSLLAAAPLSSQSVAIVVPQAQASLLDLARQVILIVRGFAWGGLG
FT                   LYLLWRSGVNLRARLGLDLRRPWSDLGVGVVLTAVIGIPGIALYLSAVAIGINLTVAPS
FT                   TLNDVWWRLPVLIGAAIENGFLEEVLVVGYLITRLEQLKLPGWAAIGISAGLRGSYHLY
FT                   QGFGGFLGNAVMGVVFAWWFRRTRRLWPLIIAHSLLDIFSFAGYALLKGSVSWLP"
FT   gene            245178..246437
FT                   /locus_tag="Namu_0217"
FT   CDS_pept        245178..246437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76650"
FT                   /db_xref="GOA:C8XJW7"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76650.1"
FT                   /translation="MGRHKALVAATGVLALVLTACGSSNAADDVTVTSFVTGSPESSAV
FT                   ASEPATSSAAASTSESASASTSASPTATQSGDGTVQEGVAMPSGFVPTKLKDGEKPPQF
FT                   IVVSFDGVGWHEKWQHWFDVGKQVPFHFTGFLSGTYMLSDQTKMAYQGPGHSPGNSSIS
FT                   WNSPADLPVEIQDLNQAIDEGNEIGTHFNGHFCAGAEPSGNQWTTADWNSELDSFFSLV
FT                   KNVKANNPGVQMDDLKLTPDMVKGERTPCLEGKAEELFPALIAHNMSYDSSFTETGISW
FT                   PKKSPQYGIWRLGMATFPINGTGKRQITMDYNFYYTQRNADSKGVTPEESAGDQAQVLA
FT                   TYNDMYNATYNGNRAPLILGNHFNEWNNSAYANALTDFVVSKCGQPDTYCVPFRDLIAW
FT                   MDVQDPAVLAQLQALPAEGA"
FT   sig_peptide     245178..245258
FT                   /locus_tag="Namu_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            246495..247439
FT                   /locus_tag="Namu_0218"
FT   CDS_pept        246495..247439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0218"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ank:AnaeK_2061 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76651"
FT                   /db_xref="GOA:C8XJW8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW8"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACV76651.1"
FT                   /translation="MGQRESTGRQRWAYLGPEGTFTEQASRALAERLTGPIDLAPAGSV
FT                   SLALDEVRTGRADAACVAMESSVEGAVPVTQDELTHGEPLLITAEAYVPVTFDLLVRPG
FT                   TDRSAIRTVGAHPHGHAQIRGWLAAELPAAEAVMTASNAAAAAAVAAGELDAAAAAPVA
FT                   GSRYGLQTLVADVGEVRDAVTRFVLLRRPDRPPAPTGNDRTSLVLSVGNHPGSLLTVLG
FT                   EFASRGINLTRLESRPTRSRMGVYYFLVDADGHLNDPAMADVVAALIRRQALLRWLGSY
FT                   PRAAGVNEVTADFATPDAYRQADDQVRRWQRGG"
FT   gene            247441..248157
FT                   /locus_tag="Namu_0219"
FT   CDS_pept        247441..248157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0219"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bmj:BMULJ_00540
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76652"
FT                   /db_xref="GOA:C8XJW9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJW9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACV76652.1"
FT                   /translation="MRLLLIRHGQTPSNVLGLLDTAPPGPGLTDLGVAQAAALPATLAG
FT                   ERIDLIAASTQPRAQLTAAPLAAERGLTVLVRDGLCEVPAGELEMRGDEPAVRTYLTTV
FT                   REWMSGNLDVPMPGGPSGHQVLSRFDAVVQEVTAVVADRVGDDGTVALFAHGAMLRTWA
FT                   TARGTDAQQRQDLLARFQPLHNTGMIVVNGSADGWRIQTWAGQALGGPRLDDAPADGPA
FT                   GGDPTGSGIPSDYSPR"
FT   gene            248172..248825
FT                   /locus_tag="Namu_0220"
FT   CDS_pept        248172..248825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0220"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76653"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX0"
FT                   /inference="protein motif:PFAM:PF08044"
FT                   /protein_id="ACV76653.1"
FT                   /translation="MSGPAIDPRDLRVSDDERAHVLSLLEKATGRGLIDIDEYTERSGK
FT                   VIAARTRRDLNAVLVDLPGLQIGGRSVGDAVAATTPRTQPSPGYSGAVPHPTGALELLG
FT                   WGSRTFKGYWSVPPLIVIGGTGASTRLDFTQAQLASSTVTVEFRSNYGGAAEFIVPVGS
FT                   TVRVESLQMRGGHVHNKVDPRTGGRGMTLVLTGVKKSGSVSVRHPKGKLRDWLS"
FT   gene            249108..250154
FT                   /locus_tag="Namu_0221"
FT   CDS_pept        249108..250154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0221"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mch:Mchl_5540 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76654"
FT                   /db_xref="GOA:C8XI22"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C8XI22"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACV76654.1"
FT                   /translation="MVGGVDTHKDTHTAAAVDTAGRVLGSAQFPTDAAGYRALLRWLRG
FT                   FGTLLLVGVEGTGVYGAGLARLLAAQGVAMVEVDRPDRKARRWQGKSDPVDAEAAARAA
FT                   LARVRTGLPKQRDGRVEALRALRVARRSAVGHRADVQRQIKALIVTAPESLRAQLRALP
FT                   DRELIKVCADQRPDRAGAGDPGTATKIALRSLARRHRALSVEIADLDELLGPLVAQINP
FT                   GLLALKGIGPDVAGQMLVTAGENADRLTNEAAFAMLCGVAPLPASSGRTTRHRLNRGGD
FT                   RAANSALWRIVITRMATDQRTKNYIARRTAQGLTKPEIIRCLKRYVAREVFLALTSASA
FT                   EKRPAKAA"
FT   gene            complement(250309..251640)
FT                   /locus_tag="Namu_0222"
FT   CDS_pept        complement(250309..251640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0222"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: dac:Daci_0086
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76655"
FT                   /db_xref="GOA:C8XJX2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX2"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACV76655.1"
FT                   /translation="MALGWTPVGIDSPLPVGTPVKPDERLSWPKTIGVGAQHVVAMFGA
FT                   TFVFPIIMGLDPNLAIMMSGVCTILFLLIVSGKVPSYLGTSASFVGAVVAIRAAGGTTA
FT                   NVTGAILVAGATLAIVGIIVHLVGGQAVRRVLPPVVSGAVVMLIGFNLAPVVAGVYWPQ
FT                   DPGVALTVMAFTILAAVAFRGFFSRIAVFLALIFGFVLSWVLDEVLGPITSATGSGEVT
FT                   THMRVDLSGVQDAAWFGLPTLHAPEFQLQFILLALPGVIALIAENTGHVRAVSEMTGQD
FT                   LDPYLGRALFADGFGTALSSAVGGSPTTTYAENIGVMAATRVYSTAAYYVAAIVAILLG
FT                   LIPKFGAIVSATPGGVLGGITVVLYGMIGLLGAKIWIENRVDFGNPVNLVPIAAAIIIG
FT                   IGNVSISFGNDFELSGIALGSIVAIVAYHLARLAAPKRLREPLL"
FT   gene            complement(251823..252776)
FT                   /locus_tag="Namu_0223"
FT   CDS_pept        complement(251823..252776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0223"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mes:Meso_0836 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76656"
FT                   /db_xref="GOA:C8XJX3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX3"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACV76656.1"
FT                   /translation="MPTIAVVGEVVADAVLPPDGISAGVAHLTVHPGGGPANTAVALSR
FT                   LGSTARFAARISGGALGALCRAKLEESLVDLSASESASEPATLAIARLDATGAASYEFY
FT                   TDGTADWAWTDASLARLIDGPFTTHPAPVAVHTGSLALALQPSGQVIENLLARARPQMT
FT                   VSVDPNLRPLLVPVTSYRLWIDRWASLADIVRLSEDDLDLLWPGWTPEQAALHLHACGV
FT                   PLAVVSLGGDGAFASLRGEQLRVPIAPTTLVDTVGAGDSFHGGLLHHLAEAGQLGGRLD
FT                   TLTVDGLRDALTFASRVSAINCSRAGANPPWARELA"
FT   gene            complement(252866..253549)
FT                   /locus_tag="Namu_0224"
FT   CDS_pept        complement(252866..253549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0224"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: bbr:BB2719
FT                   putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76657"
FT                   /db_xref="GOA:C8XJX4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX4"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACV76657.1"
FT                   /translation="MTSSPVAATPTRANTGEVYDQLRADILGGVHRPGGKLKFAELGER
FT                   YGASVSVIREALTRLVEARLVESEPRIGFRVAPLSLPDLCDLTATRIDLESLAVRYAIE
FT                   RGDIAWEADLVAAHHRLDRTPIVAAQGPQRVSDEWELAHAAFHRAVLAGCGSPRLIAMT
FT                   DVLRDGAELYRRWSQPQEPGRDIPAEHRRILQAVLDRDAEAAVHALTEHYQRTAEILER
FT                   AYAGE"
FT   gene            253682..254595
FT                   /pseudo
FT                   /locus_tag="Namu_0225"
FT   gene            254592..255512
FT                   /locus_tag="Namu_0226"
FT   CDS_pept        254592..255512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0226"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rhi:NGR_b04180 putative
FT                   glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76658"
FT                   /db_xref="GOA:C8XJX5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76658.1"
FT                   /translation="MSLHRLTHIEIGVPNVAQTADYYQEFGLSRGADGAFSTTDGGEQL
FT                   RVSHAAARRLVELGVGVDDEDDIARIAAALARAGFAADRPDPRTLEATDPVTRIRATIT
FT                   VQDRLVQPTRSATPYNGPGRVDRSGRAPGVVRTGRVTPRRLGHVVSGTTDLDATVRFLV
FT                   DGLGFKVSDRIGDKGAFLRCSEDHHNFLALQSPVTYLHHSSWQVDDVDDVGRGACAMLE
FT                   DHPERHVWGLGRHHAGSNFFWYLKDPAGNFSEYFSDMDVIPEDEIWEPEVLEGARGLFN
FT                   WGPPPPPSFLKPEDLGALMVGAHSK"
FT   gene            255556..257346
FT                   /locus_tag="Namu_0227"
FT   CDS_pept        255556..257346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0227"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   reu:Reut_B4679 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76659"
FT                   /db_xref="GOA:C8XJX6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX6"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACV76659.1"
FT                   /translation="MNIVTTDVLIVGAGPSGLAMAALLAREGIDAITVTKYGGTAHSPR
FT                   AHITNQRTMEVFRDLGMEADITRVATANDLMGNNVWATSFAGPEIARLLTWGSGPERRT
FT                   DYDLASPCAMGNIPQHVMEPVQLQRALDLGADIRFGMEVVAISQDDEGVTAQVRARETG
FT                   QEFRIHAKYVVGADGGRSLVADQLGFEMDGQMGLGAAVNVWLEADLTKYTAHRPGTLYW
FT                   MSQPGNDFWVGSGTWICVKPWTEWVLLSMYNPDDGEPDLSEAALIHRAQTTIGDPAVDI
FT                   RIKAVSQWSINHVVATRFGRGRAFLVGDAAHRHPPANGLGTNTSIQDSFNLAWKLAHVL
FT                   RGQAGPALLDSYHDERQPVGRQVVDRAMRSVQDMLPISQALGFTHGQSAEDGWASLDEL
FT                   FGATAVGEQRRQRLHAAVQLQNYQFNCHGVELDQRYASTAVIDDGTAWPAPTRDPELYH
FT                   HPTTHPGARLPHAQLELDRQPVSTLDLVGKGRFTLLAGLRGQDWVEAARKVAADLGIPL
FT                   DARIVGPQAEAADVLGRWAQLREITDAGALLVRPDHHIAWRSTGSSDAPAADLDTALRR
FT                   ILARADIPATRAGHDPRSAA"
FT   sig_peptide     255556..255621
FT                   /locus_tag="Namu_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.754 at
FT                   residue 22"
FT   gene            257343..259042
FT                   /pseudo
FT                   /locus_tag="Namu_0228"
FT   gene            259089..259568
FT                   /locus_tag="Namu_0229"
FT   CDS_pept        259089..259568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_00775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76660"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX7"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00775"
FT                   /protein_id="ACV76660.1"
FT                   /translation="MTLSTQTMTDEQRKALILEYFNTFDRGGIRSTGEPILSLFADDCM
FT                   VWFPKWGLAKGVDEVGQMFADLGSTFEWIDHTTSHLNFVFSGGTTVAVEGLTRGRHRDG
FT                   DWQAGRPQWGAGRFCNIFEIWDMKIQRLHIYLDPDYAGRDTDRYPWLARELSAAR"
FT   gene            complement(259571..259918)
FT                   /locus_tag="Namu_0230"
FT   CDS_pept        complement(259571..259918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0230"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   avi:Avi_4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76661"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX8"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACV76661.1"
FT                   /translation="MAVQMSMDAFEDLVAEALDLIPPEFTRAMDNVVVLVEDRHPTQNL
FT                   YGLYHGVALTSRTSSYSGHLPDTITIYRLPILAHAHDEQQAREQVATTVIHEIAHHFGI
FT                   DDDRLDELGWA"
FT   gene            259984..261246
FT                   /locus_tag="Namu_0231"
FT   CDS_pept        259984..261246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0231"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: afr:AFE_0380 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76662"
FT                   /db_xref="GOA:C8XJX9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJX9"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACV76662.1"
FT                   /translation="MIDLRIVRDDPDRVRASQHARGEDSGAVDRLLAADADRRAAVARA
FT                   DSLRAEQKSYGRTIGQASKDERPALLERGKAMAAEVKLAEAAEQEANAALAVAHRSIAN
FT                   IIEGAPPGGEQDYLVVKEVGRPTEFDFTPRDHVELGERLGAIDIERGTKVSGARFYFLR
FT                   GVGAQLQWALLNLAVSTAIGHDFVPMIPPVLVKPEAMEGTGFLGAHADEIYRLEADDMY
FT                   LVGTAEVPLAGYHAGEILDLSAGPLRYAGWSSCFRREAGSYGKDTRGILRVHQFDKVEM
FT                   FVFCKPEDAADQHAQLLSFEEQMLAQMELPYRVIDTAAGDLGSSAARKFDCEAWVPTQQ
FT                   TYRELTSTSNCTTFQARRLGVRYRDEDGKPQVAATLNGTLATTRWLVAILENHQQADGS
FT                   VRVPKALQPGLGGREVLEPIG"
FT   gene            261317..262627
FT                   /locus_tag="Namu_0232"
FT   CDS_pept        261317..262627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0232"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="PFAM: protein of unknown function DUF1254; protein
FT                   of unknown function DUF1214; KEGG: nha:Nham_1253
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76663"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY0"
FT                   /inference="protein motif:PFAM:PF06863"
FT                   /protein_id="ACV76663.1"
FT                   /translation="MSILASDLRTVSHEAYIYLYPLVTMEVTRQQLANIPPGTREGFGP
FT                   PNQFHHLRTFPDADFRAVVRPNFDTLYSSAWLDLTRGPVVVEVPDSDDRYYMMPMLDMW
FT                   TDVFANPGKRTTGTGAQTFVVTAPGYTGDLPAGATPIAAPTPHVWVIGRTQTNGPADYA
FT                   AVNAFQDGLRITELAGPSTFVIDESVDTTTEPLRLVDAMSAAEFFTLAARTMAVNPPHR
FT                   SDFSQVARMSLLGVAPGVDFDAGRFDAAELAEIEAGAKAAQAALHAGVARLAAPVNGWT
FT                   MLTDTMGVYGNEYFRRAVITLVGLGANPAQDAVYPLLVADADGKPTVGDHDYVIHFDAD
FT                   QLPPAQAFWSITMYDAEGFQAPNELDRFAIGDRDPLVFNPDGSLDIYMQHGDPGPHRRA
FT                   NWLPAPTGPVGITMRLYAPAPAVLDGTWHPPAVRRVK"
FT   gene            complement(262654..263043)
FT                   /locus_tag="Namu_0233"
FT   CDS_pept        complement(262654..263043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0233"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bam:Bamb_1478
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76664"
FT                   /db_xref="GOA:C8XJY1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76664.1"
FT                   /translation="MAKDLFPIINVAAIEPVRAFYERVFGGTLAYRFPPEGDPVYLTLR
FT                   IGTGQLAIGVGTGPAMYGQVPLPATGHAVDICLYVGDLDAARAAAPEAGGQVVVPAQDT
FT                   PWGERVAYLRDPQGTMLLVIQDTDG"
FT   gene            complement(263062..264339)
FT                   /locus_tag="Namu_0234"
FT   CDS_pept        complement(263062..264339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0234"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   rsq:Rsph17025_4282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76665"
FT                   /db_xref="GOA:C8XJY2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY2"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACV76665.1"
FT                   /translation="MGIWLNLLVVLLLLIIGGLFTATELALVSLRPGELADLRAQGPRG
FT                   ARVARLAGQPTRFLGAVQIGSIVAGFFAAAYATATLAEPLGAAMGRAGLGEDGGETLAV
FT                   LIVTLATTFLALIMAELTPRRYAMQRPQSVAALLGPILDRLATLLRPVIWLLEKCTNGL
FT                   LRLLRVDPKDSRAEMSVEEVRELVLAHEEVPDQEKQIIRQVFAAGERTIRQAMVPRAAI
FT                   DFLSTAATGAQARRAAWEHTHTRYPVLDEAGQVAGFLHVRDLFAPELDPGAPIRDLVRP
FT                   ISAYPPNKKLLAVLREMQTGAENIAAVVDEYGQLKGMVTLEDVVEELVGEMYDEYDRIP
FT                   TATPGDATVVDGLTGLSDFGRRLGFELPAGRYDTVGGYLQAALDRTPRAGDAVEVAGHR
FT                   LTVSSVAGWRVGQVTVEPLSTPVQPD"
FT   sig_peptide     complement(264274..264339)
FT                   /locus_tag="Namu_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.568 at
FT                   residue 22"
FT   gene            264475..265803
FT                   /locus_tag="Namu_0235"
FT   CDS_pept        264475..265803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0235"
FT                   /product="allantoinase"
FT                   /note="TIGRFAM: allantoinase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: scl:sce5876 allantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76666"
FT                   /db_xref="GOA:C8XJY3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY3"
FT                   /inference="protein motif:TFAM:TIGR03178"
FT                   /protein_id="ACV76666.1"
FT                   /translation="MELVVHAPRALVDGREQAVSVAVRLGRIVGLAPLGTAPPSRLVAT
FT                   LTDDEVLIPGLVDTHVHINEPGRTEWEGFDTATAAAAAAGVTTLIDMPLNSLPPTLNAA
FT                   ALATKRAAARGRCRVDVGFWGGCVPTNLADLPELFAAGVFGVKCFLQDSGVPEFPPVTT
FT                   AEMRAAMRTIAEVGGLLLVHAEDPGVLHTSPTPQGRDYQAFVASRPEAAETAAVQACIE
FT                   AAAITRCRTHIVHLSSAGGVALIRRAKADGVPITAETCPHYLVFDAEDIPDGSPQYKCC
FT                   PPIRGRADQEALWAGLADGTIDIVVSDHSPSTAELKLLEVGDLGLAWGGIGGLQFGFAA
FT                   VWAEANRRGVPLADVVRWMSTGPATLAGLDHKGRLEVGADADLVILAEAETFTVTDGMI
FT                   RHRNRITPYLGRELRGVVRARWLRGTELSDDLVAGRLISHEPG"
FT   gene            265887..266969
FT                   /locus_tag="Namu_0236"
FT   CDS_pept        265887..266969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0236"
FT                   /product="allantoicase"
FT                   /EC_number="3.5.3.4"
FT                   /note="KEGG: scl:sce5877 putative bifunctional
FT                   allantoicase/OHCU decarboxylase; TIGRFAM: allantoicase;
FT                   PFAM: Allantoicase region"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76667"
FT                   /db_xref="GOA:C8XJY4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY4"
FT                   /inference="protein motif:TFAM:TIGR03163"
FT                   /protein_id="ACV76667.1"
FT                   /translation="MKRTDLNLASRALGASVRYVSDEFFAPCEALLMPGAPVHDVSTFG
FT                   PHGKIYDGWETRRRRTPGHDWAVVALGVPGVLHEIVVDTAFFRGNYPPEVSMEATWLDG
FT                   APDRAALDAAEWTTIVPISAARGDTANTYRVYNSQAFTHVRLNIYPDGGVARLRVLGTA
FT                   VPDPRVLGDRIDLAAIHHGGDIAECSDMFYSDARHVLYPGIAESMADGWETARRRTAGN
FT                   DYLVVTLAGPAELEFVTIDTGYFLGNAPGRVRLSARRTDTSAWREIVPERAISPDARNR
FT                   FRVLADRQVTAVRVDVYPDGGFSRLHLMGKLLPEALSRAIAHWLERLPKSASATVLAEA
FT                   GLGGIPLGELREDQLLTLAW"
FT   gene            266987..267328
FT                   /locus_tag="Namu_0237"
FT   CDS_pept        266987..267328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0237"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="TIGRFAM: hydroxyisourate hydrolase; PFAM:
FT                   Transthyretin; KEGG: sew:SeSA_A1161 hydroxyisourate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76668"
FT                   /db_xref="GOA:C8XJY5"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY5"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ACV76668.1"
FT                   /translation="MTIVRLSTHVLDTTVGRPAGGIPANLESLTPEGVSEVGRGRTDDD
FT                   GRVFQLNATGLAPGRYRLTLETEDYFRARHGAVFYPSIAVSFELSGDRDHYHIAVLTST
FT                   YSYSTYLGS"
FT   gene            267405..268298
FT                   /locus_tag="Namu_0238"
FT   CDS_pept        267405..268298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0238"
FT                   /product="urate oxidase"
FT                   /EC_number="1.7.3.3"
FT                   /note="KEGG: scl:sce4023 putative uricase; TIGRFAM: urate
FT                   oxidase; PFAM: Uricase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76669"
FT                   /db_xref="GOA:C8XJY6"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="InterPro:IPR019842"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY6"
FT                   /inference="protein motif:TFAM:TIGR03383"
FT                   /protein_id="ACV76669.1"
FT                   /translation="MAIVLGKNQYGKAEVRMVYVDRSTPVHAITDVNVTSQLIGDFTDT
FT                   HLTGANDAVIATDTQKNTVYAMARTGGVGSPEEFALRLARNYVDKYEQVTGARMAVEQY
FT                   SWDRIVTAAGPHDHAFSKGTAETRTAVVRKDGAAETVISGLTGLVVLKSTGSEFWGFPE
FT                   VEYTSLVETNDRILATAVTARWLYTTSELDWDAAFTAVRGALLENFANTHSLSLQQTLY
FT                   AMGKGALEAVPEIAEIRLSLPNKHHFLVDLDKWDLDNPNQVFYAADRPYGLIEAAILRD
FT                   DAEVPDGAWEGIAAFI"
FT   gene            complement(268321..268587)
FT                   /locus_tag="Namu_0239"
FT   CDS_pept        complement(268321..268587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76670"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76670.1"
FT                   /translation="MATLTMTAPDLTDLSIETTGADTVLAVHFEQPRPARDARRIAQYL
FT                   TALRMPGVEGVDAIDTTVVVSFDPGTMTRSHLELLIQDAARHL"
FT   gene            complement(268707..269126)
FT                   /locus_tag="Namu_0240"
FT   CDS_pept        complement(268707..269126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0240"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mlo:mll4282 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76671"
FT                   /db_xref="GOA:C8XJY8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY8"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACV76671.1"
FT                   /translation="MTVVYQTTATSTGEGRNGRSRTDDGVLDLALTTPRPGAGPGDPTN
FT                   PEQLFAAGYAACFHSALKNLAKAAGVDATDSSVSVQIGLVKGEDGFHLAAAITGELPRA
FT                   DRAAAADLLEQAHQRCPYSKAIRGNVEVTLSVRDA"
FT   gene            complement(269148..269981)
FT                   /locus_tag="Namu_0241"
FT   CDS_pept        complement(269148..269981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0241"
FT                   /product="allantoin catabolism protein"
FT                   /note="TIGRFAM: allantoin catabolism protein; PFAM: protein
FT                   of unknown function DUF861 cupin_3; Cupin 2 conserved
FT                   barrel domain protein; KEGG: bmj:BMULJ_05196 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76672"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJY9"
FT                   /inference="protein motif:TFAM:TIGR03214"
FT                   /protein_id="ACV76672.1"
FT                   /translation="MNFNTYYAPTGGLPAQTELTTNRAVFTEAYAVLPRGTMRDIVTSF
FT                   LPFWTNTRLWVIARPLSGFAETFSQYIVEVSPGGGSDRPETDPNAETVLFLMEGELVVT
FT                   VDGDKHEMTSGGYGFIPPGADWTIHHRGDAPARFHWIRKAYQRVEGLDLPTAFFTSDEQ
FT                   VEGVEMPGTNGAWVTQRFADPTDLRHDMHVNIVTFQPGGAITFPETHVMEHGLYVLEGK
FT                   AVYLLNQDWVEVQEGDFMWLRAFCPQACYAGGPGRFRYLLYKDVNRHATLSRQFA"
FT   gene            complement(269992..271359)
FT                   /pseudo
FT                   /locus_tag="Namu_0242"
FT   gene            complement(271415..272548)
FT                   /locus_tag="Namu_0243"
FT   CDS_pept        complement(271415..272548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0243"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="KEGG: bbr:BB4099 glycerate kinase; TIGRFAM:
FT                   glycerate kinase; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76673"
FT                   /db_xref="GOA:C8XJZ0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ0"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ACV76673.1"
FT                   /translation="MKVLVAPDKFKGSMRASDVAAHVAAGIRAGAPGTEVLAVPVADGG
FT                   DGTLDAAVAAGFHLVPVTAAGPTGQPVSTGYARQDRTAVVELADACGLVRLPGGVLAPL
FT                   TASSVGVGQVIAAALDAGCRRLVLAIGGSASTDGGAGMLTALGARILDADGQPVPDGGG
FT                   GLEHVAAVDLTGLHPALAETDVVLASDVDNPLLGDHGAAAVYGPQKGATPDDVARLDGA
FT                   LRVWSGALARALGVAEGPNGHPAAEVAGAGAAGGVGFAAVAVLHATARPGIELMLELSG
FT                   FATQLGGADLVVTGEGSLDEQTLHGKAPAGVAAAARAAGVPVVAVAGRNLLSTDQLTAA
FT                   GVRQAYALTDIESDVQRCIDDPGPLLERLGRRIADSL"
FT   gene            complement(272563..274368)
FT                   /locus_tag="Namu_0244"
FT   CDS_pept        complement(272563..274368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0244"
FT                   /product="glyoxylate carboligase"
FT                   /note="TIGRFAM: glyoxylate carboligase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; thiamine
FT                   pyrophosphate protein domain protein TPP-binding; thiamine
FT                   pyrophosphate protein central region; KEGG: tmz:Tmz1t_1299
FT                   glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76674"
FT                   /db_xref="GOA:C8XJZ1"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ1"
FT                   /inference="protein motif:TFAM:TIGR01504"
FT                   /protein_id="ACV76674.1"
FT                   /translation="MPTMRAVDAAVAILEKEGVDTLFGLPGAAINPFYSALRKHGGMKH
FT                   ILARHVEGASHMAEGYTRAKAGNIGVCVGTSGPAGTDMITGLYSASADSIPILCITGQA
FT                   PVARLHKEDFQAINIADIAKPLTKMAMTVLEPAQVPGAFQQAFHLMRSGRPGPVLIDLP
FT                   FDVQMAQIEFDPDTYEPLPIYRPRATKAQAAKALDMLAASERPVIVAGGGIINADASDL
FT                   LVELAELLDVPVIPTLMGWGTIPDDHRLMAGMAGLQTSHQYGNATILASDFVFGIGNRW
FT                   ANRHTGGLDTYRAGRTFVHVDIEPTQIGRVFAPDYGIVSDAGAALEQLVAIARERKAAG
FT                   ELADRSQWVADCQERKRTLHRRTHFENIPIKPQRVYEEMNKAFGPDTRYVSTIGLSQIA
FT                   AAQFLHVYKPRHWINAGQAGPLGWTLPATLGVCVADPDATVVALSGDYDFQFMMEELAV
FT                   GAQFNLPYIHVLVNNAYLGLIRQSQRGFEMDYHVQLSFDNINTESTADDGTDNPIKGYG
FT                   VDHVKLAEAMGAKAIRVHDPEELLPALETAKKMLVEHRVPVVVEVVLERVTNISMGVEI
FT                   DNVVEFEELALTSADAPTAIISMLD"
FT   gene            complement(274379..275293)
FT                   /locus_tag="Namu_0245"
FT   CDS_pept        complement(274379..275293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0245"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /note="TIGRFAM: 2-hydroxy-3-oxopropionate reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase; NADP oxidoreductase
FT                   coenzyme F420-dependent; 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding; KEGG: mrd:Mrad2831_1777
FT                   2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76675"
FT                   /db_xref="GOA:C8XJZ2"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ2"
FT                   /inference="protein motif:TFAM:TIGR01505"
FT                   /protein_id="ACV76675.1"
FT                   /translation="MTTVAFIGLGIMGGPMAGHLVNAGFDVVGYNRSQAKVDALVAAGG
FT                   KGATSIADAVREADVVAIMVPDSPDVRQVLAGSDGTDGVFQNAKPGTLIIDFSSIRPDV
FT                   TTELAAQAKEQGFRLLDAPVSGGEAGAKNAALSIMVGGEKDDFDAAADVFNAVGKTVVH
FT                   VGPNGAGQTVKAANQLIVAGNIQLLAEAVAFVEAYGVDTEAALKVLGGGLAGSKVLDQK
FT                   GANMLGRTFNPGFRIELHHKDLGIVTSAAREAGVVIPLGAVVAQLMASAVANGDGGLDH
FT                   SALLRGVLRLSGQNPDSPSDSAS"
FT   gene            complement(275578..276411)
FT                   /locus_tag="Namu_0246"
FT   CDS_pept        complement(275578..276411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0246"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mpo:Mpop_4719 hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76676"
FT                   /db_xref="GOA:C8XJZ3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ3"
FT                   /inference="protein motif:PRIAM:5.3.1.22"
FT                   /protein_id="ACV76676.1"
FT                   /translation="MTTESPRYAVNLSMLFTELPLLQRPAAAKEAGFDAVEFWWPFSSA
FT                   VPADSQVDEFVAAVDEAGVQLIGLNFFAGDMPSGDRGLVSWPARSAEFRDNIDVTVGIG
FT                   ERLGCRAFNALYGNRTDESTPVAQDEVAAENLALAARAAARIDGIVLVEPVSGAPRYPL
FT                   LTAADVIRVIDRVEAASGVGNVKFLCDLYHLDVNGDDVAAAIEAYADRVGHVQIADSPG
FT                   RGEPGTGTLDIDGHLAALAAHGYRGYVALEYKPTAGTLEGLSWLPSAARSSATRV"
FT   gene            complement(276447..277736)
FT                   /locus_tag="Namu_0247"
FT   CDS_pept        complement(276447..277736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0247"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76677"
FT                   /db_xref="GOA:C8XJZ4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ4"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6823"
FT                   /protein_id="ACV76677.1"
FT                   /translation="MSGPETPSTTALSASFLDRLDDELAAADTQLSGHYPGDPGTRQPV
FT                   HTVYVNADLADEQLLARWAAGAREVLAVTAPDPSAAAALALPVADDDLAAALALVRAKL
FT                   DTEPIEDLRLDFEDGYGNRPDDEEDRDAIRVAALLPTLLGDPAGPLLAGIRFKSLEKPT
FT                   RRRGLRTLDLVVSGLLAAGPLPAGFLVTLPKVTSVDQVTAMVGICEELERVHGLPPGAL
FT                   RFEIQIETTQAILGADGTATVAGMIGAAGPRCVALHYGTFDYSAACGVAASQQSLAHPV
FT                   ADHAKAVMQVAAAGTGVRLSDGSTNVMPVGSPEQIRAAVVLHAGLVTRSLRAAYYQGWD
FT                   MHPGHLVSRYLATYAFYRQGLPAAAARLRAYLNKQSGGVVDEPATAQALAAFLMRGVHC
FT                   GAIDDDEVFEQAGVRRDTLDAMARRKPLPA"
FT   gene            complement(277914..279536)
FT                   /locus_tag="Namu_0248"
FT   CDS_pept        complement(277914..279536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0248"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: scl:sce8725 malate synthase; TIGRFAM: malate
FT                   synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76678"
FT                   /db_xref="GOA:C8XJZ5"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ5"
FT                   /inference="protein motif:TFAM:TIGR01344"
FT                   /protein_id="ACV76678.1"
FT                   /translation="MGVTLNGPEIARADEILTPDAVAFVADLHRRFAGRRDELLAERTR
FT                   RRERAARSGRLDVRPETAGIRAADWTVAAAPADLVDRRVEITGPPEPKMAINALNSGAR
FT                   VWLADLEDANTPHWRNVVGGQLVLFDAIRGTLAFDSPDGRPYRLATDRRLATIVARPRG
FT                   WHFDERHLLVDGEPAVGALVDFGLYFFHNAAELLARGSGPYFYLPKMESHLEARLWNDV
FT                   FTHAQAELGIAHGTIRATVLIETIPAAFEMDEILYELREHASGLNAGRWDYLFSVIKYF
FT                   RDAGPTFVLPDRGSVTMTAPMMRAYTDLLVATCHRRGAFAMGGMAAFIPSRRDPEVNRA
FT                   ALAKVRADKEREAGDGFDGSWVAHPDLVPVCAEVFDAVLGDRPNQLDRRRDDVQVTADQ
FT                   LLDVTSVPGSITEAGLRGNIDVALRYLEAWLGGNGAVGIHNLMEDAATAEISRSQVWQW
FT                   VHHGVQLDTGLTVTAELVCRIADEELAAIAAELGSQTYAASQYPLARSVFEQVALADEF
FT                   ADFLTLPAYAAAHDAELAASRQA"
FT   gene            complement(279536..280999)
FT                   /locus_tag="Namu_0249"
FT   CDS_pept        complement(279536..280999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0249"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: xanthine permease; uracil-xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease;
FT                   Benzoate membrane transport protein; KEGG: ppu:PP_4643
FT                   xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76679"
FT                   /db_xref="GOA:C8XJZ6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ6"
FT                   /inference="protein motif:TFAM:TIGR03173"
FT                   /protein_id="ACV76679.1"
FT                   /translation="MAHQPESFAGQQGVELLPDGKHPVDEVLKPGPMILFGLQHVMSMY
FT                   AGVVAVPFIVGSALGLSFADLSYLLAATLLVSGLATLLQTLGVKWIGAKLPIVQGTSFA
FT                   AVASMIAVGASAGGGVDGLRAIFGSVLIAGLAGFLLSGVFARLLRFFPPVVTGSIITVI
FT                   GISLLPVAMRWAGGGAGSADFGSISNITLAAITLGIILVIYRFLPGFFSRIAIIAGLVA
FT                   GGVVAALMGKLDFSKVGQAQAFAISTPFHFGTPTFQVAAIISMVIVMLVIMTETTADLL
FT                   AIGVVVGREADRKTVANGLRADCISTAASGGLLNGFPVSAFAQNVGLVALTGIRSRFVV
FT                   AVSGGILLVLGLFPQVGAVVAALPLPVLGGAGLALFGTVAASGIRSLAAVKYDGNSNLV
FT                   IVALAIAAGLTPIAVPEFYHSFPEWFQTIFDSGISASAVTAVTLNIFFNVLGRKDDAAP
FT                   IFAESPAIGVSPDEQPGGHLPGDPRKGSH"
FT   gene            complement(281008..281916)
FT                   /locus_tag="Namu_0250"
FT   CDS_pept        complement(281008..281916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0250"
FT                   /product="urate oxidase"
FT                   /EC_number="1.7.3.3"
FT                   /note="KEGG: scl:sce4023 putative uricase; TIGRFAM: urate
FT                   oxidase; PFAM: Uricase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76680"
FT                   /db_xref="GOA:C8XJZ7"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ7"
FT                   /inference="protein motif:TFAM:TIGR03383"
FT                   /protein_id="ACV76680.1"
FT                   /translation="MSVTLGHNQYGKAETRVVRVYRDSDPHEIVDYNVSVALSGDFEEI
FT                   HRTGDNSNCLTTDATKNTVNAFAKEYSEAARQPESFGIALAKHFVDDTAPVTRARIKLE
FT                   MYPWNRLSHDGTPHPHAFARDGGYVRTATVTYDGTNLWVVSGVQDYVVLKTTDSEFWGY
FT                   LQDKYTTLKPTHDRVMATSVTGQWWHTDSEADWAKSYDSAVATMSSVFAGHHSLALQQT
FT                   MFAMGEAMIAEQPEIGEVRFSLPNKHHFVIDLSPYGLENPNEVFHADDRPYGFIEGTIH
FT                   NDLHKDAAPAPNQAFDPGQGW"
FT   gene            complement(281923..282279)
FT                   /locus_tag="Namu_0251"
FT   CDS_pept        complement(281923..282279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0251"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="TIGRFAM: hydroxyisourate hydrolase; PFAM:
FT                   Transthyretin; KEGG: AGAP000415-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76681"
FT                   /db_xref="GOA:C8XJZ8"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ8"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ACV76681.1"
FT                   /translation="MSLSTHVLDASLGRPAQGVPIQLRAQGDAGAATPFGTTIFTAVTD
FT                   ADGRYRHQQSGADLPLAAGIYDLQFDTTAYFTATGQTGFYPRVTVTFEITDPAAHHHVP
FT                   LLLSPFAFSTYRGS"
FT   gene            282439..282921
FT                   /locus_tag="Namu_0252"
FT   CDS_pept        282439..282921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0252"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: mrd:Mrad2831_1370 hemerythrin HHE cation binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76682"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJZ9"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACV76682.1"
FT                   /translation="MESARMIAWSAQLRRVHQRLTDALAIARESIESSEPIDAREAVEQ
FT                   LADPLIYCWGLCSALDGHHEAEDGALFPRLRERHPELAPVLDNLTRDHRMIAHLLGELR
FT                   RAMAAGDPPEDLRRHLDGIEAIMTTHVRYEEKRLGAVLDGLDLGPTAPETLFGPLA"
FT   gene            282965..283747
FT                   /locus_tag="Namu_0253"
FT   CDS_pept        282965..283747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0253"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; Ion transport
FT                   protein; KEGG: vcj:VCD_000055 possible potassium channel
FT                   VIC family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76683"
FT                   /db_xref="GOA:C8XK00"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK00"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ACV76683.1"
FT                   /translation="MGTSDLDVQTPAFQAWTRAMEWPLMAVAVLFGVVYAYQVLAEPQG
FT                   ALLLATRVVSLLCWLVFAIDYVVRLWLATNRRRWFVRNILSLLVVTLPMLRPLRLVRLL
FT                   TLFTVFQRAAGTALRGRVVTYAAVTTTLLVFVASLAVFDAERYAPGALITTYGEAVWWA
FT                   CVTITTVGYGDAYPVTMEGRCIAVGMMICGIALVGTVTATIASWLVERVTSEEEAGQAA
FT                   TTAHIQLLADKIDRLEGLLSQAAADGQPRGTSRGEIVT"
FT   gene            complement(283708..284472)
FT                   /locus_tag="Namu_0254"
FT   CDS_pept        complement(283708..284472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0254"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   mxa:MXAN_2996 GDSL-like lipase/acylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76684"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK01"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACV76684.1"
FT                   /translation="MPVRYVAIGDSFTEGVGDERADGSVRGWADRVAEGLAQATQEPVQ
FT                   YANLAIRGRKLGPIVDQQLEAALALEPTLMTYNGGGNDIMRRHVDMGRLMELSRHVVDR
FT                   CRAAGVRLIVLAGPDPTSRIPLGQVVHHRGEALTADIVALTDEFGLTFVDMWHDQEIRR
FT                   AGYWGADRIHLNAAGHRRVAGQVLAALGHPAPATTTRVEDPHRSVSDNLLFYRQHVGPW
FT                   LRRRLQGRSSGDHRTAKHPDYVTISPREVPRG"
FT   gene            complement(284534..285310)
FT                   /locus_tag="Namu_0255"
FT   CDS_pept        complement(284534..285310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0255"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mxa:MXAN_0220
FT                   alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76685"
FT                   /db_xref="GOA:C8XK02"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK02"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76685.1"
FT                   /translation="MSELESYSWGETSNPTIVLLHGLSDAGTTWPDAVRRWQGRYHLIA
FT                   VDLRGHGRSPRFAPDQLTRCYDWWLSDTLDVLSTLDSAPVVVGHSLGGLFALRAAAARP
FT                   ELVRGLVLEDPARPPGATTPDPEFVAMNEAFLDSFADGGRAQRDRMRAESRWAVEEIDE
FT                   RAASKPLVDRAMIHDGLILGDGTWEPVFNGLTVPTLLVAPTDSPMAPDPALITNPLARQ
FT                   VRLDGVGHTVRRDDAPAYHAVVDPFLAAITAGSPAP"
FT   gene            complement(285358..286677)
FT                   /locus_tag="Namu_0256"
FT   CDS_pept        complement(285358..286677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0256"
FT                   /product="guanine deaminase"
FT                   /note="TIGRFAM: guanine deaminase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: pst:PSPTO_3663 guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76686"
FT                   /db_xref="GOA:C8XK03"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK03"
FT                   /inference="protein motif:TFAM:TIGR03179"
FT                   /protein_id="ACV76686.1"
FT                   /translation="MTLYRATIVDTPGDPFAGDPADALATDPDGGLLVIDGVIRERGPF
FT                   AALRADHPDEPLVELTGGLLLPGFVDTHVHYPQLRAIGGLGMPLLDWLEQCALPEESRL
FT                   AEPEYAAPLAQEFVSELIAHGTTTALVFGSHFESAMDILFAAGQDAGLNLTTGLVLSDR
FT                   ILRPDLLCSPADALAASQRLIDRWHGKGRLRYAVTPRFSLSTTDEMLEVCRQLLGPGSD
FT                   RDAHAADIWFTSHVNENLAEVQTVADLFPGTAHYIDTYHRHGLVTDRSVFAHNVHPTDH
FT                   ELDLMAQAGAWAAHCPTSNSALGSGLFPLARHVRHGVGVALGSDVGAGTGLFLPKEGLQ
FT                   AYFMQQLLGAQGLPLTPVHLLYLATHAGARALGLADRVGTLTVGRDFDAVWLRPEPSSS
FT                   LGINLRQAADPTDALARVFALSTPHDVAGVWLRGEPAYTR"
FT   gene            complement(286674..287552)
FT                   /locus_tag="Namu_0257"
FT   CDS_pept        complement(286674..287552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0257"
FT                   /product="xanthine dehydrogenase accessory protein XdhC"
FT                   /note="TIGRFAM: xanthine dehydrogenase accessory protein
FT                   XdhC; PFAM: protein of unknown function DUF182; KEGG:
FT                   avn:Avin_22270 xanthine dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76687"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK04"
FT                   /inference="protein motif:TFAM:TIGR02964"
FT                   /protein_id="ACV76687.1"
FT                   /translation="MDWLDALTQLRREGSPAVLVTVVAVRGHAPREAGAKMVVGSEHSW
FT                   GSVGGGNLEESAIRRARELIADGAGEPETQLHRLNEHARNRHGRQCCGGEVTLVLEPMP
FT                   ARPTVAIFGLGHVGYELARILSRLELRLELVDSRADQLEPLRLAEITDGAADVGVHHLV
FT                   LGEQILERLPRGAHVLIMSHDHAEDFALCDAALRLPHLGSIGLIGSSAKWSGFRRRLAE
FT                   QGHSAQTIDRIRCPIGRPEISGKQPAVIAVSVAAALLPTLTAPAGAASSGSAPSGSAGT
FT                   SAARTISGVPS"
FT   gene            complement(287552..289966)
FT                   /locus_tag="Namu_0258"
FT   CDS_pept        complement(287552..289966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0258"
FT                   /product="xanthine dehydrogenase, molybdopterin binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="KEGG: mxa:MXAN_3143 putative xanthine dehydrogenase;
FT                   TIGRFAM: xanthine dehydrogenase, molybdopterin binding
FT                   subunit; PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76688"
FT                   /db_xref="GOA:C8XK05"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK05"
FT                   /inference="protein motif:TFAM:TIGR02965"
FT                   /protein_id="ACV76688.1"
FT                   /translation="MSFAHGPLADRPNNPKVGLPLPHEAASLHVTGKALYTDDLIHRTP
FT                   NLLHAWPLQAPHAHARVTTFDVTPAYDVPGVVRVLTAQDVPGVNDAGIKHDEPLFPTEI
FT                   MFYGHAVCYVLGETEDAARLGAEAIVVEYEPLPSLMTIPEAIAAESFQGAQRTVSRGDA
FT                   DAGLAASTHRFSGEFSFGGQEHFYLETNAALALVDEAGQVFVQSSTQHPSETQEIVAHV
FT                   LGRPSHEITVQCLRLGGGFGGKEMQPHGFAAVAALGATITGRPVLLRLNRTQDITMTGK
FT                   RHPFHASWEIGFDADLRIRALKATLTSDGGWSLDLSEPVLARALCHIDNAYWIPDIEAH
FT                   GRIAKTNKTSQTAFRGFGGPQGMIVIEDILGRCAPQLGIAPEELRRRNFYSPGQPTPYG
FT                   QPVRHAERLAAIWQTLSDKASVAQRQEQIAAFNAGHHDSKRALAITPVKFGISFNLTAF
FT                   NQAGALVHVYKDGSVLINHGGVEMGQGLHTKMIQVAATALGVPLSYVRLAPTRTDKVPN
FT                   TSATAASSGADINGGAVKNACDQIRERLATVAAGQLGIHPDDVRFVDGVVTGIGFHDKQ
FT                   IEWAKLTHDAYFQRVQLWAAGFYRTAGLHWDANRMQGEPFKYFAYGAACAEVEVDGFTG
FT                   AYRLLRADIVHDVGDSLSPLIDVGQIEGGFVQGTGWLTLEELRWDTSDGPHRGRLNTQA
FT                   ASTYKIPSFSEMPEEFHVHLFERATESGVVYGSKAVGEPPLMEAFAVREALRAAVAQFG
FT                   PAGYPVDLGSPATPEAVYWAIDAARTAGTAGTNGATGRPTTDASAQELAGV"
FT   gene            complement(289963..291507)
FT                   /locus_tag="Namu_0259"
FT   CDS_pept        complement(289963..291507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0259"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; [2Fe-
FT                   2S]-binding domain protein; CO dehydrogenase flavoprotein
FT                   domain protein; KEGG: mxa:MXAN_3143 putative xanthine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76689"
FT                   /db_xref="GOA:C8XK06"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK06"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACV76689.1"
FT                   /translation="MEPHVVVNGRARPLGEVGGHTTLLEWLRSTGYTGCKEGCAEGECG
FT                   ACAVLVARPAEATGANGSATTRWTAINACLVPAAGFDAQEVVTSEGLGDPERLHPVQEQ
FT                   MAVRGGSQCGYCTPGFICSMAAEYYRADRSPADAEAEAATAEPGTNGHSRAEAGADPAA
FT                   PGHAPDHEHGPNGFDLHALSGNLCRCTGYRPIRDAAYALGSPDESDALAQRRSAPAPAP
FT                   APTVITTGGTAYRRPADLAQALELLAQHPDARLVAGSTDWGVELNIRHVRAELTIALDR
FT                   VAELRTFSVQPDRIEIGAALTLSEVERLLDGRVPLLAELFPQFASRLIRNGATLGGNLG
FT                   TGSPIGDSPPALLALDASLVLASAAGERTVPLSEYFTGYRQTVKRPDELIKTITLPLPV
FT                   APISAFHKIAKRRFDDISSVAIAFALRLDGDTVSDIKIGLGGVAAMPIRASATEAALTG
FT                   RPWTPKVAAEAARVLADEGTPISDHRASAAYRTAMLGTSLRKFHAQNANAGKVGAK"
FT   gene            complement(291570..292931)
FT                   /locus_tag="Namu_0260"
FT   CDS_pept        complement(291570..292931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0260"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   ppg:PputGB1_3262 hydroxydechloroatrazine
FT                   ethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76690"
FT                   /db_xref="GOA:C8XK07"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK07"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACV76690.1"
FT                   /translation="MTTLVLQGAHVATVDGSATEYRNGHVVVTDGLITAVGNGPAVPGA
FT                   ADARILDATGCLITPGFVNTHHHLYQWITRGLAVDDTLFGWLTTLYPVWGQIDAELVNV
FT                   AATGGLSWLAGTGCTTTTDHHYVFPRDGGDVLKAEIDAAARVGLRFHPTRGSMDLGRSK
FT                   GGLPPDNVVEDIDAILAATEEAIDTHHDPSFGSMLRIGVAPCSPFSVTGDLLRQTAELS
FT                   RRKGVRMHTHLCETLDEEQYCQEHFGCSPVEYMESVGWLGPEVWLAHSVWLTDDSIASL
FT                   ARTGTSVAHCPTSNARLGSGIARARDLRDAGVAVGLGVDGAASNEACALLEEARHALLF
FT                   ARAKGGPQALTVRDALDMATMGGARVLGRQDEIGSLEVGKLADIAVWRLDTLPHIDIVD
FT                   PIAALVLGAPPPLELLLVGGRPIVEQGRLSTVDTDRYATEVRDASKKLLARAGI"
FT   gene            complement(292976..295453)
FT                   /locus_tag="Namu_0261"
FT   CDS_pept        complement(292976..295453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0261"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: xanthine permease; uracil-xanthine
FT                   permease; OHCU decarboxylase; PFAM: Xanthine/uracil/vitamin
FT                   C permease; KEGG: mms:mma_0512 xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76691"
FT                   /db_xref="GOA:C8XK08"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="InterPro:IPR017595"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK08"
FT                   /inference="protein motif:TFAM:TIGR03173"
FT                   /protein_id="ACV76691.1"
FT                   /translation="MASAPTASTPARTKSVKHPVDQVLPIPKLAVYGIQHVLAFYAGAV
FT                   VVPILLASAIGLTTEELIHLINADLFTCGIASIIQSVGFWKIGVRLPLLQGVTFTAVSP
FT                   MIAIAMAAGGGTEGLLYIYGAVIIAGLFTFFMAPYFARLIRFFPPVVTGTVITIIGIAL
FT                   LPVAALDAVGGGANPDPTSTKNLAYALGTLFVIVLIQRIFKGFLATVAVLAGLVIGTAV
FT                   AFFLGDASFSSLSESAWFGVTTPFYFGIPKFSAAAIISMIVVMLITAVETTGDVFATGE
FT                   IVEKRVGGEDVARALRADGLATFIGGVLNSFPYTCFAENVGLVRLTRVKSRYVVAAAGV
FT                   FMILIGMIPKAGALVASIPPPVLGGAAIAMFATVAVVGIQTLSRVDFHDHRNVVIVGTS
FT                   IGLAMFVTVQPDVAKAVPEWAQIIFGSGITLGSLTAIILNLVFHHLDKGYGPAVAGSPK
FT                   GGVIRLEQVNNMSREEFVATFGRLFQGPSWVVERAYDHRPFADTPALRAAFQDALFTAN
FT                   STEQRDLLSFYPDLGSDAGPDMSEESKKDRAAAGLMLLNDDDHEQFSHLTSAYRERFGI
FT                   PLIMSVRDVEKRDQILKSGWERLQNSPTQEQATAVIEVAKIANHRFDDLVADASPLLLP
FT                   RATFLEEVDNLSTPPSARQESVDEEFAAGTTRFNAMGQDEVRQVLASCLDVPRWIDAVA
FT                   AGRPYPSAQHVLHTARVAASDFSDEELRAALAKHPRIGERAGAGHDVEFSQREQSAVGT
FT                   ADAAVQQAILAGNADYENKFDRVFLIRAAGRSAPEILAELQRRLGNSPEQERAEVVTQL
FT                   REIALTRLETVLA"
FT   gene            complement(295807..296202)
FT                   /locus_tag="Namu_0262"
FT   CDS_pept        complement(295807..296202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76692"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76692.1"
FT                   /translation="MAHSADASAAEFLTAVRPLAERIGASLVEAVEVTDADVPLVWRGT
FT                   VVAGVRLGDASAEPRTDEGGLTGILAEVQREFDGPLDQLPRPEKQRAVRLLEEAGAFSY
FT                   RKAVETVASALGVSRFTVYNYLNRDRR"
FT   gene            complement(296202..296441)
FT                   /locus_tag="Namu_0263"
FT   CDS_pept        complement(296202..296441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76693"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76693.1"
FT                   /translation="MRVVAEFTTEPFHGEGEPPEHAQRAWEVVQAAGLTGDFGPLGTEV
FT                   QGERDTVLDALREVMAAALDAGATRITVQLHTER"
FT   gene            complement(296539..297924)
FT                   /locus_tag="Namu_0264"
FT   CDS_pept        complement(296539..297924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0264"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: sat:SYN_00517 NAD-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76694"
FT                   /db_xref="GOA:C8XK11"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK11"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACV76694.1"
FT                   /translation="MASTSPGYSITVRVQAPPTMGATADLAAAVLAAGGALTALDVVES
FT                   KPDGIVVDVTCNASDADHADQISDAIAQLPGVTVRKVSDRTFLLHLGGKIEIQSKVPLK
FT                   HRDDLSRAYTPGVARVCLAIAKNPADARRLTIKRNTVAVVTDGTAVLGLGDIGPAAAMP
FT                   VMEGKAALFKHFGGVDAWPVVLDTKDVDQIVEIVRCIAPGYGGINLEDISAPRCFEIER
FT                   RLKELLDIPVFHDDQHGTAIVVLAALTNALRVVGRKPADVKVVVSGVGAAGHAIIRLLA
FT                   AQGYGDIIGCDRHGAVDPAKPGMDEFRRWIADNTNPRGVRGTLAQTLVGADVFIGVSAP
FT                   NLLTGDDIARMNKGAIVFALANPDPEVDPFAAAQHAAIVATGRSDYPNQINNVLAFPGF
FT                   FRGMLDAGTHEINEQTMIAAATAIADCVSADELNANYIVPSVFDADVAPAVADAVRKAA
FT                   LSS"
FT   gene            298095..298889
FT                   /locus_tag="Namu_0265"
FT   CDS_pept        298095..298889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0265"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   aav:Aave_0116 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76695"
FT                   /db_xref="GOA:C8XK12"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK12"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACV76695.1"
FT                   /translation="MTALAGADHPDGVDPGPKQRSGGVQSIERAFTILETLAGAGGVMG
FT                   LSALATEADLPLPTIHRLVRTLVDLGYVRQEPSRQYALGPRILLLAESASSMLASVARP
FT                   HLTRLVDDLGETANLASLDGDEIVYIAQVPSRHSMRMFTEVGRHVLPHCTAVGKAIMST
FT                   MPPADVRAMLARTGMPRHTEHTITDPGAFAEQLRWSAEHGYAMDDGEQELGVRCVAVAV
FT                   PGVRSHLALSVSGPAGRMTPETVARAVPLLTAAGEALAAELR"
FT   gene            299028..300497
FT                   /locus_tag="Namu_0266"
FT   CDS_pept        299028..300497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0266"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: xanthine permease; uracil-xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   cti:RALTA_A0991 putative xanthine/uracil permease (NCS2
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76696"
FT                   /db_xref="GOA:C8XK13"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK13"
FT                   /inference="protein motif:TFAM:TIGR03173"
FT                   /protein_id="ACV76696.1"
FT                   /translation="MGFRPKLGADGKPIESVDELPPWKHLIPLGLQHVLAMYAGAVAVP
FT                   LVVGGALISAGKLSPDDLGYLVTADLFVAGIATVIQSIGFKWFGVRLPLMQGCTFAAVS
FT                   PMIVIGSQYGVGAIYGSVIASGIFMMLLAPIFAKLVRFFPPLVTGTVILIIGLSLMGVA
FT                   ANWIGGGIITDGGAPMQNVALAAGTLILIVLIERFAPPVLARISILLGILIGTLVALPM
FT                   GLVHWGKVGSADWVGITTPFYFGFPIFEVAAIVSMCIVALVIMTETTGDILAIGEIVDV
FT                   KIDSRRLADGLRADGLSTTLGGIFNTFPYTAFAQNVGLVSITGVRSRYVATFAGGVLIL
FT                   LGLTPKMGAIVEGIPQPVLGGAGIALFGMVAASGVRTLSTVKFNNKNILVVAIALGVAM
FT                   IPVVRDSFYNDFPNWFKTIFHSGISAGAIVAILLNLLLNSDKVRAQADAQALDAHGGAG
FT                   YDAVREVTAVDPAEAAAELAEADELSSRTKQ"
FT   gene            300568..301821
FT                   /locus_tag="Namu_0267"
FT   CDS_pept        300568..301821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0267"
FT                   /product="Malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /note="PFAM: malate synthase; KEGG: azc:AZC_0078 malate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76697"
FT                   /db_xref="GOA:C8XK14"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK14"
FT                   /inference="protein motif:PRIAM:2.3.3.9"
FT                   /protein_id="ACV76697.1"
FT                   /translation="MRVVGPALEAAGDVLTPAALAFVADLHDRFALRREHLLAERQRRQ
FT                   DMVSVGEPMDFLPETAAVRTEDWQVAPIPGELAGTWSTVPVIDLSDSISPSWPHLIAAQ
FT                   RRAWTGPVRFRPRGLHLPEKHLTVDGDPAVAALVDVGLYLFHQRDPAGLLSLPLLESHL
FT                   EARLWADLLEYAAAALERPADAVKVIVSVDTVWAAFEMDELLFELREHAIGLELGLCNY
FT                   LFSMVKTFRGAGTEYVLPERSRLDASAPFLQACSDLLAATARRRGLAGPADRGPAVDTV
FT                   ISGKDLLDIRTVPLVVTAEGLRDTIATALEILINWLAGTGAMTIADQPVDLATAELCRS
FT                   QLWQWQRNRVALEGGRRITGHLIVDELDAATERLADRWAERPGGRELLAGARNLLFDAI
FT                   SAVRFTGFISVPAYESMP"
FT   gene            301858..302160
FT                   /locus_tag="Namu_0268"
FT   CDS_pept        301858..302160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0268"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: rlt:Rleg2_3056 urease, gamma subunit; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76698"
FT                   /db_xref="GOA:C8XK15"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK15"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACV76698.1"
FT                   /translation="MHLTPADTEKLLLAVAGMVARDRLARGVKLNYPETVALLTTWVIE
FT                   RARDGRSVEELMVAGREVLGRDQVMDGVAEMLPDVQVEATFPDGRKLVTIHQPIA"
FT   gene            302191..302526
FT                   /locus_tag="Namu_0269"
FT   CDS_pept        302191..302526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0269"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: mch:Mchl_1356 urease, gamma subunit; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76699"
FT                   /db_xref="GOA:C8XK16"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK16"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ACV76699.1"
FT                   /translation="MAAGSTSGPGAIRTAPGFIELNANRSAAERIELVIVNTGDRPVQI
FT                   GSHVHLPDVNGALDFDRVAARGFRLDIPAGTSRRFEPGASRSVSAVALQGRRQVPGIAI
FT                   KSTPGEL"
FT   gene            302527..304230
FT                   /locus_tag="Namu_0270"
FT   CDS_pept        302527..304230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0270"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: xau:Xaut_4156 urease subunit alpha; TIGRFAM:
FT                   urease, alpha subunit; PFAM: amidohydrolase; Urease
FT                   alpha-subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76700"
FT                   /db_xref="GOA:C8XK17"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK17"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACV76700.1"
FT                   /translation="MVQISRADYAALYGPTVGDQVRLGDTDLWIEIEQDYTAGGEEAVF
FT                   GGGKSIRESMAQGSTTRAQGAPDTVITNAIILDHWGIVRADVGIRDGRIVAIGRAGNPD
FT                   IADGVHPDLQIGPSTDIISGEGKILTAGGIDTHVHLISPSQIVEALATGLTTLGGGGTG
FT                   PSEGTKATTVTPGAWHLETIHRSIDPYPINLLLLGKGNTVSMAGLKEQALAGAGGYKVH
FT                   EDWGSTPAAIDAALRAADEWGLQVALHSDSLNESGYVASTIAAIGGRSISAFHVEGAGG
FT                   GHAPDILTLAGLPNVIPGSTNPTLPHTVNTVAEHLDMLMVCHHLNPAVPEDLAFAESRI
FT                   RATTIAAEDILHDMGAVSLTSSDAQAMGRIGEVVCRTWQVAHVMKNRRGDIGGGLPADN
FT                   FRARRYIAKYTINPAITHGIDHEVGSVEPGKLADLVLWEPKFFGIRPAVVLKGGGLVWG
FT                   ALGDPNASIPTPQPVLMRPALTDAIGAQLSLSFVSPFALEDGLADRLGLRRKLSAVKPT
FT                   RDVGKAQMINNDALPDIVIKPDTFEISIDGEVVVPAPAQRLPLAQLYSLF"
FT   gene            304331..304804
FT                   /locus_tag="Namu_0271"
FT   CDS_pept        304331..304804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0271"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: tgr:Tgr7_2551
FT                   ribonuclease activity regulator protein RraA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76701"
FT                   /db_xref="GOA:C8XK18"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK18"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACV76701.1"
FT                   /translation="MSTADLYDEYGERLQSCDTQFRQFGGRRDFDGIVATVRCFQDNAL
FT                   LKSILGTPGQGRVLVIDGGGSVHTALTGDLIAQLAVDHGWAGLVINGAVRDSVALGALP
FT                   LGIKALGTNPRKSSKTGAGEHEVDLEFGGAIFRPGDHVWCDDDGVVVLPAAAQ"
FT   gene            304801..305529
FT                   /locus_tag="Namu_0272"
FT   CDS_pept        304801..305529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76702"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK19"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c1140"
FT                   /protein_id="ACV76702.1"
FT                   /translation="MSWGHGTLVLDPRENGPRGFANGGFACGALAGFVPGDLAEVTLRA
FT                   PIPVGVPLGVKSRLGGGAQLLDGGRQVLAEAVPAEPFVAEPPYRPTVAQAQAAWAAHPF
FT                   RGLDLPLSDCVVCGAERRDGLRICFGPVPGHPELMASPFTVPAAYCQDAGVLRTPAVWG
FT                   ALDCPSYPAEAVRRGRFALLGRLSASQRRPIMVGEELIAVGWTESIGNRSMRTASALLA
FT                   GDEIVASARAVWVEAKPDAV"
FT   gene            305711..306367
FT                   /locus_tag="Namu_0273"
FT   CDS_pept        305711..306367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0273"
FT                   /product="Urease accessory protein UreF-like protein"
FT                   /note="KEGG: yps:YPTB2940 urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76703"
FT                   /db_xref="GOA:C8XK20"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK20"
FT                   /inference="protein motif:COG:COG0830"
FT                   /protein_id="ACV76703.1"
FT                   /translation="MLLADARLPTGAHTQSAGLEPAMRQGLSLAQVPAYIRTRLRTVVA
FT                   VEAGAAVVARHVAVAAPADLADGLRAVDDAWRARTISPALRENAEGLGRGYARLVTGLW
FT                   PDAPASGALRAVRRPTRTVAIGVAGALAGLTGRQVARLIGYDDAQTVAAAALKLDPLDP
FT                   LVATGWVVQAASDIDRMAAAVASLTAPGQIPAVAGPLIEQWAQVHAVTGQRLFRA"
FT   gene            306456..307178
FT                   /locus_tag="Namu_0274"
FT   CDS_pept        306456..307178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0274"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: hit:NTHI0662 urease
FT                   accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76704"
FT                   /db_xref="GOA:C8XK21"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK21"
FT                   /inference="protein motif:TFAM:TIGR00101"
FT                   /protein_id="ACV76704.1"
FT                   /translation="MPDTTTRTTLRLGVAGPVGTGKSSIIALICREMAAELQLGVITND
FT                   IYTDEDARFLRSAGVLDPERIRAVETGACPHTAIRDDVTANLLAVEDLEADFAPLDVVL
FT                   VESGGDNLTATFSPALVDAQLFVLDVAGGGDVARKGGPGIGRADLLVINKTDLGPYVGV
FT                   DVPQMVADGQAARDGRPVIGLSRTDRASIDQLTGWVRATLQSFRSGGHVAVDPGPMAPH
FT                   FHAEANLWHAHDEAQPHS"
FT   gene            307175..307897
FT                   /locus_tag="Namu_0275"
FT   CDS_pept        307175..307897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0275"
FT                   /product="Urease accessory protein UreH-like protein"
FT                   /note="KEGG: rpb:RPB_1799 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76705"
FT                   /db_xref="GOA:C8XK22"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK22"
FT                   /inference="protein motif:COG:COG0829"
FT                   /protein_id="ACV76705.1"
FT                   /translation="MTLIAVDPAPGRARVTHTPGPIAARVQRVDQAGARVALVATTALL
FT                   LGGDRVELDVRVGPGGWLDVVETAGTVAYDAQGIASSWLIRADLAAGATLTWSGEPLVV
FT                   ADGARVHRSTTLDLAAGASACLRETLVFGRVGEAGGALRATTRVRHEGADLLVEDLDLP
FT                   DGAARRAPGRLGPARVIDTVLLLGRQAAPTPVLPAGTRYDLAGPGTVARVLAGDTDRGG
FT                   LDPVWRQWCADQAGQRRS"
FT   gene            complement(307873..308265)
FT                   /locus_tag="Namu_0276"
FT   CDS_pept        complement(307873..308265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0276"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: afw:Anae109_2650 HNH
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76706"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK23"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ACV76706.1"
FT                   /translation="MERVDDPQRRTQLNRAARLAVVLDRDGAHCLWCGRGFTTLIRPTT
FT                   DHLVPRVKGGPSWLENEVAACSRCNNDRGHRTPVDWLAECDRRGWAPDRAAIGEALLRF
FT                   RAAIHDRGGQRRAATYLDGQLRRWPA"
FT   gene            308379..309158
FT                   /locus_tag="Namu_0277"
FT   CDS_pept        308379..309158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0277"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: asa:ASA_3688 HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76707"
FT                   /db_xref="GOA:C8XK24"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK24"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACV76707.1"
FT                   /translation="MVVTDLDGTLLDESGMKISDRNLDALNRAAAAGARVVVATGRPIW
FT                   WLGPVIEAGFTGIAVCMNGAVVYDVAAGDIIAASPLTAETMQTFVTGLEQETDTFSLAV
FT                   ERLGITLQACIAEHDYDHPWAFGYFKRADRAELLAEPAAKLLVRGRGDSRSLALAARAV
FT                   GAEEVSITYSTDDGLIEVAAAGVNKGTALSELAARWGIDRKDVIAFGDMPNDLEMLHWA
FT                   GFSVGMGNAHPDVAAIVSEVGAHHHEDAVAQILERWF"
FT   gene            complement(309229..310449)
FT                   /locus_tag="Namu_0278"
FT   CDS_pept        complement(309229..310449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0278"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bur:Bcep18194_C7182
FT                   serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76708"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK25"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACV76708.1"
FT                   /translation="MRATRKSRGLLVVVAAGALVLAGCTSGTEAASTTKSAATVSPTAS
FT                   ETGSPADDLDRALAELVAMPGGPPGVISIVQVGDKQTVHTAGVADTTTGAAPEATDHMR
FT                   IASAAKAFSGAAALSLVDQGKLSLDDTIGKWLPDLPAAWADVTLRQLLSHTSGLPDFTQ
FT                   NADFGAAAGASLDTPLPPEQLLTFVYDEPLVFPPGSRYMYDNTDNIVVGLMIQAATGKT
FT                   YAEVLQEQVFAPLGLDSTSLPVGTEMPEPTLHGYDLDEQGAPEDVTELVAAGWAWASGG
FT                   IVSTPADLNTFIRGYVGGKLFGPETQARQTDLFIPGGESGPPGPGQNSASLALFRYQTP
FT                   CGTVYGHTGNTPGYTQFMVASPDGTRSATMSMTLARNAGGTPEELQVLDALQRAEAAAI
FT                   CLALDGS"
FT   sig_peptide     complement(310357..310449)
FT                   /locus_tag="Namu_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.801 at
FT                   residue 31"
FT   gene            complement(310489..312153)
FT                   /locus_tag="Namu_0279"
FT   CDS_pept        complement(310489..312153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0279"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bpy:Bphyt_6230 peptidase S13 D-Ala-D-Ala
FT                   carboxypeptidase C; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76709"
FT                   /db_xref="GOA:C8XK26"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK26"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACV76709.1"
FT                   /translation="MLTGKTSRVLVAGAAVLCLAACTGNSTTVSSSSSTPSSAAGANAS
FT                   TSPSSAVSSSAGTGSEGLTSVPGLPQEALDVMNQPQYALGQWAISVRDIDTGEQIVSLH
FT                   PDTLFEPASVTKTYSTGAAWQELGPDSTVTTPVKRTGEVTGGTLNGDLVLVGKGDITMG
FT                   GRTKPDGTVDFTNLDHNDANGIPGATLTTEDPLTGLNELAAQVKASGINEVSGDVIVDD
FT                   RLWQPHDLVGNPVTPIIINQNVIDFTTTATTPGQPASIVMSPVVAPWQIDNQVQTVEAG
FT                   GKTQIKPTSTDEKTVTLTGTIAADSAPVVNVYLFKDPATYARTAFIEALGRAGVTVTAD
FT                   PVATNPDSALPPKADVDGLTSVAELTSLPLKEEITYINKISYNNGGEAMFCRLAVAAGS
FT                   DDCEQGLRKGQEIWQAAGLDTNAVVLVDGSGLEGNYVTPNSQVQLQTIMAKRPDSQEWL
FT                   DTLPILGVDGSLATVQSTSPSAGKVFGKTGTLAAGDAFNDRYRLPVKALGGQMDTEGGR
FT                   HFAFAVFSTNSLYPDINGIFQANDDVGKVVASIQQAY"
FT   sig_peptide     complement(312034..312153)
FT                   /locus_tag="Namu_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.805 at
FT                   residue 40"
FT   gene            complement(312140..312334)
FT                   /locus_tag="Namu_0280"
FT   CDS_pept        complement(312140..312334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76710"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76710.1"
FT                   /translation="MSVERLHLCIEVGRAGDLITGTLTLPSGRVRTFTGRLGLFSAIDD
FT                   EIENVAPQGAPEGTEDVDR"
FT   gene            312453..315296
FT                   /locus_tag="Namu_0281"
FT   CDS_pept        312453..315296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0281"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; Bacterio-opsin activator HTH domain protein; SMART:
FT                   regulatory protein LuxR; KEGG: afw:Anae109_3347
FT                   transcriptional activator domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76711"
FT                   /db_xref="GOA:C8XK28"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK28"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76711.1"
FT                   /translation="MTGRASGDGGPSAGTLLERAGEISAIADAFGAAADGEGRVVVVAG
FT                   RAGIGKSSLLAESQRAARAGGFSVLTARASDLEREFAFGVARQLFERAVRRSPQWWAGA
FT                   ADQARAVFDEVPAAPGGIFEDVSQSVLHGLYWLVVNASADGPLLLTVDDLQLCDRSSLR
FT                   FLSYLSRRLDGLPVVVVAGYRTAGQPPADAALDELVGDPATQLVQPQPLTLEAVTEVLR
FT                   RRMGTYPAPEFAADCRRVTGGNPLLLDELARALQADGVRPDAASVAAIATLGPRAVSRT
FT                   VLARLAHAGPQAIAVAQALAVIGDWEGVAMVEAVTGLDADEIEAATRTLLRAEILQPGS
FT                   PLRFVHPLVRDAVYRELTPVESERRHLRVADVLRTMGRPDEQIAAHALALQPAGREWVV
FT                   TVLRAAALIAVHRGAADDALAYLRRAVIEPAPDDVRPRLLQELGMSESLANEPVSAIEH
FT                   LRAAYQLASAPADRGEIVGVLSRMLIFTNPPGEAVELLRQARATLPADFGDLHDALVAV
FT                   ELYAGHFGADDADAGERLSLVRVPGPGSGPGARMLAATAAWDRALTGAPMAGCVALARA
FT                   ALDDGVLVRADPWFMSIVAAGVLVLADEAGAADVWARMLADGLRNGSQLTVSGVRLWQG
FT                   WNFLEWGALDEAAHALGQYETDTIRRGGQHESGMAYWAGFHTRLLVDRGDLAGARAAWG
FT                   RAAPAAPGSDGDLLLRRAELEVLLAEGQWQQALEAADRLDAVRRRVVNPAWVPVAGLRA
FT                   RALAGLQRWSEATAAAESGVSAARQWGAPRTVGSALRVLAGVLDAAGSDSCLPVFDQAV
FT                   GALADSPARLELARAEAGLGGALRRRGQAVAARPHLARAVELATACGADSVAGPAAAEL
FT                   RVAGGRPRQRALTGIEALTPSERRAVELAAAGRTNKAIAQELFVTPKTVEVHLSSAYRK
FT                   LGVTSRGELAALWARVG"
FT   gene            315529..316908
FT                   /locus_tag="Namu_0282"
FT   CDS_pept        315529..316908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0282"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mxa:MXAN_3577
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76712"
FT                   /db_xref="GOA:C8XK29"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK29"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACV76712.1"
FT                   /translation="MILLMLMIAAVSGAGPVQARTLPAPAAVAAAAPGAFSLAVIPDTQ
FT                   QEVFGADTRFANRTQWLVDNRAALNLAFVLHTGDVVNWDTADHAQYAIARTAMQKLTSA
FT                   GIPWIPAIGNHDTAAVCAGGSACPGQSAHVNVRGTATFNQYFPVSSFPAVNGTFESGKV
FT                   DNAWSTFTAGNMDWLVLNLELWPRAQVISWARDVVAGHPQHNVIVVTHSYLNAGGGIEQ
FT                   GNGGYGDTSPQYLYDNLVRPFSNVKLVFSGHVGNAASRTDVRPDGSKVVSFLGAFHSNS
FT                   TNPVQIVTIDPAAGSVSTRFYAPKDGATWPQYATTVTGVSWGPPQPSGSWVALRAVAND
FT                   RFVTAEAAGAQPLIANRTVAQGWERFILHSLGGNEVNLWSLASQRYVTAEAAGAQPLIA
FT                   NRAEALGWEQFELIDNGDGTVSFRARANNLLVTAEAAGAQSLVANRTAIGGWEKFVLVR
FT                   L"
FT   sig_peptide     315529..315588
FT                   /locus_tag="Namu_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(316921..318294)
FT                   /locus_tag="Namu_0283"
FT   CDS_pept        complement(316921..318294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0283"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bac:BamMC406_5857 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76713"
FT                   /db_xref="GOA:C8XK30"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK30"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACV76713.1"
FT                   /translation="MTASAPARPSSPADHLWMHFTRMSAYAGQPVPTIERGEGCHIWDT
FT                   DGKRYLDALSGLFVVQAGHGREELAQAAAAQARKLAFFPVWSYAHPTAIELADRLAAAA
FT                   PGDLNKVFFSTGGGEAVETAWKVAKQYFRLTGRPGKYKVISRAIAYHGTTQGALSITGV
FT                   PPFKAPFEPLVPGSVRVPNTNFYRAPEFVAGDEKAFGRWAADQVEQAILMEGADTVAAV
FT                   FVEPVQNAGGCFPPPPGYFERLRQICDAHDVLLVSDEVICAYGRLGTMFGAQKFGYQPD
FT                   IITSAKGLTSGYSPLGAAIISDRIFEPFATGETTFAHGYTFGGHPVSCAVALANLDIFE
FT                   SEDLLGNVLRREVDFRTTLNRLLDLPIVGDVRGDGFFFGIEMVKDKATKETFTAAESER
FT                   ILRGFVSPALFERGLYCRADDRGDTVVQVAPPLISDQAVFDEIESVLRSVFTDAWAML"
FT   gene            complement(318291..318797)
FT                   /locus_tag="Namu_0284"
FT   CDS_pept        complement(318291..318797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0284"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: rhi:NGR_b01300
FT                   putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76714"
FT                   /db_xref="GOA:C8XK31"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK31"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACV76714.1"
FT                   /translation="MTVMPLHDDPEPVAVDPPGRIVLDEVSKKIIEQLQQDGRRPYASI
FT                   AAAVGLSEAAVRQRVQRLLRAGVVQIVAVTNPLHVGFTRQAMVGIRVDGPIDPVVAAVS
FT                   ALDEVSYVVVTAGSFDLLVEVVCTDDEHLLRVINHHLRAVDGVRSTETFVYLDLSKQTY
FT                   TWGTR"
FT   gene            318911..319981
FT                   /locus_tag="Namu_0285"
FT   CDS_pept        318911..319981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0285"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="KEGG: mpo:Mpop_4397 agmatinase; TIGRFAM: agmatinase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76715"
FT                   /db_xref="GOA:C8XK32"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK32"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ACV76715.1"
FT                   /translation="MGMARYGSMYGPDITFTGVPRCDLADPASYTDAVAVILGAPYDAG
FT                   TSYRAGARMGPMALRSCDYSEHTGSRPHLALRVDPLLDLGVVDAGDVEMAPTETQRSLA
FT                   ALQDAVLTLARAGKIPVVLGGDHTVAQPDITALAEHFGYGRLAVIHFDAHADTGDIQFG
FT                   SLYGHGLPMRRVIESGAVRGEKFLQIGLRGYWPEPPELAWMAEQGMRCYEMAEIARRGL
FT                   DRVLTEAMTIATQDTDGVYLSVDIDVCDPAAAPGTGTPEPGGLTARELLDAVRRIGRAV
FT                   PLVGLEIVEVAPPYDHADITAMLGNRVVLETLSGIARRRADAAAGTVWDEATPLMAGRV
FT                   SAAPPPVEPPEHERSL"
FT   gene            complement(319992..321350)
FT                   /locus_tag="Namu_0286"
FT   CDS_pept        complement(319992..321350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0286"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mxa:MXAN_2304
FT                   cytochrome P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76716"
FT                   /db_xref="GOA:C8XK33"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK33"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACV76716.1"
FT                   /translation="MTAPAHPSTAPLAPEAPLPVRDKLAALRVFHTGPGKVAAAAGPVA
FT                   LLTFTPRWLIPRYAMVCSPRGARDVLGRTDGAFDKQHIVHRQSQAFGRNVFNLPHEPWL
FT                   GRRRLLQPLFTRRHVAEYAGHMSTSAARLADDWIARGTVDLDEQTRRLTLQVIGRSVFG
FT                   LDLGERADELGPPVKLVLQWLTGRSRRPVRAPGWLPTPARHRMRTSLGQIRAVIDEAID
FT                   AARMDPGRDAGLVTLLLAADDPETGVRLTDEQIRDELFVFLIAGRDTTSTTLAFSLWSL
FT                   GRDPVLQERVAQEVSGLGPRALTVDDLPKLAFTARVIHEALRLCPPAPIIVRSAMQDAT
FT                   VDGVRIPAGTQVIVGAYAMHHDPSLWSEPELFDPDRFAGYRPVGDDRWRFLPFGAGPRS
FT                   CIGDHFAMLETTLGLATIIGRTRVESLDADFPIGLPFTLTAGGPVPARITSRS"
FT   gene            complement(321419..322036)
FT                   /locus_tag="Namu_0287"
FT   CDS_pept        complement(321419..322036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0287"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   reh:H16_B0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76717"
FT                   /db_xref="GOA:C8XK34"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK34"
FT                   /inference="protein motif:PFAM:PF07077"
FT                   /protein_id="ACV76717.1"
FT                   /translation="MPGLVGDGLVRLHEVALIVVGLGFVFVADEDELAYLGIWDLLAVL
FT                   YVGIGVVVLRRSRRDPRPVTDGPVVGRFRFNFLFALVASMIGFFVAVDIAVSDNPDEYQ
FT                   ILLNLLGVVAMILSWMLLQAGYARRYASMYVRGGGLTFPSTADPSAVDFLYFSVTIGTA
FT                   FSVSDVLVTTARMRWHVLVHSTISFFYNAAVVAFALSMFAGR"
FT   gene            complement(322178..322732)
FT                   /locus_tag="Namu_0288"
FT   CDS_pept        complement(322178..322732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76718"
FT                   /db_xref="GOA:C8XK35"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76718.1"
FT                   /translation="MSQPQGQRVVVIGPDGQPVGYADVPNGDGQPADGTSSPDGDGPAD
FT                   PADAIGEPAKVMRIGTMIKQLLEEVRAAPLDEASRARLMQVHQRSIRELETGLTPELRD
FT                   ELERLSLPFTEDTVPSEGELRIAQAQLVGWLEGVFHGLQAALVAQQMAARTQLEQMRRS
FT                   LPPGHSDGPGSAPGPGSGQYL"
FT   gene            complement(322761..323792)
FT                   /locus_tag="Namu_0289"
FT   CDS_pept        complement(322761..323792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0289"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76719"
FT                   /db_xref="GOA:C8XK36"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK36"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACV76719.1"
FT                   /translation="MKAIVVEQPGSPARLVWREVPDPVPGAGDVLINVAASAVNRADLL
FT                   QAAGHYPPPPGAPDTLGLECSGVIAQLGPDVSGWRVGDRVCALLAGGGYAQRVAVPAGQ
FT                   VLPVPDGVDLIEAAGLPEVACTVWSNLVLTAGLTAGRTVLIHGGGSGIGTMAIQVAVQL
FT                   GARVAVTASRDAVLDRCRTLGAQVTINYAQQDFVEAIQDATDGRGADVILDPIGAKYLA
FT                   RNIDALADGGRLVIIGLQGGTRAELDINGLMRKRAGVIGTTLRSRPIAGPGSKSEIVER
FT                   VRTDLWPLVAAGAVRPVIDSVLDLPDAAAAHARMAEGGHVGKILLRAPARVGTGTGEGA
FT                   ATT"
FT   gene            323903..324562
FT                   /locus_tag="Namu_0290"
FT   CDS_pept        323903..324562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0290"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   scl:sce7213 ribosomal-protein-serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76720"
FT                   /db_xref="GOA:C8XK37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK37"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV76720.1"
FT                   /translation="MSTKLRTLADYWPIFGLRLASPRLVLAPLQDADLPETLDLILAGI
FT                   HDRASMPFAMPWTDVPPDELVAGALRHYWSTRASATPQRWTVPFLVRRQGVAVGLQDLS
FT                   GTDFAVTRTVHTGSWLGRAHQGQGLGTEMRSAVVQFAFDHLKAERADSAAFSDNPTSLA
FT                   VSRKLGYRADGTAVVQRRPGERAVEQRLTLDRASFVRPGWMVQVRGLPACQAFFGT"
FT   gene            complement(324567..325238)
FT                   /locus_tag="Namu_0291"
FT   CDS_pept        complement(324567..325238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_3447 major facilitator
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76721"
FT                   /db_xref="GOA:C8XK38"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76721.1"
FT                   /translation="MTGGAILAVLPLAIGLALAALPVTLIPIALAAKRPPAVARAFLLG
FT                   WLLGIAVVGTVVIVLADVIVLPSGNLSWFGYIKIAIGLVLIGLAGRRWLGRPRAGEDPP
FT                   VPGWLASVDAMGAGRAFGLALLLAGLNPKNLALVLAGAVTIAEATAVPAQQAAALAVFT
FT                   VIGSVGVAAPPVLTLVLGDRAGPLLRSVDEWMTRQSTVIVAAVLLVLGVVLIVNGVTAL
FT                   R"
FT   sig_peptide     complement(325179..325238)
FT                   /locus_tag="Namu_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.802 at
FT                   residue 20"
FT   gene            325352..326218
FT                   /locus_tag="Namu_0292"
FT   CDS_pept        325352..326218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0292"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mlo:mlr1493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76722"
FT                   /db_xref="GOA:C8XK39"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK39"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV76722.1"
FT                   /translation="MDRIPAPALFLTSGLTQYVGAALAVGLFATIPAASVAWWRIAVSA
FT                   VVLMAWRRPWRQAWTRSDLVGAAVFGIVLATMNVTFYIAIDHLPLGTAVAIEFLGPVAV
FT                   AGLTGHGWRDRAGIALAAGGVVLLAGVQVEGGVTGSTAIGLVAIMGSAVSWAGYILLGR
FT                   RMAVRRDGISSLAVGMTAGAVVWVPLAFGAFLPVVTDPARAAAVVGVAVLSSVIPYVLE
FT                   QLVLRRVTAARFAILLAMLPVTAALIGAVLLAQIPTGFELAGMALVCVAIVLSGQRPAP
FT                   PESPLPG"
FT   sig_peptide     325352..325417
FT                   /locus_tag="Namu_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.473 at
FT                   residue 22"
FT   gene            complement(326228..327178)
FT                   /locus_tag="Namu_0293"
FT   CDS_pept        complement(326228..327178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0293"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rfr:Rfer_2725 protein of
FT                   unknown function, zinc metallopeptidase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76723"
FT                   /db_xref="GOA:C8XK40"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK40"
FT                   /inference="protein motif:PFAM:PF04228"
FT                   /protein_id="ACV76723.1"
FT                   /translation="MKFNPNARLDTSQVQDRRGGGSSRGGLSGGGFPGGRGGLAVGGGG
FT                   LGLLVLVAVVLFNMLGGGGGSTGSTGLLEGASGNATVDNGQLAQQCQTGADANANADCT
FT                   AVAVINSVQDYWADALAASGGTYQEADTVFYTGSTRTACGQGSAGMGPFYCPADQLVYI
FT                   DLSFWKDLRTTFGANDAPFTQAYVLAHEYGHHVQNLLGTSSRVGSATGATSGSVRLELQ
FT                   ADCYAGVWANHATTVPGADGQVLITEITDADLANAVQTAGAIGDDYIQTNLAGQRVDPS
FT                   QFSHGTSAQRQKWLLAGYRSGDPAVCNTFDTNDLG"
FT   gene            327276..329195
FT                   /locus_tag="Namu_0294"
FT   CDS_pept        327276..329195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21128 gene product from transcript GK21128-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76724"
FT                   /db_xref="GOA:C8XK41"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK41"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK21128"
FT                   /protein_id="ACV76724.1"
FT                   /translation="MATRFGRATTAAVWGLLLVGLGVAACLLGPVVGPFGDSTDPVSPP
FT                   TRAQAALDRLGQRIPGAADPTGWVVVVAPAGRTVDDPAVAGALRTLVDQLRDVPGVTAV
FT                   VDPAVGGTVAADRRTAFVPVAVAASAVLDARPAVATVATAARDDGSQVEVGGVLRAPAD
FT                   RSGAAALLALVVAIGLAGLLARLILRSWGGAALALGTALVGAGVGVAVAILLGLAGSGS
FT                   GWGSGWGSAAVAGGLGVAVGSAAAVLRHSHPGSHRGSRRAVAGGGALAVVATAGLAVTG
FT                   VGAWAAAGAALALATAGALLAILTLAPAVMGLTGEPPAAPEAGPGRWARAVTGYPLRAI
FT                   LGGLGVVGVLALMPLLGVRFGPPADPAQARLAAEFGPGAAGPLLLIVEVDRPAELTGAL
FT                   TAVAAQARQAAGVALAAPGRTAADGTLGVVTVLPRTGPTDPATRDLLLRLRADPAGVAG
FT                   ASVEVTGATAVAIDVADARAGAAWRYLLIIGPVLLVLLAVTSGPPSIGLAVAAGSVLSI
FT                   GLSTWLALGTFSGVFIHDGGGLGADLWWAAVGLALLLALVSEQAARAAVVRTDHGAGRA
FT                   VGLTALMVAVLVGGDLLAAGSVPAAALVVLAVLVDALVVRLTLLPALAALLARPARHRG
FT                   RHRG"
FT   sig_peptide     327276..327353
FT                   /locus_tag="Namu_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.754 at
FT                   residue 26"
FT   gene            complement(329211..329657)
FT                   /locus_tag="Namu_0295"
FT   CDS_pept        complement(329211..329657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0295"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   smd:Smed_6384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76725"
FT                   /db_xref="GOA:C8XK42"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK42"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ACV76725.1"
FT                   /translation="MATTAALDVLRRMFDEGFATGNDAIVDELCSPDLVEHQFGLTGSG
FT                   PAALASVKAAIRDVHRAMPGLRFDIEDSAESGDRVWVRVHGRGRATGPFFGPPSGRPVD
FT                   FTVFDLARVVDGRIVEHWGVPDRLAILAQTGVLDRLAAPPLAGP"
FT   gene            329692..330342
FT                   /locus_tag="Namu_0296"
FT   CDS_pept        329692..330342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0296"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pzu:PHZ_c3146
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76726"
FT                   /db_xref="GOA:C8XK43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK43"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV76726.1"
FT                   /translation="MQLYCIDCTAILRAVAPPVKTRSTYRQEQAAATRVRIAEAARRLF
FT                   TAHGYGSTSIDAIATEAGVAVRTVYSAFGTKRDILSLVCEQWLEQAQARERAQQVLADP
FT                   DPVRRLRGAAGWLTHLYAAGFDVVTIFEGAMDEGPQTRELLRAKLAGRNQVMDAMIASV
FT                   GERLVVPLADAQAVFRAFAAAGVYQELVVDQGWTPDRFEHWLADTLQAQLLGG"
FT   gene            complement(330361..331152)
FT                   /locus_tag="Namu_0297"
FT   CDS_pept        complement(330361..331152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0297"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   mlo:mll8086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76727"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK44"
FT                   /inference="protein motif:PFAM:PF07103"
FT                   /protein_id="ACV76727.1"
FT                   /translation="MTVPSARADRRRSPTRLAARIYDARTTHRRTVAAPAQVDRRFDYR
FT                   TCYWLIDLDEPPVLPGVLRRLVRFEARDHLGDPAATIATNARARLAEHDLAADRILLLT
FT                   CPRTFGHVFNPLSVYYCLRRQDAGEELVAVIAEVHNTYGGRHTYLLRPDQAGADEVDKQ
FT                   FYVSPFLPMGGSYTMRTPLPEERLAVSITLHQDGATPFVATLTGPGRPLTPASAVRAVL
FT                   RWPVLTLRTSALIRWQGIRLWLRRVPVQPRPADAAADERGR"
FT   gene            complement(331149..332438)
FT                   /locus_tag="Namu_0298"
FT   CDS_pept        complement(331149..332438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0298"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: bvi:Bcep1808_5907 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76728"
FT                   /db_xref="GOA:C8XK45"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK45"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACV76728.1"
FT                   /translation="MTADATSARPTVAVIGSGVAGLTAAYLLQRRYDVRLFEADERLGG
FT                   HAHTHEVALTHGQVVGLDSGFLVHNDRTYPNLLRLFDELGVATQDSDMSMSVRCDGCGL
FT                   EYAGAKGLSGLFARQSSLARPRYLAMLAQVKYFHRRARAVLDSGDDTLTLDEFLTRGRF
FT                   TDYFAHHFMLPMVAAVWSCGYDGARAYPARYLFTFLDNHGALSVTGSPQWRTVVGGSKT
FT                   YVERVAKDLSAVHTATPVRSVLRRPDGIEIRDDADTVHRVDHAVLAGHPDQTLAMLAEP
FT                   TRDEARLLGAFEYLPSTAMLHTDASVLPRAPKARASWNYRMAQCHAEPDRVKISYDISR
FT                   LQRITDERTYVVTLNDDPDAPGAVDPGSVLARMNYAHPTYTRASVAAQRELPQLNTDRL
FT                   AFAGAWQGWGFHEDGCLSGVRAAASLGVQW"
FT   gene            332682..332769
FT                   /locus_tag="Namu_R0004"
FT                   /note="tRNA-Ser3"
FT   tRNA            332682..332769
FT                   /locus_tag="Namu_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(332776..333405)
FT                   /locus_tag="Namu_0299"
FT   CDS_pept        complement(332776..333405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0299"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nha:Nham_1015 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76729"
FT                   /db_xref="GOA:C8XK46"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK46"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV76729.1"
FT                   /translation="MIIGQTPGPGNARGPRTLRTVVGVSASPSNPLDELVHDLILRVPD
FT                   PLSLVPGPWPVPTGQPGVGDEALRALLADDWAGTRMSAAKMSRLIDSQLVSRHRELEAD
FT                   HPDARDLGICRQGQTVGRLLLDLDTELPSARPPVVLVDIALHPDHRRSGIGSTVARALL
FT                   DTAAQHQRSVHATGVYGSSALGWLLRLGLVDVGGDALYRQLVWPGP"
FT   gene            333455..333799
FT                   /locus_tag="Namu_0300"
FT   CDS_pept        333455..333799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0300"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   smt:Smal_3901 protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76730"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK47"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ACV76730.1"
FT                   /translation="MEGSAPVTLPCSTTFDLPGYTIDRNLGICWGLVVRSVGFAKGFTG
FT                   GFRSLKAGEVPQYTEVVDSARQTAMERMAAHAQQLGGNAVLGVRFDSSDVAENLAEVIA
FT                   YGTAAVVHPS"
FT   gene            333876..334658
FT                   /locus_tag="Namu_0301"
FT   CDS_pept        333876..334658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0301"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76731"
FT                   /db_xref="GOA:C8XK48"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK48"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACV76731.1"
FT                   /translation="MSAVEIIAIFLAGVGAGTINAVVGSGTLVTFPTLVAFGYPPVVAT
FT                   MSNAIGLVPGSASGTFGYRRELQGQGPRLKWQIPASFLGALVGAWLLLHLPEATFKKIV
FT                   PVLLVIALVLVVVQPRLQATIRRRAEAAGRDHDTVTRGRFVALIIATFLVGIYGGYFAA
FT                   AQGILLVGVMGVLLPETMQRMNAAKNLLTLVVNTVAATTYIIVGFDRIAWGAVALIAVG
FT                   SLIGGFVGAHYGRRLSPVVLRGCIVVFGLIALWRLLAV"
FT   gene            complement(334712..335074)
FT                   /locus_tag="Namu_0302"
FT   CDS_pept        complement(334712..335074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76732"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76732.1"
FT                   /translation="MAFADGRSESVGESRSRVAIARAGLPAPDLQVELYSAADGRFLGR
FT                   SDFGWREQRTVGEFDGRIKYGRLVPSGRQPGDVVFQEKRREDLIRGEGITVVRWTWAEL
FT                   DDGTATDRIRRALHLV"
FT   gene            complement(335160..336230)
FT                   /locus_tag="Namu_0303"
FT   CDS_pept        complement(335160..336230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0303"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG:
FT                   cti:RALTA_A0774 histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76733"
FT                   /db_xref="GOA:C8XK50"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK50"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACV76733.1"
FT                   /translation="MTVRIRSALDTLPAYAPGRSVPGAIKLASNELAFPTLPAVAQAIA
FT                   DAAVHESSGINRYPDNGAARLVTALAALTGAPESHIVTGCGSVALCQQLVQATAEAGDE
FT                   VLFGWRSFEAYPIVTQITGATAVRVPVTAGHELDLAAMADAITPATRLIFICTPNNPTG
FT                   TTVRAADLIAFLDRVPEHVLVTIDEAYTEFDDADDSPDGLAEATSRPNVVTLRTLSKAY
FT                   GLAGLRVGYAVADPAVVTALRKVAIPFALNSLAQAAALAALGARAELAPRWQQVVAERT
FT                   RVHAALRELGYEVPVSRANFVWLPLRERSAEFAAHSEQHKVIVRAFADASGGVRVSIGA
FT                   PHENDAFLAAAAAFPR"
FT   gene            336426..338429
FT                   /locus_tag="Namu_0304"
FT   CDS_pept        336426..338429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0304"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sil:SPO1959
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76734"
FT                   /db_xref="GOA:C8XK51"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK51"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACV76734.1"
FT                   /translation="MTGNDVVPEVLWSPSKERIARAAITDFADFVSDRTGRTFDDYAAL
FT                   WDYSTGEPADFWGAIADYFQVRWHEQPTEVLPDVSMPGARWFPGGTLNYAEHALAEPAE
FT                   PVAGEPAIIAVAEDGSEQQLTRADLRRQVGAVQAGLRRLGVGQGDRVVALVPNTVHALV
FT                   GFLATAALGAVWSSCSPDFGAPSVIDRFTQISPTVLIAVDGYRYGGKAFPVAETVTKLR
FT                   EALPSLAGAVHVPALGTDVPAGMIGWDELTAQAAEQTFTPVPFDAPLWVLYSSGTTGLP
FT                   KPIVHSVGGILVEHLKSLRLHWDLGRGDRFLWFTTTGWMMWNFLIGGLLVDATVILYDG
FT                   SPGHPDLMTLWRLAEKHRVTLFGTSAPFVAASQKAGLRPAAELDLSSVTAIGSTGSPLS
FT                   TSGFRWIRDEVGADIQIASFSGGTDVCTGVVGGAPTVPVWMGEISCRALGAKVESYSPT
FT                   GEPLIDEVGELVITAPMPSMPVFFWGDEDGSRLRDSYFDDYPGVWRHGDWIRITSRGSC
FT                   VIEGRSDATLNRGGVRMGTAEFYRVVESLHEVADSLVVDTSTAAGEGDLLLFVVLAPDA
FT                   DPVAVTGSVKKLIRQELSPRHVPGAVVAVPAVPRTLNGKKCEVPVKRILGGMAVDTAVS
FT                   RDALADPAGFDEFIRVAQESANRSAAGRGSTG"
FT   gene            338426..339343
FT                   /locus_tag="Namu_0305"
FT   CDS_pept        338426..339343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to WS5"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76735"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76735.1"
FT                   /translation="MSTVSPRPRTGRAHRLAGLLAATGVLLASCASGTLATSDTSPVGS
FT                   SAPVTRPSVTGPTVVVTVPELVLSSQGTAPVTVAPTTDTVTASSTPEPAAETAQVPAAE
FT                   TDTAGPAPETTAAATAANPAPAPAPSGQGLNVSLANCDGCTVLATHRDVAGGRSAALVS
FT                   TGSGRGILLSVGGDGQVAGVIGVPYGAAFTTPDSGVLPCAQGRCVVTGRQGDGRAILSA
FT                   FELTDSGAWRDVSGDDAFPSATERSAVVDLDGELAIAVQDQGDGSAVWMLYTWSGDRYA
FT                   VLGCAADGDPPATAAAVSPSACLS"
FT   sig_peptide     338426..338536
FT                   /locus_tag="Namu_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.642 at
FT                   residue 37"
FT   gene            339481..339708
FT                   /locus_tag="Namu_0306"
FT   CDS_pept        339481..339708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76736"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76736.1"
FT                   /translation="MTELSAVSTGTMIRLDDETITLDRVEHLGATEGALSPVHGMPLTK
FT                   IKFSRNGRTKRRIYPSMMLVERLRRGRNRP"
FT   gene            complement(339811..339993)
FT                   /locus_tag="Namu_0307"
FT   CDS_pept        complement(339811..339993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0307"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: sme:SMa2071
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76737"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK54"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ACV76737.1"
FT                   /translation="MGLDDKIANKGQDLGGKVKEGAGKATGDRDLEAEGKGDQAAAGIK
FT                   QAGEKIKDAVKNVIN"
FT   gene            complement(340107..342083)
FT                   /locus_tag="Namu_0308"
FT   CDS_pept        complement(340107..342083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0308"
FT                   /product="PTS system, glucose-like IIB subunint"
FT                   /note="TIGRFAM: PTS system, glucose-like IIB subunint;
FT                   PFAM: phosphotransferase system EIIC; phosphotransferase
FT                   system PTS EIIB protein; KEGG: cvi:CV_0979 protein-N
FT                   p-phosphohistidine- sugar phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76738"
FT                   /db_xref="GOA:C8XK55"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK55"
FT                   /inference="protein motif:TFAM:TIGR00826"
FT                   /protein_id="ACV76738.1"
FT                   /translation="MTTTLEKTPAAEPAAPAPNKLKEIWSNFFGFLQKLGKSLMLPVAV
FT                   LPVAGILLGVGGAFLGNYNQQAINAGYCSAPGGITISGDAAACLALPSDTVVGDPVAAG
FT                   ILAEPLYVFLKILQGAGDPVFGALGLIFAVGVALGISKNDGVSALAATVGYLVMTATIG
FT                   VVAQARGIDTKAVLGLQTLDTGVFGGIIIGIIAGYLFNRFYRISLPPYLGFFAGKRFVP
FT                   IVTAFAAIALGVVLAFLWPPIGNFIENTANEVISANAPVAVFVYALVERALLPFGLHHI
FT                   WNAPFFYVVNIGGWSNCEGILTCFLRGHPESGIFGGGFLGKMFGLCGAALAIYVTAKPE
FT                   NKVKIGSIMLAAALTTFLTGITEPLEFAFLFVAPLLYVAHALMYASGFTVMYLLGGRLG
FT                   YTFSQGGIDYVLFYANGIKPWLVLVIGPIWFVLYFAVFYGLIKLLNMKTPGREEAEVDV
FT                   GEAAADGANRFSQQLVLAFGGRSNITDLDACITRLRVGVVDINKASQSKLRALGAAGVL
FT                   IVGNNMQAIFGTRSENLKTDIEEYLKIAGDEAELGDDQIEEVVYDEPGTKPKLRDPLAA
FT                   EKSRDFIAGLGGRDNISKVEAAAETRLRVKVKDGSKVDEAALANSGIAGVVKVGDGLYH
FT                   LIAGANADQYAAEMRGQLVSVPA"
FT   gene            complement(342133..344730)
FT                   /locus_tag="Namu_0309"
FT   CDS_pept        complement(342133..344730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0309"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PTS system, glucose subfamily, IIA
FT                   subunit; phosphocarrier, HPr family; PFAM: PEP-utilizing
FT                   protein; sugar-specific permease EIIA 1 domain;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region; phosphoryl transfer system HPr; KEGG:
FT                   cvi:CV_0980 phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76739"
FT                   /db_xref="GOA:C8XK56"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK56"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACV76739.1"
FT                   /translation="MSAPVSAPTATRVSLLAPVTGVLVPIEQVPDPVFAGKMVGEGISI
FT                   DPLENILVAPCDGEVVHLHPSLHALTIRSPEGLEVLTHIGLDTVRMRGEGFEVKVKVGD
FT                   QVKAGDELIVFDLDMVATQAKSLLTQMVIANTADMLSGLEPETGFVTAGQSVAAVAILS
FT                   APAAAEEGKAPRQPGKKVTSDAIIIPNPVGLHARPASVLSNLAAQYESDVTLHRGEDQA
FT                   NAKSVMAIMGMEVRFRDKVRLSAYGADADEAIKDLAEQLRVGLGEEGAVPIEEGADEDA
FT                   EHAAPAPVAAVAPAPRRRSDDPNVLLGVSASPGLGVGTVLQIRHQDIEVEENSNDRHRE
FT                   RRKLNDAIDRSLVQLTALEDRLASQSDAEKAAIFAAHREILRDPELLDLANSGIDKGKT
FT                   AGYAWRSAYTNYADKLAALKNELLAGRAIDVRDVGSRVLEEITGQRREKALIPAGSILI
FT                   AEDLTPSDTASLDPSAVAGFCTTAGGASSHVAILARALDIPAVAGIEPRALDIPEGTRV
FT                   ILDGAKGTLRQNVTEDEVERIRQRQERQAQRRAIELEHADEPATTTDGHHVEIVANIGS
FT                   LDDAQAAMTKGAEGVGLLRSEFVFMDRRSAPTEDEQAQIYTDIAKALKPGQPLVIRTLD
FT                   VGGDKPLPYLPIAPEENPFLGQRGIRVGLDRPEILRTQIRAILRAADAGAKINVMFPMI
FT                   STIEDFRLAKAIFEEERNAMGVLPMPVGIMCEVPSTAVMAHQFAAEVDFFSVGTNDLTQ
FT                   YTLAMDRGHPKLAPQVDALNPAVLGLIAECVRGAHAAGRWVGVCGGAASDIQAVPLLVG
FT                   IGVDELSVSVPAIPSVKALIRSLSLERCQELAAQALGADSAEAVRALVPLDND"
FT   gene            complement(345214..345507)
FT                   /locus_tag="Namu_0310"
FT   CDS_pept        complement(345214..345507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76740"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76740.1"
FT                   /translation="MGAADLEVVALLDDDEAEALADDVEGELDAAVEAGLALALDVAVS
FT                   SDGRVVDGTAAVPPTLAQEASARVATAARLALIKIGRALARPCDMSSFCQQE"
FT   gene            345515..346408
FT                   /locus_tag="Namu_0311"
FT   CDS_pept        345515..346408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0311"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   sfu:Sfum_0755 TolB, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76741"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK58"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ACV76741.1"
FT                   /translation="MPRSAPLTDTQLIATRNEDDKNDLSVIDTTTGMVVGKLTDGSPGS
FT                   QYPTMSPDRSTIVYAQTSDHGIELRMMAADGSGDRSLLAADSEFCPNPQRPAWNPMDTS
FT                   EIAVACRRGEDPDTLALISVDGTLRSTINTGFPSFDDPTYSPDGKTLAYWASQTPGSTS
FT                   GAIYTQPVNGSEAPKQITSPGARANDVDPVWSVDGKTIYFRRATEDASGQSSAQILRVQ
FT                   ADGSGLTPITDGTAFDNDPSVSPDGTQLAFFSNRTNAAGNNAGQIWVINVDGTGLRQIG
FT                   IGKPGTASGPPEWSRR"
FT   gene            complement(346419..346997)
FT                   /locus_tag="Namu_0312"
FT   CDS_pept        complement(346419..346997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76742"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK59"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3660"
FT                   /protein_id="ACV76742.1"
FT                   /translation="MPAPDATAVLELPDAEAWERWLSANHDQAREAWLRIARRGSGAPL
FT                   IDIADALDVALCWGWIDGQRRAHDATSFRQRYCPRRPRSAWSQVNVGKVEVLIAAGRMR
FT                   PPGLAQIDAAKADGRWAAAYERQRTAEPPPDLIAALAENPPAQSAFDALSRTDRYLVIL
FT                   ALAKARTPAARARTLAAAVARLAAAADHD"
FT   gene            347062..348207
FT                   /locus_tag="Namu_0313"
FT   CDS_pept        347062..348207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0313"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: pag:PLES_48141
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76743"
FT                   /db_xref="GOA:C8XK60"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK60"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACV76743.1"
FT                   /translation="MRRVIFDQDHDDYRQAITECLTRVVVPHHEQWERDGIVPRSLFGD
FT                   LGELGVFGFGVPEEYGGAGISDFRYNMILMEQAHRLGVAPAVLGPALQADICLPYFVTG
FT                   TPEQRARWLPGIVAGTSITAVAMTEPGTGSDLSGIATKAVRDGDHYVLDGSKTFITNGI
FT                   NADLVIVAVRTGGHAHRGLSLIVVERGTPGFERGRKLAKVGLHAQDTAELSFAGARVPA
FT                   ANLLGGEGSGFTQLTANLTQERLSVAVGAVAAAATALDRTIDHVRTRTAFGAPIGALQH
FT                   IRFQIAELATEIDIAQQYVDRCVTEHNQGVLGPVDAAKAKWWTTEMQWRVLDACVQLHG
FT                   GMGYMTEHPIARAWADARVQRIYAGTTEIMKDLIGRSMKLG"
FT   gene            complement(348226..350580)
FT                   /locus_tag="Namu_0314"
FT   CDS_pept        complement(348226..350580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0314"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   rsh:Rsph17029_3668 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76744"
FT                   /db_xref="GOA:C8XK61"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK61"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ACV76744.1"
FT                   /translation="MPTVRRHPPRLLVIQAVAGLVGVLLVLGALAGTVGLRTPGWVVGV
FT                   GYGLTLTGLLIRAVWRTGRGHLGPADAVTLTRAVLVGGLTALVADSISGPAPVSMMVAL
FT                   ATVALALDAVDGRVARRTGTVTPAGARFDMEVDSFLLLVLAVYDVRLLGSWVLLIGAAR
FT                   YLFVAATWRWPWLDRPAPPRYWAKVVAAIQGIVLTVTMAGLLPTPVLAVAVLAALGLLV
FT                   ESFGRQVWWLFRHARPDRSAEGAASARAVSPTRRVLAGLTTAVAVGLVWFGLVGPSDPS
FT                   QLDVTAFLRIPLEALIMVALVLTLPRRAGQVVAVLGGVLLGVLTVIKLLDIGFLAALDR
FT                   PFNLLSDWSYARSFVELLGGSLGDAAGTAVGIATAVLIVGLLVLLPLAVRRLVRVAGRD
FT                   RALTYRFVGAFGVIWLVAATVGLQVAPGAPLAAAEAAETAYQELSTVRAGLADREDFAE
FT                   QLARPTLPPSALTGLAGKDVVIAFVESYGRVAVQDPAISPGVDAVLNNGTRQLTAAGFG
FT                   GRSAFLTSPTFGGISWLAHSTLESGLWVNNQARYDQLTATPRATLISTFRDAGWRTVLN
FT                   VPANTRDWPEGQRFYGPDRIDDARTVGYRGPPFAFGAPPDQYTLAHFARTELAPTDRAP
FT                   VMAEIDLLTSHSPWAPLPELVDWARVGDGTVFTGMPERSPSVDQVWASGDRVRAAYGAT
FT                   IEYSLSALISFVLTYGDDDLVLVVLGDHQPASIVSGADAGRDVPVTIISKDPAVLDAIA
FT                   PWGWQPGLHPDPQAPVWRMDEFGDRFLRAFA"
FT   sig_peptide     complement(350485..350580)
FT                   /locus_tag="Namu_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.981 at
FT                   residue 32"
FT   gene            350755..351744
FT                   /locus_tag="Namu_0315"
FT   CDS_pept        350755..351744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0315"
FT                   /product="putative dehydrogenase"
FT                   /note="KEGG: csa:Csal_1178 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76745"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK62"
FT                   /inference="similar to AA sequence:KEGG:Csal_1178"
FT                   /protein_id="ACV76745.1"
FT                   /translation="MVGPTEPGAAFWVRAPGVGEIRPGPRPEPEAGQVRVRTLRSGISR
FT                   GTETLVFTGSVPPSQYQAMRAPFQEGDFPGPVKYGYLNVGVVESGPADLRGRTVFCLYP
FT                   HQREYVVPASAVTPVPDGVPPARAVLAGTVETAVNACWDARPLVGDRITVVGAGMVGGS
FT                   LARVLAGLPGARVTLVDLNPARAELAAALGVDFAAPERAPDGQDLVFHTSASSDGLALA
FT                   LRLLRPEGEVIDLSWYGTTPVRLPLGEAFHSGRLSIRASQVGAVAPARRGHRSMGERLA
FT                   LALELLRDQAFDALLSGESTFEDLPRVLPALVGGQLPALCHVITYDER"
FT   gene            351751..352158
FT                   /locus_tag="Namu_0316"
FT   CDS_pept        351751..352158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76746"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK63"
FT                   /inference="similar to AA sequence:KEGG:M446_4784"
FT                   /protein_id="ACV76746.1"
FT                   /translation="MFTVTVRDHMMIAHSLRGEVFGPAQRLHGATFVVDAAFAGRALSP
FT                   DDIVVDIGLAADELRAVVDDFRYRNLDDDEAFAGRNTTTEVLARAIADRLADRVHAEAF
FT                   GPSGRGLCRLTVTLHESHIAWASYERELWPG"
FT   gene            352146..353177
FT                   /locus_tag="Namu_0317"
FT   CDS_pept        352146..353177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0317"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   csa:Csal_1176 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76747"
FT                   /db_xref="GOA:C8XK64"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK64"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACV76747.1"
FT                   /translation="MAGVTRAVVALVPAGLDDPARPSGGNTYDRRVLDGLTRTGWQVDE
FT                   RPVPGGWPEPDEPDLAGLDRVLADLPDRAVVLVDGLIASAAAPVLVAAAGRVRLVVLVH
FT                   MPLGTDQERLVLERSRRVITTSRWTREWLVARHGLDPERIQVASPGVDPAPPAAGSAGG
FT                   RRLLAVGVIAPHKGQDLLVDALATLPDLDWSCTVVGALDVAPDFAARVRAAGSPRIRFR
FT                   GPLTGPDLAAAYAHADLLVLPSRAETYGMVIGDALARAIPVLATRVGGVPEALGAGDGS
FT                   GRPGMLVAADDPAALAAALRDWLGDPARRQEWRRAAAARRSTLTGWPVTAERVSRTLLA
FT                   AGR"
FT   gene            353174..354205
FT                   /locus_tag="Namu_0318"
FT   CDS_pept        353174..354205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csa:Csal_1174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76748"
FT                   /db_xref="GOA:C8XK65"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK65"
FT                   /inference="similar to AA sequence:KEGG:Csal_1174"
FT                   /protein_id="ACV76748.1"
FT                   /translation="MTIAPPPPPPPSPLPVADRRRPDRARWWPRLQLLGGALVVVIVLR
FT                   QLGTGPFLAGLAALTVPAVLAAMVIGAVTTVACAWRWRIVAERLGLRLRWGPAIAAYYG
FT                   SQFLNSTLPGGVLGDVDRAVRHGRTVEDVGRGARAVAGERAAGPLVHVGLTVLVVALVP
FT                   GPALSWLLGPVILLGGLLIVAGAVLLIARGTSRWSRLAGVVAADLRTGVLAREAWPRIL
FT                   LASVVVAVGPAVLFVIAARLVGVPAGALELVPVAMVVLAAMLVPINVGGWGPRESVAAA
FT                   VFGAAGWGAGTGVAAATAFGALTLIATTPGLVVLLARPLSRSTLARSIRTRSAGRTREV
FT                   GDE"
FT   gene            354198..354890
FT                   /locus_tag="Namu_0319"
FT   CDS_pept        354198..354890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0319"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: nha:Nham_1816 riboflavin biosynthesis
FT                   protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76749"
FT                   /db_xref="GOA:C8XK66"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK66"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACV76749.1"
FT                   /translation="MSERPYTLLSCCTSLDGYLAGAGQRRLLLSNDADFDRVDEVRAGC
FT                   DAILVGAATVRKDNPRLLVRTATRRDDRVTRGQAPSPAKVTLTCGAQLDPTARFFTEGE
FT                   TDRYVYCASSAVTQARRSLGPRATVIDGGQPVDLAWMSQDLYGRGIRRLMVEGGGSVHT
FT                   QFLTAGLADELNLVIAPFFVGDHRGRRFVDDGDFPFHPGRRARLAEVRQIGDVVLLRYA
FT                   LSDRFGAP"
FT   gene            354887..355684
FT                   /locus_tag="Namu_0320"
FT   CDS_pept        354887..355684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0320"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   scl:sce1808 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76750"
FT                   /db_xref="GOA:C8XK67"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK67"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ACV76750.1"
FT                   /translation="MTRGRRWAQGRDAAVRAWGIGRSLAIYHGIPGRRARLTRFYRQFL
FT                   DPGDVAFDIGAHVGSRVRAWRRLGVRVIAVEPQPDCLRVLRVLYGRDPRVTIVPEAVGA
FT                   RPGQARLAVSTASPTVSSMAPEWIDEVTRDPLFARVHWDRSVPVSVTTLDELAARYGEP
FT                   AFVKIDVEGFETAVLAGLSRPPRALSFEYLPAAHDQAGAALDLVDRLGNYRYNYSPVET
FT                   MRLAADSWLDADGLRRLLDRFRPAGRSGDVYARLVGPAVEAGS"
FT   gene            complement(355686..357260)
FT                   /locus_tag="Namu_0321"
FT   CDS_pept        complement(355686..357260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0321"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: regulatory protein
FT                   LuxR; KEGG: mlo:mll1989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76751"
FT                   /db_xref="GOA:C8XK68"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK68"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76751.1"
FT                   /translation="MLAADPAPARPRRAEVLAALSLALDLGLGQPMEHMLRAAVIATRM
FT                   ADRIGMDATERGVVYYAELVSWIGCQADSPELSALFADEIAFRAGTFPIDLRGRNRARF
FT                   LLGQAGHGRPPLAGGRARLRLLADGRRRMHELLESHYASAGALADRLGLGAGVRDAIHH
FT                   TFERWDGTGLPRGIGGPAIPIAMRIVHVADVIEVQLRAAGPEAAVQLARRRSGTQFDPQ
FT                   VVAVLTGAADEIFAGLDQQDVWPLALSQAPDPRLALSDPEVDALLIAIGDFVDVKSPRR
FT                   QGHSRRVGALAARAGQSRGLPETTVHALRRAGWVHDLGRLGVPGALWDRSGPLSSADRE
FT                   RIRLYPYFTQRILGRVGGLAEVAEIAGAHRERLDGSGFPRGVDGSSLSVPARLLAAAAR
FT                   LQSLTEERLDRPAVGLAQAVRTLEREAAAGALDAQAVAAVADAAGQPQPRRRARATGLT
FT                   AREEQVLALAAVGRSSRQIAAELTISEKTARNHLEHIYTKTGVSNRAGASLFAVQHGIV
FT                   RAGPPTG"
FT   gene            357380..357763
FT                   /locus_tag="Namu_0322"
FT   CDS_pept        357380..357763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_7467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76752"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C8XK69"
FT                   /inference="similar to AA sequence:KEGG:OCAR_7467"
FT                   /protein_id="ACV76752.1"
FT                   /translation="MVAMSQAVGKAVISLCTGLEDAEKVTVAFLVAVGAAEQGRTTLMF
FT                   LTKEAVRLATGSVATGVACAGCPPLADLVARYAAAGGSYLVCPLCFDAKALSAQTLVAN
FT                   ATLGGTVPLWQWIGDDPVVTFSY"
FT   gene            357775..358188
FT                   /locus_tag="Namu_0323"
FT   CDS_pept        357775..358188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76753"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76753.1"
FT                   /translation="MMDTNTMTSVGECFARAVAAKDRAGLRALLAESIDFQALTPGRHW
FT                   QAGAPDVVVDEIILGRWFGPGDVIEHLFSITGGQVADCERVTYRLGVRRDGHGYTVEQH
FT                   AYFTTVPAAGAGTRQIDWMRLLCAGYRSDPGVG"
FT   gene            complement(358202..361018)
FT                   /locus_tag="Namu_0324"
FT   CDS_pept        complement(358202..361018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0324"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rlt:Rleg2_6475 adenylate/guanylate
FT                   cyclase with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76754"
FT                   /db_xref="GOA:C8X5Y3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76754.1"
FT                   /translation="MVALFGRSSDLAALAAARAAVLGGSGRLVLITGEAGIGKSALAQR
FT                   ALEDAAAAGCRVARGFAVDDPGAPALWPWRRVGRDLPEVAHALATTAGGDAPPDAVPVA
FT                   LPDAGARFRLNEAIADAVTAAAGPTGLAVLLEDLQWADATTVAVLKHLAQELAAARLLV
FT                   LVTAREAEDTPFTRAWAELTRSPAAVSIPLRGLPELAVRDWLAATGDPHGWLELAPELA
FT                   DRTAGNPFYLAAITAQQRPPGSARPTVDRLVLDRAGLRTILLTPLRSLSEDHRRTVATA
FT                   AVLGERLSPTLLAAALGVPTESVSAQLADAVRVGLLHFGATGLAFRHAIVRDAVLADMS
FT                   ADERIAAHESIATAMDTVADDALVGPSAGHWNQVPGRPSAQRCRDRAARAAVLAASDTA
FT                   HDRAVGFARMSLRHSRELGDPTVELAQRTLELARYEWAAGLLPDALASCTEAVDLADRC
FT                   DRPELMAQAALVPQGVGSLDVSRVRDGLCRRALNRLPAGDSAWRARLLGLLAVAAADEA
FT                   IDSSAEVLSADALAMARRTGDPHAELDTIAARHFVLSYPQAIAERTALARRTLELAPPG
FT                   SMSRLWGLLWLSDIALQEGDMGRWDGLVQDIDALARRTGSPVARWHVARMQALRLALIG
FT                   EFAAALVEADRGRRLAEQVGDISMLGMYFALRAQLAILLGAPDDILGQAMSLMDRAPAM
FT                   PLITVSQAQIFLAQGRRDAAAAAIAPLRDLPERMPMGPRWSGSLGSLGLVATDLGDADL
FT                   AGRCYRALAPTAHWCLGDGGGTPYSLGSIDWPLGEMARCAGLAETAIGHFRRAIEINTR
FT                   LGARPFVAMARLGWARCLTDDDPDSPAGGDLAGTALAEFERLAMPGPAAAARRLLEHRS
FT                   PAAHGDGLTDREAEVAGLVGQGLTNKQIAAQLFLSVRTVESHVRNALAKLQLTSRTELA
FT                   LWVHRPDR"
FT   gene            361173..361502
FT                   /locus_tag="Namu_0325"
FT   CDS_pept        361173..361502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76755"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76755.1"
FT                   /translation="MYAQLTLFDGPRSPELVAAAERAGTERIDPLLDSDPELRADLVAR
FT                   YVLTQPDGGSAVVVISRSEASLDKAIRLITTSELLPGEDPALLPGPSRVERYQVADVRS
FT                   GDGAR"
FT   gene            361499..362044
FT                   /locus_tag="Namu_0326"
FT   CDS_pept        361499..362044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0326"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: mxa:MXAN_5877
FT                   YceI-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76756"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y5"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACV76756.1"
FT                   /translation="MTAPARAVTPSAAMVGWWAVDPATSTARFRVRDKLVATARGTIAV
FT                   AGGTIRIGAAGDVVSARVELTTASIDTGNRHRDRDLRTERFLSADRHPTIVVQAAPAPA
FT                   RSDGWTVPAQLQARGSSVPVDLTVTLTAVDEGSAAVRITGRLDRSGLGIKVPGFVIARF
FT                   VDLEVDIRAHRLDHTPAD"
FT   gene            362129..363793
FT                   /locus_tag="Namu_0327"
FT   CDS_pept        362129..363793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0327"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   rec:RHECIAT_CH0003125 putative sulfite oxidase protein;
FT                   SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76757"
FT                   /db_xref="GOA:C8X5Y6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y6"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACV76757.1"
FT                   /translation="MGQRTSGVTTSEQVPPAGTTAAPAPWRAGWLGSALGGIVAVVLTL
FT                   GVAELISTLGRWIGLLGASSSPFVALGQTFIQFTPEWLKELAIRTFGEHDKDALTAGMA
FT                   LTLLIVAIGIGLLNRRSPRLALGVTALLVLVAGAAVVSRPGADVLDLLPLVVGAIAGVT
FT                   FLILLARRSLVQDPDSAPLETPSSTASSTASSAGGTDRRRFFRLVGIGAIIGVAAGSLA
FT                   RLVPSAAEVADSRRRISLPTPADDQNIDVDALTLDVAGLTPFVTASSDFYRVDTAFTVP
FT                   NLTTDEWSLRIHGAVDREITISFDDLLAMPAVQRMITLTCVSNEVGGKLAGNARWLGVR
FT                   LADVLAMAGPQDGADCLLSTSVDGFTVTTPLAAVTDGRDALLAYAMNGEPLLVEHGFPV
FT                   RMVVPGLYGYVSATKWVVDLEVTRFADVTAYWTERGWAPQAPIKTASRIDVPAGFAQLT
FT                   AGSVAVAGMAWAQHRGLRAVQVQIDDGPWQDATLSGEAGIDSWRQWSYPWTATEPGIHT
FT                   IRCRAIDADGTVQTDAVQGVMPDGSTGLDSRQVTVKA"
FT   gene            363910..364611
FT                   /locus_tag="Namu_0328"
FT   CDS_pept        363910..364611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0328"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; SMART:
FT                   beta-Ig-H3/fasciclin; KEGG: cps:CPS_1375 putative adhesion
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76758"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y7"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ACV76758.1"
FT                   /translation="MLIKRVLTLVAGAGVALALAACGSTSTPAATSAASSAASSAASSM
FT                   SSSMAPSSSMSAPMSSSMSGSDMGAALVGPGCADYAKQVPTGAGSVDGMAQDPVATAAS
FT                   NNPLLTTLVAAVSGKVNPQVDLVNTLNSGEFTVFAPVDSAFAKIDAGTMDTLKTNSELL
FT                   SGILTYHVVAGQLDPSQVVGSHPTVNGASLTVTGSGDTLKVNDANVICGGVKTKNATVY
FT                   LIDSVLMPPTS"
FT   sig_peptide     363910..364023
FT                   /locus_tag="Namu_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.273 at
FT                   residue 38"
FT   gene            complement(364714..365556)
FT                   /locus_tag="Namu_0329"
FT   CDS_pept        complement(364714..365556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0329"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: msl:Msil_0764
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76759"
FT                   /db_xref="GOA:C8X5Y8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACV76759.1"
FT                   /translation="MAAAGTFEIKDLGPVRRLGFGAMRITGPGIWGEPADRDLARSVVR
FT                   RAVDLGVDFIDTADSYGPAISEEIIAESLHPYPAGLRIATKAGLVRSGPNQWHPLGRPD
FT                   YLRQQVELSLRRLRVDVIDLFQLHRIDPDVDRDDQFGVLRDLQDEGKVRALGLSQVSVD
FT                   DIKAAQEVFTVATVQNRYNLTDRSSADVLAYAQTQGIGFIPWAPVSAGELARLGGPVDT
FT                   IARRLSATPAQVALAWVLQTSPVMLPIPGTGSVEHLEDNLGAATLVLPDDAVAELDAA"
FT   gene            complement(365631..366998)
FT                   /locus_tag="Namu_0330"
FT   CDS_pept        complement(365631..366998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0330"
FT                   /product="ferredoxin--NADP(+) reductase"
FT                   /note="KEGG: acp:A2cp1_3438 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76760"
FT                   /db_xref="GOA:C8X5Y9"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Y9"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_3438"
FT                   /protein_id="ACV76760.1"
FT                   /translation="MPNAVPDFAVAVVGAGPAGFYAAAALLAPPEPRVRVDMYERLPTP
FT                   WGLVRAGVAPDHPKIKSISAQFARTATHERFRWFGNVEVGTTVSREELLARYDAVVYCV
FT                   GSPADRDLHIPGADRPGSVGARDFVGWYNGHPDFRALTFDLQVSRAVIVGHGNVALDVA
FT                   RILSTPPDRLAATDIADHALVALRASRIRDVLVIGRRGPAQASFTTPELRELGELTGAD
FT                   VIVDPAQLGPPDADADLPHVPRHNLEVLRRYAAAEPAGTGRRITLRFLTSPIEIRGRDR
FT                   VESVVLGRNRLLDPGDGAATAIDTGEREELAAGLVLRAVGYRGVPIPGVPFDDRAGLVP
FT                   NVEGRVLGGDREYVAGWIKRGPSGIIGTNKKCATDTVHTLLADLASTPGASTRPAAADP
FT                   GAIEAWLRRRQPDLVDLDGWTAIDTAELRAGAPLGRPRVKVCTWRELLATARTVPV"
FT   sig_peptide     complement(366924..366998)
FT                   /locus_tag="Namu_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.483 at
FT                   residue 25"
FT   gene            complement(367102..368088)
FT                   /locus_tag="Namu_0331"
FT   CDS_pept        complement(367102..368088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0331"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   atc:AGR_C_4543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76761"
FT                   /db_xref="GOA:C8X5Z0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACV76761.1"
FT                   /translation="MSIRLGYQIPNFSYGTAVDQLFPTVVAQARAAEAAGFDAVFVMDH
FT                   FYQLPGIGSPDQPMLEAYSTLSALSGVTDRIQLSALVTGNTYRNPTLLAKTVTTLDVVS
FT                   GGRAVLGIGAGWYELEHRQLGFEFGTFGDRFSKLAESLSIIAPMLRGERPTVDGRWYHT
FT                   ESAMNEPRLRDDLPILLGGGGERKTFGLAARYAQHLNIICAPDELPRKLAALDERCAEV
FT                   DRDRSTLETSFLVTGIIDEDGDRARAAMLEHFRRTGVDLDSLDPERRKSMESRLFAGTP
FT                   DDVAADLQARVLDTGVDGVIVNLIANGHQPGIVELAGSTLRRLIPAA"
FT   gene            368933..369163
FT                   /locus_tag="Namu_0332"
FT   CDS_pept        368933..369163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76762"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76762.1"
FT                   /translation="MPMVSEADLDQRIEQAFRDVLRKAIAWRMITDDPDQVAVVDYAAR
FT                   ELHAAVVEYEAAMNAWTGPIDPDGSASPAVG"
FT   gene            complement(369189..369689)
FT                   /locus_tag="Namu_0333"
FT   CDS_pept        complement(369189..369689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76763"
FT                   /db_xref="GOA:C8X5Z2"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76763.1"
FT                   /translation="MGDNGSSSKATRIGLEILGWLLVAAGVAALILPGPGLLLLALGLW
FT                   VLAKNYEWADRLLDPVKRAAYRGAAEGVKSWPRIIMSTTLALGLIAVGVIWGIRPAAPG
FT                   WWPLAEKWWLFGGWGTGVFLIFSGLLALGLLGWSMKNFRYGTMTLDELYRDQKLNERPG
FT                   RRR"
FT   gene            complement(369779..370915)
FT                   /locus_tag="Namu_0334"
FT   CDS_pept        complement(369779..370915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0334"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pca:Pcar_0178
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76764"
FT                   /db_xref="GOA:C8X5Z3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z3"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACV76764.1"
FT                   /translation="MSESSLWSLLLVMTVAALAPIASRLVPGRPPQVLFLILGGMVIGP
FT                   SVLGWADAVDIELLSGLGLGFLFLLAGHELDPRMLRERAGTQALLAWGVSAALAVLVVG
FT                   GLEYLGYVKAFVPVAIALTTTALGTLLPILREQQMLAGPFGRYVFAAGAVGELLPILAI
FT                   SLFLGAYDSWWEALIIASIAGLALLLAWLHKHATSQSTLRITVVLLLALLLITENFGIE
FT                   AALGAFFAGMVLRQTSSAEGNQEFEDKLDAVGYGFFIPVFFVSSGMGLDLQSILNSPGR
FT                   LLAFFVLLLVVRGVPAILIYRKTLGPRQRVEMMFLTATALPLLVALSEIGLQSGVMLPE
FT                   NAAALVGAGVLSIAIFPFVAARLHRPVGQRPVRDPRVP"
FT   sig_peptide     complement(370847..370915)
FT                   /locus_tag="Namu_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.322 at
FT                   residue 23"
FT   gene            complement(370960..372468)
FT                   /locus_tag="Namu_0335"
FT   CDS_pept        complement(370960..372468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0335"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: mpo:Mpop_1515 glucose-6-phosphate 1-
FT                   dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76765"
FT                   /db_xref="GOA:C8X5Z4"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z4"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ACV76765.1"
FT                   /translation="MSEPLSESLPQTIAYPAPGSRPYRRADEQLDPYVVVLFGATGDLA
FT                   RRKLLPGLTHLSLSALTPDIQVVATSLEEMDTDQFRELARAAVTEFSSRPKDVQNWDTF
FT                   APRLRYVPQSAGPEALARAVAEAEAELGPDVRRLHYLSVPPKAALAVVTMLDQADLVAR
FT                   SRVVMEKPFGTDFDSAVLLNQLVHQVFRESQIFRIDHFLGKEAAQNILAFRFANGLFEP
FT                   IWNRNFIDHIQIDIPETLGLDRRAGFYESTGAYKDMVVTHLFQVMAFVAIEPPTALEPR
FT                   AISEEKNKVFRSLLPINPANVVRGQYNGYRQEEGVSPDSETETFIALKCGIDNWRWAGV
FT                   PFYLRTGKRLAEGQRIISIAFREAPKSMFPAGSGVGLQGPDHLTFDLADETKVSLSFYG
FT                   KRPGPGMKMDKLSMQFSAHDTDRAADVLEAYERLILDAMRGDHTLFTTAEGIESLWERS
FT                   IPLLENPPPVKPYAPGSWGPNAIHQLIAPHAWRLPFERTWRETR"
FT   gene            complement(372611..373441)
FT                   /locus_tag="Namu_0336"
FT   CDS_pept        complement(372611..373441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0336"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; KEGG: xcv:XCV2090
FT                   response regulator NasT"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76766"
FT                   /db_xref="GOA:C8X5Z5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z5"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ACV76766.1"
FT                   /translation="MAQGRRELPPALTAAALADLLRDAITRPLAEAAPSLMDLALTGPW
FT                   QGAALAGRLASGAWGTLSETGSVDPGCDQRQWALQDGPAHDALTVDLIIAGDLGRDPRW
FT                   PRWRPAALTLGVRAAASIRLHAGRTLGTLTLYSPTPLPPAPLSSGRPRAMDGVVDEWAD
FT                   LATLAAHLSVLVEGSERRQQLERALVSRSTVGQAVGLLRSRFGLDADQGFALLRRHSQQ
FT                   RNVKLIELARAVVATGELPGLDREPDPNRQSRFRAGTAGDCAVREPAHPGQWRS"
FT   gene            373655..373894
FT                   /locus_tag="Namu_0337"
FT   CDS_pept        373655..373894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_2632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76767"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76767.1"
FT                   /translation="MSKDLSKPKNRKKLDKSAFALPGKRKYPIPDKAHARNALARVAQH
FT                   GTKDEQKKVKAAVHKKFPGIGRDGKGKGKKAAKT"
FT   gene            374027..374224
FT                   /locus_tag="Namu_0338"
FT   CDS_pept        374027..374224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76768"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76768.1"
FT                   /translation="MNEQGTSTDARDPGEPNLRPGPQDQGGHGGMATREQEKRVHDGTD
FT                   SAGVPPVEDTRASARQGERE"
FT   gene            374221..374421
FT                   /locus_tag="Namu_0339"
FT   CDS_pept        374221..374421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76769"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76769.1"
FT                   /translation="MKILGKLGAAGAVYSFLRSPTGQRILEEVKRQAADPKNRQRAADM
FT                   VDRLRSGGRKPIVVDPDQPAR"
FT   gene            374465..375049
FT                   /locus_tag="Namu_0340"
FT   CDS_pept        374465..375049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0340"
FT                   /product="putative membrane glycoprotein"
FT                   /note="KEGG: bpy:Bphyt_4458 putative membrane glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X5Z9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4458"
FT                   /protein_id="ACV76770.1"
FT                   /translation="MASHPAVGTADFELTMPELREVARFVVLHAQDVLAVYEQAVPADE
FT                   GPRAALAAAWAFAEGARRTAWQRTASVQAHRSARSAPSEVARLAARCAGDAAAAAYLHP
FT                   IARATQVGHILRAAASAARIAEVQAGEDPAAADAALGRSRQRATPVLLDVLGRYPAAPA
FT                   GRDRVARLMCTLDRTLRERVDVVDSASERPA"
FT   gene            375046..375570
FT                   /locus_tag="Namu_0341"
FT   CDS_pept        375046..375570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_04674 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76771"
FT                   /db_xref="UniProtKB/TrEMBL:C8X600"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76771.1"
FT                   /translation="MILPPVRDPRFITIRRGGTLTDTDHHLLALWAASCAEHVLALFET
FT                   VRPDDPRPRVAIEHARAWVRGEVTMMQSRAAGGHAMGAARDLRGPARHAAYAAGQAGVV
FT                   AHVAAHELGAAAYAIKAVRAAAGGDRVAAAQAAGRRECQWQRDQLPDAIRALVLDDQRL
FT                   RNDICWSVFEV"
FT   gene            complement(375585..377180)
FT                   /locus_tag="Namu_0342"
FT   CDS_pept        complement(375585..377180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0342"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; amine oxidase;
FT                   KEGG: scl:sce3770 putative phytoene dehydrogenase- related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76772"
FT                   /db_xref="GOA:C8X601"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X601"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACV76772.1"
FT                   /translation="MTTRTADAVVIGAGPNGLVAAIALADAGWDVLLLEANETVGGAVR
FT                   SAEVTAPGFCSDMFSAFYPLAAASRVIQDLELARHGLVWTQADKVLAHALPDGRAAVLE
FT                   RDPDRTAAGLEEFGAGDGQAWLEMFAGWQRIRDPLLDAMFTPIPPIRSGLKLLGRTKLA
FT                   GLLDLARLAVLPVRRLGQESFVGDGGPLLLTGNAMHADVPPDAAGSGIFGWLLTMLGQD
FT                   VGFPVPQGGAQNLAFAMARRFESVGGQVRTGARVSSVLVAGGRAVGVRLADGTAIRATK
FT                   AVVADVAAPTLYRELVGLDQLPAGIGEVLDRFQWDNPTLKLNWALDRPVGWRAPGAVGA
FT                   GTVHLGTDLDGFVDFSADLSVGRPPRHPFVLFGQMTTADPSRSPAGTESAWAYTHVPHS
FT                   MSQDATRLDQHVQRVQEHLEQVAPGFGDSVRARVVQYPTDLQDANANLVDGAVNGGTSY
FT                   PHQQLIFRPTRGLGRPETPLPGLFLASASAHPGGGVHGACGWNAAVAALHSQGPWRAAR
FT                   RTLARTAWARLLGS"
FT   sig_peptide     complement(377103..377180)
FT                   /locus_tag="Namu_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.664) with cleavage site probability 0.611 at
FT                   residue 26"
FT   gene            complement(377177..378121)
FT                   /locus_tag="Namu_0343"
FT   CDS_pept        complement(377177..378121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0343"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   scl:sce0047 putative 3-oxoacyl-[acyl-carrier- protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76773"
FT                   /db_xref="GOA:C8X602"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X602"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACV76773.1"
FT                   /translation="MHVQGNESTRRPVALIIGASSGIGRSTAQALSREGWNLVLASRSA
FT                   PALAEVERECARYGVDTTVIPTDVRDRAAIESLLVQAAAGSGRVDAVVNTAACVAYGRF
FT                   DQIPAEIYDQVIATNLLGTANVARAALRQFRSQGGGELVLMGSLLGKIAVPFMSPYVTS
FT                   KWGVHALTRMIQLEAREIPGVHVTLVSPGSVNTPAYSQAANYASREGRPPPPVDPPEKV
FT                   ARAVVKSLTQPRRERSVGLANHIVVLGFRLLPAVFDLAVGPLMKLTGLSRRPVADHPGS
FT                   VLHPHPAGEAEHGFWDRLGRRHESADSPVPVAP"
FT   sig_peptide     complement(378035..378121)
FT                   /locus_tag="Namu_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.310 at
FT                   residue 29"
FT   gene            378376..379566
FT                   /locus_tag="Namu_0344"
FT   CDS_pept        378376..379566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0344"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   pzu:PHZ_c1058 glutathione-dependent formaldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76774"
FT                   /db_xref="GOA:C8X603"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X603"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACV76774.1"
FT                   /translation="MKAVTWQGKRSLRVDEVPDPTIQEPTDAIVRITSTAICGSDLHLY
FT                   EVLGPYLSAGDILGHEPMGIVEEVGAGVTHIKPGDRVVIPFNISCGHCGMCRDGLQSQC
FT                   ETTQVRAQGKGAALFGYTSLYGSVPGGQAEYLRVPQAQYGPIPVSPDGPDERYLFLSDI
FT                   LPTAWQAVQYAAVPDGGTLVVFGLGPVGQFASRIGHHLGHRVIGIDPVPERRAMAERHG
FT                   IQTLDPAGLDDVPATVLELTGGYGAHGVIDAVGMEAHGGAGAAAGKFAQSAVGLLPDTL
FT                   ARKLIENVGVDRLTALHDSIGSVRRGGTVSVSGVYGGTADPMPMMDLFDKQVQLRMGQC
FT                   NVRKWIGDILPLVEDSADPLGVLDLTTHTLPLTDAPQAYQTFQEKSDGCVKVVLKP"
FT   gene            380206..380817
FT                   /locus_tag="Namu_0345"
FT   CDS_pept        380206..380817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0345"
FT                   /product="DNA-binding SAP domain protein"
FT                   /note="SMART: DNA-binding SAP domain protein; KEGG: FAP208;
FT                   flagella associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76775"
FT                   /db_xref="GOA:C8X604"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:C8X604"
FT                   /inference="protein motif:SMART:SM00513"
FT                   /protein_id="ACV76775.1"
FT                   /translation="MTITSTEPYTAATTAARQATERGVDAFKKGAKSLTEQTTNAAASL
FT                   PTVDLTKPVARYFDYIQKSIDLNREFATRWAELVTSFSGLVREQAETAGHVVREQTDAV
FT                   ADLTVEQAAKADELAREQAEKAEQVQREQAEQAEQAKRDEEKAAKAAERAEAKRAKEQA
FT                   REPYEGLTKAELADKLAERDLPKSGTVEELIERLVDADNQ"
FT   gene            complement(380931..382031)
FT                   /locus_tag="Namu_0346"
FT   CDS_pept        complement(380931..382031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0346"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: cak:Caul_2941
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76776"
FT                   /db_xref="GOA:C8X605"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniProtKB/TrEMBL:C8X605"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACV76776.1"
FT                   /translation="MTSLSIPREQRAVSAAARRPRRVLTDYAELLGRVQAQGLMERRYA
FT                   AYAIKGGLLLAAFAGVWCAFFLLGESWLQLVIAAVFGVVLAQFGFLGHDAAHRQILRSG
FT                   PRNETLARVVAGLFCGMSSTWWARKHTRHHLAPNQIGKDPDIDPSVLHFYPTETVPRSR
FT                   VLAFLRAHQGWWFFPILMFEGLHLHVQGFRTVLGRSPITHRWTELGFMAARMGGYVAVL
FT                   LIFLPVGMAAAFLGVQLAVLGVYLGCTFAPSHKGMPILPPEAKIDFLRRQVLMSRNITG
FT                   SHLTTFAMGGLNYQIEHHLFPSMPGPNLRHARTTIREFCQQRGVTYTETSLLTSYGIVI
FT                   RYLNRVGLRGELDSFQCPIIAAHRPI"
FT   gene            382227..382607
FT                   /locus_tag="Namu_0347"
FT   CDS_pept        382227..382607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0347"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rlt:Rleg2_1526 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76777"
FT                   /db_xref="GOA:C8X606"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C8X606"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76777.1"
FT                   /translation="MACRISELVLECRDPELLARFWCEVLDFVVLDRPGDGSVEIGPRE
FT                   GFGGPQPTIILSPTDDPPRAKSRLHLDVNATDRDQDAELARLLALGARPADVGQTGQES
FT                   WHVLADPEGNEFCLLRTRLNPL"
FT   gene            382604..383551
FT                   /locus_tag="Namu_0348"
FT   CDS_pept        382604..383551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0348"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   smt:Smal_1800 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76778"
FT                   /db_xref="GOA:C8X607"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X607"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ACV76778.1"
FT                   /translation="MTGAPLPQQVALPGLPSAISICEVGPRDGLQNEKSIMPVDVKLEF
FT                   IRRLVAAGHRLIEVTSLVHPRWVPQLADAEQLIGALERQPGVRYPVLVPNLRGYRRAAE
FT                   LGLTDIAIFGSATETFARRNLNRGVEESLAMFEPVVAAARADGGRVRAYLSMCFGDPWE
FT                   GPVPLDQVVGVAVRMMDMGCDELSLGDTIGVATPGHVAALIGWLAAAGVGADRLAVHFH
FT                   DTYGQALANTLTALGQGITVVDASAGGLGGCPYARSATGNLATEDLLWQLAGLGIDTGV
FT                   DLTAVVETSRWMAQQLGRPSPSRVVRALTGDAAG"
FT   gene            complement(383582..384190)
FT                   /locus_tag="Namu_0349"
FT   CDS_pept        complement(383582..384190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0349"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   afw:Anae109_2479 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76779"
FT                   /db_xref="GOA:C8X608"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8X608"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACV76779.1"
FT                   /translation="MVDLDRADPDDADLDMADVGPDNLAALDRLFATERSTRHCWCMAF
FT                   CRSGPAFAAGWYGGGNRRHFEAMAARGPMGVLAALNDEPVGWCACGPRARYRAAARGRS
FT                   RPLTLIPRADDDQVWLVACLFVARDARGRVALPLIRAAVDLARRQGASAVEAWPVSSST
FT                   RRRPEWAHVGREATFTRLGFTIVGRPTPDRAIMRLDLSG"
FT   gene            384408..385643
FT                   /locus_tag="Namu_0350"
FT   CDS_pept        384408..385643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0350"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dvm:DvMF_0624 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76780"
FT                   /db_xref="GOA:C8X609"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X609"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACV76780.1"
FT                   /translation="MNRLLVLGGGTAGTMIVNKLRRKLDRSAWDITIIDQDDRHHYQPG
FT                   YLFLPFGSATPEQVTRSRHAFLPDGVNFVIGEIDAIDAGGNVVTLADGRALPYDYLVIA
FT                   TGVTPRPDQTPGMLGDHWRTSVFDFYSLEGAQALAKALAEFGGGRFVVHITDLPIKCPV
FT                   APLEFTFLADDYFRRRGIRDDVEMVYVTPLSGAFTKPISSRRLGSMLSDRGVRVETDFL
FT                   VESVDGPARKLISYDEREIPFDLLVTIPLNMGAEFIARSGLGDELNYVPVDKHTLRSAA
FT                   HPNIFAVGDASNIPASKAGSVAHFSVEIFCENFLDLIAGKPMRGSFDGHANCFIESGNG
FT                   KGLLIDFNYDTEPLTGKYPVPFVGPFSLLEETRANHLGKLAFRWMYWNVLLPGKPLPLP
FT                   AHMSMAGKHVDS"
FT   gene            385679..385993
FT                   /locus_tag="Namu_0351"
FT   CDS_pept        385679..385993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0351"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="TIGRFAM: sulfur relay protein, TusE/DsrC/DsvC
FT                   family; PFAM: DsrC family protein; KEGG: tbd:Tbd_2480
FT                   putative sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76781"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:C8X610"
FT                   /inference="protein motif:TFAM:TIGR03342"
FT                   /protein_id="ACV76781.1"
FT                   /translation="MPVTTVGGRTIHVNDEGFLTDPNEWSPALGQILAHQIGIELGDVH
FT                   WKAINFLRSDYAGQGETPTIRRVATAGGIPVKELFKLFPQKPAKKMAYIAGLPKPQGCV
FT                   "
FT   gene            386034..386549
FT                   /locus_tag="Namu_0352"
FT   CDS_pept        386034..386549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_2556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76782"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:C8X611"
FT                   /inference="similar to AA sequence:KEGG:AFE_2556"
FT                   /protein_id="ACV76782.1"
FT                   /translation="MTDVVDTAAAIVPQFDTEASGRKLAIICSKGTLDMAYPGLVLANA
FT                   ALGEGIETHLFFTFWGFEMINKKTMDHLQFTVLGNPATHLPQGLGGLPWMTAMATSKMK
FT                   KSIAEVGVPEVPDFLDQIVASGGHLWACRMSADMNHLTKDDLYDEVEGIISASDFIEMT
FT                   EGAQLLFI"
FT   gene            386635..387546
FT                   /locus_tag="Namu_0353"
FT   CDS_pept        386635..387546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccs:CCNA_03389 lantibiotic transport ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76783"
FT                   /db_xref="GOA:C8X612"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X612"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV76783.1"
FT                   /translation="MGEEAIVRTMGLGKSFGSTVALRDVDLTIGRGEVFGYLGPNGAGK
FT                   TTTLRLLLGMLRPTTGRASVLGLDAWRDAVAVHRRVGYLPGEPALYGKLSGRQHVAYFG
FT                   HLRGAANDRRALSLADRLDLDLDRPAHELSKGNRQKLAVVLALMSGPELLVLDEPTSGL
FT                   DPIVQQEFYALLREQTDTGGSVLLSSHVLGEVQRVADRIGVVRSGRLIAVERMADLREK
FT                   SLHHVGARFADDVNAAEFAAVPGVRDLAVTGRVMTCSAPQAALDGLLKRITRHPVVDLD
FT                   CAEAELEETFLAYYGTGEHHAA"
FT   gene            387536..388336
FT                   /locus_tag="Namu_0354"
FT   CDS_pept        387536..388336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2567 ABC-type transport system
FT                   involved in multi-copper enzyme maturation, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76784"
FT                   /db_xref="GOA:C8X613"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C8X613"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76784.1"
FT                   /translation="MLHNVATKTLFDQRRTLLAWTISLALLVGMYVAIWPSIRDQPAMT
FT                   DFLNSMPPAIRSMFAMSGADMSTPIGYVKIEMLSLMAPLLVLLYAVSTGAAAVAGEEDR
FT                   HTLDLLLANPVSRSRVVLDKLLAMTVGIVLLAGATAVALMVISPLADMSLPTGPIVAAM
FT                   VHLALLGLVFGTLATAVGAATGNLTAARAVPAVTAVIAYVVNGLGPQVSWLAPAQKFSP
FT                   FYQYTGHDPLLNGLSVPAVLIALATAAVLAEIAVAGFRRRDVAA"
FT   gene            complement(388368..388538)
FT                   /locus_tag="Namu_0355"
FT   CDS_pept        complement(388368..388538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X614"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76785.1"
FT                   /translation="MCSPATCRTCGKASYTGCGKHVDQVLAGVPAHQRCSCSPTERSAE
FT                   SRSMLSRLFGR"
FT   gene            complement(388623..388889)
FT                   /locus_tag="Namu_0356"
FT   CDS_pept        complement(388623..388889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0356"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   lch:Lcho_3746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76786"
FT                   /db_xref="GOA:C8X615"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X615"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACV76786.1"
FT                   /translation="MVQIEPESITAVVNRLRRAQGQIGGVLRMIEEGRDCQDIVTQLAA
FT                   VSRAVDRAGFAVIAAGLKQCLIESDGADTLDTKTMEKLFLSLA"
FT   gene            complement(388934..389365)
FT                   /locus_tag="Namu_0357"
FT   CDS_pept        complement(388934..389365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0357"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   tbd:Tbd_2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76787"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C8X616"
FT                   /inference="protein motif:PFAM:PF03625"
FT                   /protein_id="ACV76787.1"
FT                   /translation="MTGTTAAARPDYAIAVIVERPFAEVVQATRDALAAQGFGVLTEID
FT                   MRATLKAKIGADIAPQVILGACRPPLAHAAILAEPSIGLLLPCNVVVRSVADDRTRVET
FT                   IDPAIMVTLTGNPGLQPVAAEARGRLTSALDSLVQSPTT"
FT   gene            complement(389362..389733)
FT                   /locus_tag="Namu_0358"
FT   CDS_pept        complement(389362..389733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0358"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mxa:MXAN_5670 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76788"
FT                   /db_xref="GOA:C8X617"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8X617"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACV76788.1"
FT                   /translation="MATTTLTDSTFERVVQRDGIVLIDFWASWCGPCRMFAPVFEQAAT
FT                   ANPDIVFGKVDTEAEPNLASAAGIRSIPTLMVFRDGILVFSQPGALPAKSLDQLITAVR
FT                   GLDMDQVRAQVAAAKAMSA"
FT   gene            389933..391363
FT                   /locus_tag="Namu_0359"
FT   CDS_pept        389933..391363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0359"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein; KEGG: gsu:GSU2309
FT                   metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76789"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C8X618"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACV76789.1"
FT                   /translation="MSNVVITGSERARPSGATVTDPGAGTTIVPIETPTLGDRSYLIHD
FT                   GRVAVVIDPQRDIDRVLRLAGAAGVRISHIFETHIHNDYVTGGLALAGVTGAAYHVNAA
FT                   DPVAYERVGVGDGDVVEIGPGWRLRVLATPGHTYTHLSYVLEEHGTATAVFSGGSLLFG
FT                   STGRPDLLGPDHTHELVHHQYASARRLAAELPEQTQVMPTHGFGSFCSATQTEAVASTI
FT                   GAEKSTNPVLTQDETHYVSDLLAGLDAFPAYYAKMGPANTAGPGAPDLSPPEPADARQL
FT                   RQRLERGEWLVDLRTRTAFAAGHAPGTLNFGLDGSFATYLGWLIPWGTPVTLLGENAAQ
FT                   VAQAQREMVRIGIDRPAAAATGGPRQWTDGPLDTVERATFADLAQVRHHRRVTVLDVRR
FT                   NLERSASRIDGAWHIPLHELLVRADEIPAGELWVHCAAGYRASIAASILLARGHRVVAV
FT                   DDDYSNAAATGLPVTVGA"
FT   gene            391377..392204
FT                   /locus_tag="Namu_0360"
FT   CDS_pept        391377..392204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0360"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mxa:MXAN_0177 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76790"
FT                   /db_xref="GOA:C8X619"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C8X619"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACV76790.1"
FT                   /translation="MVLIVAILAGALIGLSLGALGGGGSILTVPALVYLVGMDPRAATT
FT                   GSLIIVGVTAVVGMLAHHRDGHVRMSKGVVFGLVGAVGAVAGSRLSLAVPPDVLLAGFS
FT                   VLMLAVAAIMLARRRVPAGRGGPGMAEAVPFDVPIVSFTPRFVCACPRAAKVVVAALAL
FT                   GLMTGFFGVGGGFLVVPALVLALDFPMPVAVGTSLLVIALNSATSLVARAGSGLEIDWS
FT                   VIAVFTGAAVIGSLLGARIARRVRPQSLQIAFAGLIVAVGLYTAARSLPVLLS"
FT   sig_peptide     391377..391442
FT                   /locus_tag="Namu_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.932 at
FT                   residue 22"
FT   gene            complement(392245..392667)
FT                   /locus_tag="Namu_0361"
FT   CDS_pept        complement(392245..392667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0361"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: dvm:DvMF_3179 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76791"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C8X620"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACV76791.1"
FT                   /translation="MTDEVRVRHLGGDRFAVDIREHTVLVDQPVGAGGTDSAPTPTELF
FT                   VAGLASCVAFYARRYAARHQFSTDGLQVAVGYELGGRPARVSRIAIVVTPPAALPPDRR
FT                   DAFLAVASHCTVHNTLVQPPTIDITLAPDPVAVVGD"
FT   gene            392913..393664
FT                   /pseudo
FT                   /locus_tag="Namu_0362"
FT   gene            393764..395257
FT                   /locus_tag="Namu_0363"
FT   CDS_pept        393764..395257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0363"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: tbd:Tbd_1700
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76792"
FT                   /db_xref="GOA:C8X621"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8X621"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACV76792.1"
FT                   /translation="MGLTRPSGPAATPGSASAGRTRPTGRPSVTADIGPGVLLDERYRL
FT                   DERVGAGGTATVYRGTDTVLHRQVAVKLFRPDGADATVARRRAREMRLAAAVSDPHLVT
FT                   VYDAHPADPVPTTPEAALWYLVTEYVDGPTLADNVAGGPVAPEQLRSVGAGLARALAAL
FT                   HDHGLVHRDVKPGNILITSSGQPKLTDLGIAVEVGGLPVTQDGMVVGTVPYLSPEQAQG
FT                   DDVGPASDVYSLGLVLLECLNGHREFPGAPLESAVARLLRDPAVPPDLPPPWPDLLAAM
FT                   TDRDPTRRPSAAQVAATLAADPTDVTPIAQAERPPTTVVLTRPAVRAEPAKPRRRRWAV
FT                   LATAVVAAAILGGWWVVGADDPAVAPPTTEAPTSASPPAAPPTPTATAPQPAADPATSA
FT                   ESTTTAAPPTSAAASSSSEPIVDDARTVAPPEPDPIDAPEQVTTAATAGNGNGGNNGNG
FT                   NGNGNGNGNGNNGNGNGGGNNGNGNGNGGGNSGNGNGRG"
FT   gene            complement(395289..397586)
FT                   /locus_tag="Namu_0364"
FT   CDS_pept        complement(395289..397586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0002212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76793"
FT                   /db_xref="GOA:C8X622"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C8X622"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0002212"
FT                   /protein_id="ACV76793.1"
FT                   /translation="MRDILGVDRNYASLSTKDLLDARDQYHWHLVHRRNVIGTAVGLYH
FT                   IRKDEDWPSRERSARAVAAAARAASTRMRRTSGGIGPEPRTFENSEVRDYSWPCVLVLV
FT                   HTWIDADQFGTDDGQLPPEDMIPTTLYLPDGRTVPVCVIQVEPTVPDRDLLPAWTWPKS
FT                   VIGGGFPLISHTQGTTNVASVGALVTDGHTVYALTSRHVAGPAGQPIGTILRGQAVDVG
FT                   RSSERQLTRLPFTQVYPDFPAHRTYLTLDAALVEVNDLADWTSQTYGLPPVGALADLSE
FT                   RNIGMQLINAQVTAYGAASGRLTGRIAALFYRHRSMGGYDEITDFLIAPDPGQPSSQPG
FT                   DSGTVWHLIEPSEQPDDPARRLRPIALQWGGQGVRPADPGPGYNFALAAGLTAILRLLD
FT                   VELVVDYNTGPQPFWGKTGHYTLATVACAQVVTPTLRTLMAANQDRISFPAAGLSPGDI
FT                   DQATKDAKQHGGFVPLADVADVIWKNLAGQVRGGRDTSPRTGPEHPTHYADIDEPRPAD
FT                   HLTLRALCMQDPANVAVGVWQAFYDALGEQASRDRGLLPFRVWQFYDAMLDALAQDDLV
FT                   RYLAAAGLMAHYVGDACQPLHGSTLADGLPDGTGKGVHSAYESAMIDHHAADILAALLG
FT                   RLQDLAAHPLPPVASGQQAAVATVALMDRTATAIPPVDLVNAYAATPGGQSKAVTGKLW
FT                   DRFGPATVSVLADGARTLAMLWDSAWTQGQGDTRFTAAQLTAVDRSALQHLYESPGFVP
FT                   SLDLDTIGPNLH"
FT   gene            complement(397685..398560)
FT                   /locus_tag="Namu_0365"
FT   CDS_pept        complement(397685..398560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr3270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76794"
FT                   /db_xref="GOA:C8X623"
FT                   /db_xref="UniProtKB/TrEMBL:C8X623"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76794.1"
FT                   /translation="MELPVAPAPRDRVRPATRALCAFVTPFLLVGFVLLYFWSSAEDTG
FT                   RLFAWRISPDFTAMMLASAYLGGAYYFARALYADRWHRIAGGFLPVTLFASLLGVATIV
FT                   HWDRFVHGNVAFWIWTGLYVSAPILVLLAWWFNRAESVPVAPDELLLSGAEAGTIAAVG
FT                   ILACLVALVLFVAPGWAATVWPWSLTPLTARVVGAIFALGFAGIEVLADRRWDSARLLV
FT                   QVALIMLGLMGVAALRSLSDFDPQRPLSWLMGIGMPATTVALVGLYVVHERRAGPGPVE
FT                   RRGPDARPVD"
FT   gene            complement(398712..399852)
FT                   /pseudo
FT                   /locus_tag="Namu_0366"
FT   gene            399929..400936
FT                   /locus_tag="Namu_0367"
FT   CDS_pept        399929..400936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0367"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   scl:sce5223 DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76795"
FT                   /db_xref="GOA:C8X624"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X624"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACV76795.1"
FT                   /translation="MLTSSARLLSLLGLMQSRRRWAGPELAERLGVSDRTVRKDIDRLR
FT                   SLGYPVDAVRGAGGYYELGVGASMPPLLLDEDEAVAVAVGLRAASGIAGIEETSVRALA
FT                   KLDAVLPHHLQRQVAAVHEAVVQGPENTGSNVADPVVDAGLLTELSAAIRDRVEVRFDY
FT                   RADPDSALSAASGAASVVDRRQVEPYRLVSWQRRWYLVARDARTGSWAPYRVDWLTLKT
FT                   PGGRHFRPVSRPEGEDTAFVLREVAFAGWAVHARVLVDAGADEVLARINPTVGVVEPVD
FT                   GQHCVLVTGGDSVEVVAVWIGMLGLDFHVEGPPALVQALRVQARRYAAAVPPGE"
FT   sig_peptide     399929..399997
FT                   /locus_tag="Namu_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.907 at
FT                   residue 23"
FT   gene            401137..401784
FT                   /locus_tag="Namu_0368"
FT   CDS_pept        401137..401784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0368"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG:
FT                   ank:AnaeK_4117 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76796"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C8X625"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACV76796.1"
FT                   /translation="MSERIDRQWQPPEDALATTVEARKGAGSPWAKALREMGAVDRAVY
FT                   QAVADTPTPHLDAHVRRLSNAANFSRLWLGLAAGIAVFGGKRGHRAALEGVVAIGATSA
FT                   AVNLGIKPIARRRRPERAADTGQARFVSMPGSTSFPSGHSASAFAFAYAVGRHLPGLAV
FT                   PIRLLAGGVAYSRVHTGVHYPGDVAIGSIVGAGTAAIVAAASDGLSRSRRRD"
FT   gene            complement(401851..402540)
FT                   /locus_tag="Namu_0369"
FT   CDS_pept        complement(401851..402540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76797"
FT                   /db_xref="GOA:C8X626"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C8X626"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76797.1"
FT                   /translation="MVHETSIDAVPDVRSPTARSTRQLISVSDNLDPVRVQAQLDLAAT
FT                   VLGLGRCIDEIVIPVRRQLRMMVATGERDHLQELIATETIRAWLDRCGWSLPAPHPIGT
FT                   VLLACGPRDCDMVGPESLALLLRGHRRPCWVLGARIPTRMLATAARAADTSAVVVFAHH
FT                   RRGRPQAIASLEAVDALAIPVYYAGEAFDADRGRPDCPGRYLGTGLQQAAEMLMAATSP
FT                   PNRAGSS"
FT   gene            complement(402819..403733)
FT                   /locus_tag="Namu_0370"
FT   CDS_pept        complement(402819..403733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0370"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: scl:sce0579
FT                   MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76798"
FT                   /db_xref="GOA:C8X627"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C8X627"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV76798.1"
FT                   /translation="MVVSTRPNGEKGDSRGIPITDVARLLGVPMPTLRSWELRYGIPEL
FT                   SGRPSGQHRRYRPDEVNALRLMRDEIARGEQAALAAQSVRRMLGGQGQAQELILRVLDA
FT                   AERMDAAGIRARLDLAADALGLAGCLDDVLLPAMRQVGVWWAAGHCDVAQERMATEAVR
FT                   AWLDRRSAFAPAPTRSRPILLACGPSDLHTIGLESMALLLRSQGWPCRLLGARAPTATV
FT                   AAAARASSAAAVIVVSHLASGRLRAVESIRAVHELGIDVFYAGNAFSTPRSRRGVPGRY
FT                   LGVRVQDACADLTQALEPTELGG"
FT   gene            403919..404746
FT                   /locus_tag="Namu_0371"
FT   CDS_pept        403919..404746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2035 luciferase family monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76799"
FT                   /db_xref="GOA:C8X628"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X628"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76799.1"
FT                   /translation="MTDPSASSFREFRFGIVAPCLGGLSTWREQIRRIAGHGYSTVLMP
FT                   DFPRLQPAPAPALAVAASVADVRVGTWVYAAPFRAPWLTAWEAHSLTVLTDGRFEMGIG
FT                   VGRPGIEDELRERGLPVPGPGERLDQVRQTVAALRELDGGSRHTPVALAVSGPKARALA
FT                   AEIADTVTFAMAPSEPRAAVEQRIRDFHSTRAVELSMHVPVVGDAVSPFMAPPTTDTTA
FT                   LRAADSLAYLPADPAAAADELRRRREETGVSYIAFEANVADLFAPLVAELSGC"
FT   gene            complement(404790..405242)
FT                   /locus_tag="Namu_0372"
FT   CDS_pept        complement(404790..405242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76800"
FT                   /db_xref="GOA:C8X629"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8X629"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76800.1"
FT                   /translation="MPPRWFVVLFWYGHRLLVRTTRGRLGLWRPKPNRWGALRLTTRGR
FT                   RTGQPRHVLIGYVQDGDNLVTMAMNGWSPGEPAWWLNLQARPEATVQTRDGVRPVVARR
FT                   AQGDERARLWSRWAEIDHDLDAYAARRPAGTAVVVLEPRATTSPAG"
FT   gene            complement(405447..406526)
FT                   /locus_tag="Namu_0373"
FT   CDS_pept        complement(405447..406526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0373"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mpt:Mpe_A0896
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76801"
FT                   /db_xref="GOA:C8X630"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X630"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76801.1"
FT                   /translation="MPLDNPFYSAEQQGPYELISIGRFELEEGGVIPDLELAVATYGEL
FT                   NEAKDNVILIPTWFSGTHATWWQVYLGEGRALDPTKYFIVVINQIGNGLSTSPHTTNDP
FT                   EIAMANFPHVRIGDDVRAQEALLRQEWGIEHLALVVGGSMGAQQTWEWAVRFPEKVLRA
FT                   APIAGTAQATPHDFLFVRTLMDALTSDPGWAGGNYAAHTDVADGLRRHADIWAIMGLTT
FT                   EFWKSGFWKTIPPVVEGLGWETYEEFQQNFTRLLFGLMDPNALLTMAWKWQRGDVARLA
FT                   DGDLKAALSRVTAKVFVMPIEQDMFFPPQDCEPEAALTPGAEVRMLHSIAGHFGLFGFE
FT                   QSYLDEVDSALKELLASPV"
FT   gene            407211..407780
FT                   /locus_tag="Namu_0374"
FT   CDS_pept        407211..407780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0374"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: tgr:Tgr7_1155
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76802"
FT                   /db_xref="GOA:C8X631"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8X631"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76802.1"
FT                   /translation="MSAPSGVSHIAIVTGDLDGFRAFYEDTLGLRTTIVFGGGPGHSRQ
FT                   AILMAGDAMLHVFEVANDAATTQRVTAGMFERGRLDHLGFTVTDLVALRAIRDRLLAVD
FT                   ASSGDIRSLGPMLSLRFVDPDGSDGELNCYNTKFDPSTLRDEDEVIDPDWLVLTKRALQ
FT                   PGAGTDRRQPSGAARLHPRTHRRTGR"
FT   gene            408077..409222
FT                   /locus_tag="Namu_0375"
FT   CDS_pept        408077..409222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0375"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: slo:Shew_3053
FT                   serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76803"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C8X632"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACV76803.1"
FT                   /translation="MQLLVDTTIKDQLIPGAVLVLSTPQGDFTVSSGTTEIGVQSPPDA
FT                   NTHFRIASNTKTMTAAVVLQLAQEGKLELTDPVSKYVSGVPGGDSITVEQLLKMRTGLY
FT                   NYTNAQQMATSLDDDPTREWTPQELLDIAFAQPANFAPDAEFEYSNTNYVLLGLIIEKV
FT                   DGKPLATSFQDRLFGPLGMTNTELPAGASFTIPDPFAHGYLYGSSSIALFGEPAYTPEQ
FT                   IAAAKDGTLQPTDYTDVNHSFAFGAGNVISTAHDLVTWTKALVGGQVLDAEYQKLWLDS
FT                   PQMEDPDKPGGLWYGYGITRQSWGSNNLIYHGGETAGYNSKMAVETTNDVTLVLWTTLT
FT                   VDVDKEQQTANTLMLKVLDQIMVQSPLAVTAADLTAPPTTG"
FT   gene            409326..410719
FT                   /pseudo
FT                   /locus_tag="Namu_0376"
FT   gene            410890..412119
FT                   /locus_tag="Namu_0377"
FT   CDS_pept        410890..412119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0377"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: pzu:PHZ_c0370 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76804"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C8X633"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACV76804.1"
FT                   /translation="MNRGNSFRVALITAVFALALGAASCTSSSTTDTAATGGTPTDTVL
FT                   TTTAAEHPSAILVQPIHDAQIVPGDDGKDHVEYELLVVNVYFDPVTLTSLTVLDPAGKE
FT                   IGRITGATLAAATQALLTRTLTPAIDPSAAVAVDVDLAVEPGTAPERVTHRIDYTVTDP
FT                   KRAVIIDIGDTVVNGPEVAIDRRAPVVIAPPLAGDGWVVSSGCCSPNVHRDTRLAINGD
FT                   HIGTPETFAIDWVRVRNDRIYDGDGSQNEQHYAFGADILAVADATVVIVQDGEPEQLPD
FT                   VRLVPEKSTELAGNLVILELEPGVFAAYAHLQPGSITVKVGDKVKVGQHLANLGNSGNS
FT                   SGPHLHFGLLDQANMFTGRSLPYVLQQFTLVGAVNLETSTGDHLVIAPESRDVTRAYPL
FT                   HGGILDIPES"
FT   sig_peptide     410890..410994
FT                   /locus_tag="Namu_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.455 at
FT                   residue 35"
FT   gene            complement(412249..412677)
FT                   /locus_tag="Namu_0378"
FT   CDS_pept        complement(412249..412677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abb:ABBFA_002712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76805"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8X634"
FT                   /inference="similar to AA sequence:KEGG:ABBFA_002712"
FT                   /protein_id="ACV76805.1"
FT                   /translation="MANLVVHFEIHASEPPLLIKYYGGLLGWKFTQFGDMPYWAIDTGE
FT                   GAIGLNTPGTGINGGLTQRQGPAPGRGAAVNGCNFVVGVEGNVDDLFQKGLDLGGTEAL
FT                   PLSDMQGIGRVGYLHDPDGNIFGLISPVLSDGTTVTGG"
FT   gene            complement(413103..414251)
FT                   /locus_tag="Namu_0379"
FT   CDS_pept        complement(413103..414251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0379"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: bph:Bphy_2044 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76806"
FT                   /db_xref="GOA:C8X635"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C8X635"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ACV76806.1"
FT                   /translation="MDAILDALAAAGSMAWQMLWALILGFTLSAVIQAVVRKSAIVRLL
FT                   GDARPRTLATAAGLGACSSSCSYAAVALARSLFRKGADFTAAMAFEIASTNLVIELGVI
FT                   LALLLGWQFTLAEFVGGPLMIVFVAVLFRLILRERLVRSARGQADRGVAGAMEGHAAMD
FT                   MSIQQKGSFTERLFSGPGYTAVAHVFVMEWAAILRDLIIGLLIAGAMAAWVPTDFWNRL
FT                   FLADEPVWSALWGPLIGPIVAVASFVCSVGNVPLAAVLWNGGISFGGVVAFLLADLLIL
FT                   PILNIYRRYYGLRMMLVVTAVFYASMVAAGYCVELIFGVANLIPDSRDATVLHTGVSWN
FT                   YTTWLNIAALVLAGALVLRFLRTGGPHMLTRMQSSGRSSARS"
FT   gene            414666..415073
FT                   /locus_tag="Namu_0380"
FT   CDS_pept        414666..415073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76807"
FT                   /db_xref="UniProtKB/TrEMBL:C8X636"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76807.1"
FT                   /translation="MGNITDIPRPAVLDPHRPLRRHGTELFADNRPEAEVLRQALEDSC
FT                   AYADQLWQTLNYLREYLMLSLPPESTATGAGRMGASPYGPDDDEGWQAWMQAFAATTSV
FT                   LCGPNGDGGFGFSRARLEAQHRGFHPHSGQG"
FT   gene            complement(415081..415473)
FT                   /locus_tag="Namu_0381"
FT   CDS_pept        complement(415081..415473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0381"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: abo:ABO_2725 ATP synthase, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76808"
FT                   /db_xref="GOA:C8X637"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:C8X637"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACV76808.1"
FT                   /translation="MADMQVDLVAAEREIWSGRAQIVVARTVEGDIGIMPGHAPLLGRL
FT                   REGFAARIVEPEGNVLSVAVHGGFLSVTKEGVAILAEDAELREEIDVTKARAAYERAKA
FT                   QGTNSAEAEAELRRARAQLLAFGEPI"
FT   gene            complement(415476..417311)
FT                   /locus_tag="Namu_0382"
FT   CDS_pept        complement(415476..417311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0382"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   xop:PXO_02887 glycosyl hydrolase, family 15"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76809"
FT                   /db_xref="GOA:C8X638"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C8X638"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACV76809.1"
FT                   /translation="MTASRRHRIGLDHTSFPPHVLREYALLADGERGAVLGPGGDIVWM
FT                   CMPRWDSDAVFAALLDGPGAYSVTPLGRFVWGGSYEAGSMIWRSRWVTDDGIIECREAL
FT                   AFPGEPHRAVLLRRVVANDRDAQVRVTLAPRARFGRHGFTELHHADHSWTGRSGPLHLR
FT                   WTGAPAGIRRVNPHHELTTDLLVPAGGHHDLVLEIGDQALPSDPPDPETAWQATAAAWS
FT                   AAVPDLQNCLEPADARRSYAVLRGLTAASGGMVAAATTSLPERAEGSRNYDYRYVWIRD
FT                   QCYAGQAAAAAAAPALLDDAVRFVTARILDHGPDLRPAYTTQGAPVPDQRTVDLPGYPG
FT                   GGNMIGNWVNQQFQLDAFGESLLLLAAAGRADRLDVDHWKAARIATDAVAARWTEPDAG
FT                   IWEIDPQPWTHSRLTCVAGLRAIARLPHAGTAAGAWLTLADQITAHTAARATHPTGRWQ
FT                   RSPQGPGVDAALLLPSLRGGIDPADPRSDATLIAYLADLTRDGYAYRFRHDDRPLADAE
FT                   GSFTLCGFLVALSLHQQHRPIAAARWYERTRGCVGPPELYSEEFDVAHHQLRGNLPQAF
FT                   VHALHLEAAARLSEPSASPSRPSIDFQSSSPELRL"
FT   gene            complement(417308..417640)
FT                   /locus_tag="Namu_0383"
FT   CDS_pept        complement(417308..417640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76810"
FT                   /db_xref="GOA:C8X639"
FT                   /db_xref="UniProtKB/TrEMBL:C8X639"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76810.1"
FT                   /translation="MWAAATAAVGVAAILRSEPVARLVAGRGTAPDARLVRILGARQLV
FT                   QGGATLIRPTRHLVAIGGGVDVIHGASMVLAAVIWPEHRTAALISAGVAGTSAAAAALI
FT                   LVGDHR"
FT   gene            complement(417676..418661)
FT                   /pseudo
FT                   /locus_tag="Namu_0384"
FT   gene            418897..420072
FT                   /locus_tag="Namu_0385"
FT   CDS_pept        418897..420072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0385"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: scl:sce0981 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76811"
FT                   /db_xref="GOA:C8X640"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X640"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACV76811.1"
FT                   /translation="MKVLIVGAGIAGPTLAYWLLRAGHQPTLVERAPELRHGGYVIDFW
FT                   GAGFEVAERMGIAEELRGRGYRFRQVRVVDRRGHRFASFRPASIVGPMDRYVSIARSEL
FT                   ARVIYDSLDGAVELILGDTVRTLCDESDRVRVEFGSGDVRHFDLVVGADGLHSRVRRLA
FT                   FGADAQFEKYLGIVFAAFQAQGYRPRDELVAMMHAEIGFQAVRLSLRQDMTLFLFTVRH
FT                   LGAVPTDDRTAQQDLLRAKLAGKGWETSAMLELMPQSQSFYFDSASQIRMPEWSRGRVV
FT                   LVGDAAAGPSFLAGQGSALAMVESYTLAAELARTADHREAFGRYQARLAPLLRSKQDAA
FT                   QGLGLAFAPASGVQLLVRNAAMIAMGLPRVAGLVMGRSFHDSVELPEFAAA"
FT   gene            420173..421513
FT                   /locus_tag="Namu_0386"
FT   CDS_pept        420173..421513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0386"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   rsh:Rsph17029_3442 cyclic nucleotide- regulated
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76812"
FT                   /db_xref="GOA:C8X641"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X641"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACV76812.1"
FT                   /translation="MDRERQRPVSGRSGVVVIGSGFGGFFAARRLRRLRVDVTVLAATD
FT                   SFLYTPLLPDVAVGTVDPRSVLIPLASTLRGVTIVRGQADRVDLNSQTVHYTDARGQQA
FT                   ELGYRRLLLAPGSVTKLLPIPGLSDHAIGLKTATEALYLREKVLAQLEAATTITDAARR
FT                   REALTFVVVGAGHAGVELTAQMARLAHNLVPLYPGVTRDDVRWLLVDVADEVMPELGGS
FT                   LGRSALRLLRRRGVDVRLGVSVERVRDHEVALTDGTRVRCGTLVWCAGVVGNPLIEALG
FT                   LPTSKGRLVVDKVLRVPQHHDVYAIGDAAAVPDLTKPQDEHGQRPLCPPTAQHAMRQAT
FT                   AVARNIVADLDGRPLRPYRHHDLGLVVDLGGPDAAATPVGFRLRGRLAKAVTLGYHLYA
FT                   LPTGKRRIRVAVDWAIAGKRPDDVSLRSLPQSAALIVNAEDGGPAIS"
FT   gene            complement(421510..422016)
FT                   /locus_tag="Namu_0387"
FT   CDS_pept        complement(421510..422016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0387"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: mms:mma_3602 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76813"
FT                   /db_xref="GOA:C8X642"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X642"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV76813.1"
FT                   /translation="MPRESKAALQRRQLALQVDGVLTASKALVGVAAQSVEEAGANLTA
FT                   PQLRALVIVASLGPLHLTALAAAMRVHPSNATRTCDRLVADGLLDRKDNPADRRHLALT
FT                   LTPAGQHLLDGVMERRRAAISEILQRMPVLARERVADALAEFASAAGEPTEHHLWSLGW
FT                   ISEAR"
FT   gene            complement(422115..422333)
FT                   /locus_tag="Namu_0388"
FT   CDS_pept        complement(422115..422333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76814"
FT                   /db_xref="GOA:C8X643"
FT                   /db_xref="UniProtKB/TrEMBL:C8X643"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76814.1"
FT                   /translation="MVGELLGSALVLIGVVMLLMRGRISPRIDGPTGSGLAPIHQGPAA
FT                   GKRRQLLVACLLLILGRTALVLAGVMA"
FT   gene            complement(422565..423656)
FT                   /locus_tag="Namu_0389"
FT   CDS_pept        complement(422565..423656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0389"
FT                   /product="glycoside hydrolase family 76"
FT                   /note="PFAM: glycoside hydrolase family 76; KEGG: glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76815"
FT                   /db_xref="GOA:C8X644"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:C8X644"
FT                   /inference="protein motif:PFAM:PF03663"
FT                   /protein_id="ACV76815.1"
FT                   /translation="MRPGRAARMLAVLVAGSLLVGCGAQAPSDQPAVDALVQMYDQRSG
FT                   VWPTTGWWNSANAVNALTNYMIVSGDHRYTWVLENTFAKKRNAARGNFINDFTDDTGWW
FT                   ALAWISAYDLTGNAEYLQTARRAVDFMWSNQDDTCGGGLWWTVNHGYKNAISNELFIQA
FT                   AAELATRLGDAGAAYLDRARTVWDWLQASGMINDDLLVNDGLNAATCRNNRDTTWTYNQ
FT                   GVILGGLVALFRATGDHSYLKSARELADASTRAPGLHVDGVLTEPCERTGCDVNGPSFK
FT                   GIYVRNLGELNRVLDDHPYSDYLIDQASTAYDHNRTDDNEYGLHWAGPVDRVNGATQQS
FT                   AVDLLVAAQPIPETPESAVSTSG"
FT   sig_peptide     complement(423582..423656)
FT                   /locus_tag="Namu_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.740 at
FT                   residue 25"
FT   gene            423818..424966
FT                   /locus_tag="Namu_0390"
FT   CDS_pept        423818..424966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0390"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: sme:SM_b21421 putative sugar uptake ABC
FT                   transporter periplasmic solute-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76816"
FT                   /db_xref="GOA:C8X645"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8X645"
FT                   /inference="protein motif:COG:COG1879"
FT                   /protein_id="ACV76816.1"
FT                   /translation="MVAIGLLAACTSTEPVDGTTGTITNVGSSPLSSASPTPTATGTSV
FT                   IGPPVTGTQATGTSGTGTSGDEPTGTAEPTGTVVTFRTVAPDSAVGIRIGMVVSSGSDP
FT                   FSAAVAESVVDQVQAAGAELIRCDPGANASLALECARRLATQHVDGWISLQPGQAGEAL
FT                   CAAGPRDAPLITVAAASLSCQRAQVGADDRLAGYLAGQALGRSARLGTGCQHDVLVVIT
FT                   GDPADPMSARRTEGIKGGFATECPASGADPVLLDAGTQDRAFEAFTNELTALPDDTEIL
FT                   VAAVDDGTALGAAAAVPAARADRITLAAVGADQRARCRIVAEPWWIGDAALFPDRYGEV
FT                   AVPALLDAIAGKDVPADMYVETTFVTADTLTAFYDVSDCPAR"
FT   gene            424963..425985
FT                   /locus_tag="Namu_0391"
FT   CDS_pept        424963..425985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0391"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sme:SM_b21423 putative sugar uptake ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76817"
FT                   /db_xref="GOA:C8X646"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C8X646"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACV76817.1"
FT                   /translation="MTAHSRPPDRRAVLTRVVLAVSGVVAFIAFTVTIPYFLTVDNLAN
FT                   LLNDVALVGIVALPATFLMMSGQVDLSVGAAAAFVGIVLARTAPDSGLLPAVLLAIGTG
FT                   ALIGLVNGLLVTEGEVNSIAATFASMALLRGLAYLVPSGLAIALPGFRSLGTLRPVLGI
FT                   ALPTLIFAAIALVAALMSRSAIGRRSRAIGSLPAAQRMDGSGERHWIIALFVASGLAAA
FT                   LAGLIRTSQLGTGLPTAGIGIELTVVTAVLLGGGHLTGGRGSVGGTLLALLLMAIVDNG
FT                   MSLANVTPYAAQVFHAGLLLLALMIDRPRRRSRTRSPARTKQGGDSVRIDGASDPRVPG
FT                   "
FT   gene            complement(425945..427303)
FT                   /locus_tag="Namu_0392"
FT   CDS_pept        complement(425945..427303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3822 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76818"
FT                   /db_xref="GOA:C8X647"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:C8X647"
FT                   /inference="similar to AA sequence:KEGG:Rpal_3822"
FT                   /protein_id="ACV76818.1"
FT                   /translation="MPTPSQGGWSVLRDAVRTQLWPIPAVGIGLAVFLGVLLPQLDAQI
FT                   DDGLPSAVTDYLFGGGAEAARAVLEAVAGSLITVTSLTFSLTVVTLQLASSQFSPRLLR
FT                   TFSSDRFVQITLGVFLGTFTYALTVLRTVRTAADDQELFVPQIAVTVAFLLAVASVFAL
FT                   VIFLAHLAKEIRVETMLATVHRDATATLRRVLPDRQADRPPATAPDIPAVSEVVPAPSS
FT                   GFLVWIDELAVLRAARQGDAILTITAPPGSSLIQGVPMGECWPRRGAEFDPDVLRELRD
FT                   AIAPAIHTGPERTAAQDVAFGLRQLTDVTVKALSPGINDPTTAIHALGHASALLTELVG
FT                   RDLGPRVLADDDGPTRVILQRPGFAELLDLAVAQPRRYGAGDPAVLDRLFQLLREVAWL
FT                   VTDPIEQRSIAEQLARLRATTEAQSFDVAEQKMLKRTADEVIPALGGRWRHRS"
FT   gene            427487..427753
FT                   /locus_tag="Namu_0393"
FT   CDS_pept        427487..427753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76819"
FT                   /db_xref="UniProtKB/TrEMBL:C8X648"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76819.1"
FT                   /translation="MTVANHTEGALDREVRDLLANVACSVPADVVKDVVSAVRQDLEGQ
FT                   VPAEAFPEFLHRSVVQRLLTRAVAGGRCAPPADPADSLSGVAQ"
FT   gene            427750..427953
FT                   /locus_tag="Namu_0394"
FT   CDS_pept        427750..427953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76820"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:C8X649"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76820.1"
FT                   /translation="MTSAEQIDQVVDAVSMAFCMRPVTRADLLTAAVAAHAPTPVFDAL
FT                   LQLPERRYYDIVELRGQLRAAT"
FT   gene            428030..428752
FT                   /locus_tag="Namu_0395"
FT   CDS_pept        428030..428752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0395"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: mno:Mnod_7423 two component transcriptional
FT                   regulator PhoB, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76821"
FT                   /db_xref="GOA:C8X650"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8X650"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76821.1"
FT                   /translation="MPSLPPDSGSAPTRVLLVEDDERIRLALGLALGDLGFQVRDAASG
FT                   ELALERLEVADVDVVLLDLMLPGVDGLTVCRTLRARGDLPIIITTARSDTADVIAGLEA
FT                   GADDYMSKPLVASELAARIRALLRRRRPVSNTTVQSYVQVADLEVWPMEGRVRRAGADV
FT                   HLTRTEFRLLAELVSADGVVVTREELLHRVWGYDYFGDTRLLDVHIRRLRRKVETDPDN
FT                   PALITTVRGLGYRFSSSR"
FT   gene            428769..430178
FT                   /locus_tag="Namu_0396"
FT   CDS_pept        428769..430178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0396"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   scl:sce4877 two-component histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76822"
FT                   /db_xref="GOA:C8X651"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X651"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV76822.1"
FT                   /translation="MVTKRRIGLSLRWRVAIAFGLASVAVAGLVAVATWQLATTYMLDQ
FT                   RRQSATLQATVNAQLVEASSRSGSGSLDELLSGLVVDPGSSILLARSDGLLTSGRAVDP
FT                   ADLPSQLFTPDPGETRWLVTEIDGIRVLAISLQGGSAGTVFIELFPLVELGRIQHFLIL
FT                   VLVAGAAASGLLGVGLGWWTSKRALRPLTELTESAARVAGGDLHVRLPEQSDPDLAPLA
FT                   STFNATVEALERRVRLDARFAGDISHELRSPLTTMVNAIEVLRHRQGEIPEVARQAVDL
FT                   LAGEVERFRKMLLDLLEISRSDEDVDDRALESIDLAILVAKVRDTGRMTFPLVVEKPPP
FT                   AIYADRRRLVRVVANLLDNAERHGGGVAKVTVTEWQGRARLEVDDAGPGVPVELREQIF
FT                   ERFARGRHAGERGGESGSGLGLALVARHVRLHSGAVWVEDAPGGGARFVVELPAANDDA
FT                   GHPEVGPSIAR"
FT   sig_peptide     428769..428870
FT                   /locus_tag="Namu_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.819 at
FT                   residue 34"
FT   gene            complement(430215..430508)
FT                   /locus_tag="Namu_0397"
FT   CDS_pept        complement(430215..430508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76823"
FT                   /db_xref="UniProtKB/TrEMBL:C8X652"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76823.1"
FT                   /translation="MSLTLDNACEVLDHCVADTPAGGFTRTSHHAGHLAPGDLWRPDRR
FT                   EGPHTITELRRSADQVTLVDQTGTSYRYRTDAILPTAVADPLVPRPRDMVYP"
FT   gene            complement(431056..432303)
FT                   /locus_tag="Namu_0398"
FT   CDS_pept        complement(431056..432303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0398"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   sit:TM1040_0033 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76824"
FT                   /db_xref="GOA:C8X653"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X653"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACV76824.1"
FT                   /translation="MTTLLLVYSAVLLLSVLVSNLANRTILSTAVIFLVAGFLCGSGVS
FT                   GLIPLEPGDSIVATLAELALFSVLFTDGMRVGWSDLRSAWRLPGRALLLGLPLTLVLTA
FT                   AFAHWVAGLDWIESLLIGAVLAPTDPVFAAALVGNDKVPARLRHLLNVESGVNDGLALP
FT                   FVLIFLTLASGSPDLHLGALAGELAIGLLIGVAVPWIAIRLEATRLFSASARYQPLNAL
FT                   AIGLLVLGLALVTGGNLYLAAFAAGITIATCGPRQRQAFEEFGELIAELLKLAALLVFG
FT                   ALISPAFLSEIPLGGWIFAVLALVVARPVALALSFLGSGLNAREQVAAAWFGPKGFAAV
FT                   VYGLLVLDSQIPAAGSVFHLVAVTIVLSILAHSSTDVLVARWFDEPDETPRWHETGDTA
FT                   PAPPREPDPERPDSPS"
FT   sig_peptide     complement(432238..432303)
FT                   /locus_tag="Namu_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.421 at
FT                   residue 22"
FT   gene            complement(432589..433089)
FT                   /locus_tag="Namu_0399"
FT   CDS_pept        complement(432589..433089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0399"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   mch:Mchl_3352 protein of unknown function DUF421"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76825"
FT                   /db_xref="GOA:C8X654"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:C8X654"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ACV76825.1"
FT                   /translation="MFYDTFDGLLRVLVVAPLTYVWLIAVLRFSGKRTLAQLNAFDFII
FT                   TVALGSTLATVVLSDTVAWLEGAVALALLVALQFVVAVMSVRISWVRRMLTSEPTVLLR
FT                   DGRPVRDALLRERISYESLLAAVRAAGVGGLELVSAVVLETDGKLSVISARQLGSGSAM
FT                   HTP"
FT   gene            433352..434492
FT                   /pseudo
FT                   /locus_tag="Namu_0400"
FT   gene            complement(434494..434727)
FT                   /pseudo
FT                   /locus_tag="Namu_0401"
FT   gene            434817..435011
FT                   /pseudo
FT                   /locus_tag="Namu_0402"
FT   gene            complement(435147..436628)
FT                   /locus_tag="Namu_0403"
FT   CDS_pept        complement(435147..436628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0403"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: vvy:VV2044 sodium/alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76826"
FT                   /db_xref="GOA:C8X655"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C8X655"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ACV76826.1"
FT                   /translation="MATAFVAAEETEPSGIDAAVNDAVGPIATWIEGIVFYRFEFFGVG
FT                   VPVIVLWLITGAVFFTIFLGFKNIVGFKHAIDLVRGRYSHPEDAGEVSHFQALATAVSG
FT                   TVGLGNIAGVAVAISLGGPGATFWMIVAGFFGMSLKMAECTLGVKYRKEHADGSVSGGP
FT                   MYYLRDGIAKLGKPRLGKVMAIVFAVCCVGGSLGGGNMFQSNQATALIVEVFGGEDYKW
FT                   AFGLVFAILVALVIIGGIKSIARVTDKIVPFMAVLYITAALVVIFANVSMIPAAFGQII
FT                   SGAFNPEGVVGGVVGVLIVGFQRAAFSNEAGVGSASIAHSAVRTKEPATEGFVSLLEPF
FT                   IDTIVICTMTALVIVITGVWDDPNSSELGGVGLTTAAFQSVLPWFQFVLVVAVVLFAFS
FT                   TMIAWSYYGMKATGYLFGDSAKAENIFKAVFCVFTLIGATLSLGPVIGFSDSMIFLMSV
FT                   PNLIGLYLLARVLKKEINGYWERIQSGEIEMVDKH"
FT   gene            complement(436628..437059)
FT                   /locus_tag="Namu_0404"
FT   CDS_pept        complement(436628..437059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0404"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sil:SPO2371
FT                   universal stress protein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76827"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8X656"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV76827.1"
FT                   /translation="MTSILIGIDSSEASDRALALGLRLARWANAEVLIVHAIPWSPYSF
FT                   QTNEENEFRAGEREHEIQAATTQLLEPALTKAKEAGARADGITRHGHPVEVLVELAEEH
FT                   HVDHVVVGRTGESRMKKVLYGGIPGRLILNSPVAVTVVP"
FT   gene            complement(437222..438535)
FT                   /locus_tag="Namu_0405"
FT   CDS_pept        complement(437222..438535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0405"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; KEGG: ret:RHE_CH00589 Na+/H+ antiporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76828"
FT                   /db_xref="GOA:C8X657"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C8X657"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACV76828.1"
FT                   /translation="MVGSPRTLFSPGTWAEDGRVAHILRKETVGGGLLLLATVVALVWA
FT                   NTAVSESYFQLLDTELGPAALHLNLTVGEWAGDGLLAIFFFVAGLELKREFVAGDLRDP
FT                   HRAVVPVAAAFGGMIVPALLYLVIAGGTGPKGWAIPTATDIAFALAVLAVISTHLPAAL
FT                   RTFLLTLAVVDDLLAITIIAVFYTDDLQPVWLLLALAPLALFTVLVQRRISSWWLLLPL
FT                   AFVTWSLVHASGVHATVAGVLLGFAVPVRARKVRGKDDDRPGMAEHFEHLWRPISAGIA
FT                   VPVFALFSAGVAIGGWSGLRSALTDPIAVGIIAGLVLGKPVGILTATYLTSRLTRRPLQ
FT                   RGLTWPDLTGVALLGGVGFTVSLLIGELAFGGSSAADDHVKIAVLAGSVTAAVLAAVLL
FT                   RMRNRRYRAICEEEERDDDHDGIPDIYQMRTPLDPPES"
FT   gene            complement(438886..439074)
FT                   /pseudo
FT                   /locus_tag="Namu_0406"
FT   gene            439150..439635
FT                   /locus_tag="Namu_0407"
FT   CDS_pept        439150..439635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0407"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; KEGG: mxa:MXAN_6785
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76829"
FT                   /db_xref="GOA:C8X658"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C8X658"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ACV76829.1"
FT                   /translation="MDVTETLLPGVGIRYEFVTRSGAHIGLISRRDGRIDVGVYDRSDA
FT                   DVWIELVRLTPAEADTLAELLGAPRIAERFADLTREIPGLVAAQVEIEPGSTFAGRTLG
FT                   ETRARSRTGASVVAVVRSAGVVAAPTPSQPLTAGDVLVVLGTEDGIAALRRILTGVG"
FT   gene            439641..440807
FT                   /locus_tag="Namu_0408"
FT   CDS_pept        439641..440807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0408"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: net:Neut_0318
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76830"
FT                   /db_xref="GOA:C8X659"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X659"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACV76830.1"
FT                   /translation="MHVSAAFLVEFGILLLILGAVSAVAGKLGLSAVPLFLIAGLFVGP
FT                   GGLLPVPAAAPFLEAGAVIGVVLLLLSLGLEFSADEFTQALRRHTPSGVVDLVLNAVPG
FT                   VVAGLLLGLPVAGVVALGGITWVSSSGIVSRTLSDLGRLGYRETPAVLSVLVLEDVAMA
FT                   VYLPMLGILLAGTAFLAGLAGVLVAVVALIGVLMLSRWSGPVIGWLITHDSDEQVLLRL
FT                   LALTLLVAGAAEYMGISAAVGAFLVGLAVPAEAAESVRRVIGPLRDLFAAAFFLSFGYA
FT                   IDPRDMPPALVVAALLAVVTAVTKVITGWFAARRDGVGARGRRRAGTALIARGEFSMVI
FT                   AGLAVAAGVTEIGPLAATYVLLLAVGGSLLTRLSGQGRDRLAHPHRQA"
FT   sig_peptide     439641..439718
FT                   /locus_tag="Namu_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.584 at
FT                   residue 26"
FT   gene            441592..442167
FT                   /locus_tag="Namu_0409"
FT   CDS_pept        441592..442167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0409"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: dat:HRM2_24220 TRAP-type
FT                   C4-dicarboxylate transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76831"
FT                   /db_xref="GOA:C8X660"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X660"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76831.1"
FT                   /translation="MRASTRCPHAGDGSEAVQRAAMMDIDLAILDIAMPRMTGLQAARE
FT                   ISRRATGLRILMLSMYDNEQYFFEALKAGAAGYVLKSVADRDLVEACRAVRRGEPFVYA
FT                   GALTALITEYLRRSRNGDRIPTSILTPREEEIVKLIAEGHSSREIADTLVISAKTVDRH
FT                   RANIMQKLGMHDRLDLTRFAIRVGLVEP"
FT   gene            442207..442494
FT                   /locus_tag="Namu_0410"
FT   CDS_pept        442207..442494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76832"
FT                   /db_xref="GOA:C8X661"
FT                   /db_xref="InterPro:IPR021401"
FT                   /db_xref="UniProtKB/TrEMBL:C8X661"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76832.1"
FT                   /translation="MPLSDEHRHALDEIERALKKDDPRFAATVNIDQIQRHRRRWTIIA
FT                   AALFLLGVVLLITGLVTSDSYLLVGAIISSIGFLTMPAAIAVFLDHRFNL"
FT   gene            443012..443824
FT                   /locus_tag="Namu_0411"
FT   CDS_pept        443012..443824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21250 gene product from transcript GK21250-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76833"
FT                   /db_xref="UniProtKB/TrEMBL:C8X662"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76833.1"
FT                   /translation="MSAADRAQTAVDERGAAGSGDDLSVLLAAVAAESWGGDAGRRAVG
FT                   IMRSACRREATHWIRTAGWLTDEGLSEVWEQMDRLVRAGRFADAPGLLRVAVRRAYAAE
FT                   AAAAQTCMGSASTRGLIGAVRRADVSVVSALDEDSPAVDAGGLGRPAAPDWMRTLAAVL
FT                   AMEGWPWPVAPLHAVMASAAGAASTSRRCRSAMAAHRTGVPAATWSALDLLTLGSGPGC
FT                   RPEARATGVAMQIDALGAAGVRANPELMRVVRAAVQGRVVRTGRKRAA"
FT   gene            443824..444732
FT                   /locus_tag="Namu_0412"
FT   CDS_pept        443824..444732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76834"
FT                   /db_xref="UniProtKB/TrEMBL:C8X663"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76834.1"
FT                   /translation="MALHSVDGPADAASGSGIDVDAEAGFFEMSPAGAEQVTMQIRSMM
FT                   ERAWEYIAIAYQGRAHIALGYETWDQYVDDRLGDLRLTVPREERGAVVQSLSRAQMSLR
FT                   AIAKVLGVDPATVHRALGADDSAGADDAEELAPVRGRDGKTYPRRRRQRVASACSICGE
FT                   LHDESLDECPWDLFAQGLGPRPVWRGAGLEGPSHDRKGADVMVEEPPEEIEGLAADGHP
FT                   AVGAMDAFPVVTIVDSVTRAVCLVEELDTLPQLVDEIEVAGATAGAGLVDVIRELTRHL
FT                   RAQAATMVALVGRLERLTPPL"
FT   gene            complement(445379..446254)
FT                   /locus_tag="Namu_0413"
FT   CDS_pept        complement(445379..446254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0413"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: gsu:GSU1573
FT                   CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76835"
FT                   /db_xref="GOA:C8X664"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C8X664"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACV76835.1"
FT                   /translation="MSPAPARQVSHRSVWNARPVPAPVRSRRRRLVEGFTFIAVWVGLG
FT                   YLVPGSSETYLLMGIPLTVAFQLFVRRRPLRELWVRRGGARSGLSRRDVAVTALLALAP
FT                   AYWGVKAVGGGNPSVIGWYAAAIVGAAAAAYALRSASVRAVFRSAALATTLGVVGNLVV
FT                   VGGFQVATGTSVDLMALVGSVLRWTAIYFPATFVIEEVAFRGALDSHLHHPGDARGWQS
FT                   ALLVSVLWGLWHLPVAHGMPFPLLLLSLVTWHCAIGIPLSLAWRRSGNLAGPAFAHSAI
FT                   DAVRNGLLGL"
FT   gene            complement(446290..447654)
FT                   /locus_tag="Namu_0414"
FT   CDS_pept        complement(446290..447654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0414"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gbm:Gbem_1853
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76836"
FT                   /db_xref="GOA:C8X665"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X665"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76836.1"
FT                   /translation="MTVPAPTTRTTPVNDDRRPGCWALTRVVLASLAIGATIALVLTMA
FT                   VFPGAAEGVVTGSLLFGFGLGWAALAVISERKTSQPQRWARVPAAAMMATGAGLMVCAP
FT                   QDAALTALNWVWPPLMLALVAWMYARSRRAMPGRARWLLTPVFVVLTLASVGAGVQNVT
FT                   SVGFAQDHPAPGQSYSVGDHRLHIQCHGAGGPTAVLFNGLGEFSGSWARIDDQVSATTR
FT                   VCAYDRAGQGWSDDVDRPQDGIAAAADLHALLAAAGEHGPYVLVGHSIGGPYALTYAAQ
FT                   YPQDVAGMVLLDSASPRQFTEMPAYPTQYALMKRGLALLPTLARIGLGPASTPTSHLPG
FT                   ADADTVDAMGSTVRAKRNGRDELSIIPDLFEQAQTLTTLGDRPLAVVTASENLSTEGWP
FT                   AEQDRLATLSSDSIHSVVNSSHAGVVEDGPGSDASVAAITAVVHAVGSGSPVTTA"
FT   gene            complement(447759..450494)
FT                   /locus_tag="Namu_0415"
FT   CDS_pept        complement(447759..450494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0415"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: pol:Bpro_3193 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76837"
FT                   /db_xref="GOA:C8X666"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C8X666"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76837.1"
FT                   /translation="MRYFRRVLVGREPERQLLGALVEGARRGLAGTLVVRGEPGVGKSA
FT                   LLEELVAGADATVLRTQGVAVEAPLVFAALHRLLRPLARLHARLPEPQARALRIVFGEE
FT                   AGGSVEPFLVGVATLSLLTSAAEENLVLCVVDDAHWLDPATAGALLFCARRLGADRVAM
FT                   VFAARDGAWGSFDAHGLPETVLAGLDPVDSRTLLQERLGSATAADVLDRLVAETRGNPL
FT                   ALMELPGELTPGQLSGSAPLPSQLHLTAQVEQVFLDRSRRLPAAVQTMLLLAAADDTGE
FT                   LEMVRQAATALGLDEADLQAALGSGLLVGGSTSIAVRHPLVRSAIYQAATGAQRREVHR
FT                   VLAVALSGRGDPDRKAWHLASAAQGPDREVVGALQAVGARAQRRGGHAAALAAYERAAA
FT                   LCDDRARRAELTFAAARSAWACGRAGPAQTLLTAAREGADDPLLLGDIARLRGHIEVNL
FT                   GSAAEAHRIFVEAAQQVYPLDAARALDIGVAAAVMRTFGADSGTPLAATHALVAPVGGD
FT                   PPRTRCLRLLLAAMTSVSEGDWSAATVALDLALEVGEQVDDRDLLWNLGNAALQLGDDQ
FT                   AQQRFYGYALSRAREAGAVTAIVYCLQRLCFGYYLAGDLVAVRSSAEEALSLGSSIGQP
FT                   AMTAPPVAWLTLLAALQDRDDYDEQLARLGELVAAHPLGILSDPVHDLTRWAKGLRAAG
FT                   SGDGFGAVHHLARFRMPVLARMAAPERIEAAARAGDAAAATGWTEELARFADATRRPWA
FT                   LATVAFGRALLAGQADAEALFHESLTHHKRAERPLAAARAQLAYGEWLRRSQRRVDARK
FT                   HLREAVETFQDLRAEPLIARASQELRASGETARKRDPTTLVTLTPTELQIARLVSSGLS
FT                   NKDVAAQCWVSPRTVAFHLRNVFAKAGVTSRGELARLDLG"
FT   gene            450572..451228
FT                   /locus_tag="Namu_0416"
FT   CDS_pept        450572..451228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0416"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: pla:Plav_0470
FT                   ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76838"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C8X667"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACV76838.1"
FT                   /translation="MNDTRDHVADDSVPRDPTPGDRRRRQIGILLFDGVEELDAVGPWE
FT                   VLSTWTQQHPDDGWDAFCLSSDGRPVRSAKTLVIGAHHSIDDAPVMDILVHPGGPGTRP
FT                   MLRNRGHLDWVRRQRATVPLMTSVCTGSLVYAAAGLLVRRRATTHWAWLNLLSEMDPTV
FT                   ITDVSSRFVDDGDLITSAGVSAGIDMALHLVARLTDVERAREIRRDIQYNPLPPV"
FT   gene            451284..452255
FT                   /locus_tag="Namu_0417"
FT   CDS_pept        451284..452255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0417"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   scl:sce1535 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76839"
FT                   /db_xref="GOA:C8X668"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X668"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV76839.1"
FT                   /translation="MRAVLQDRYGTAEVLRLGSVPRPVIGDHDVLVEVRAAGLDRGTEH
FT                   LMMGKPYAVRLATGLRRPRNPVPGRDVAGTVVEIGAAVTRFAVGDEVYGVAPGSFAEYV
FT                   AAPESRLARKPASLTFTQAAVVPVSAATALRALVDVGRVQAGQSVLVVGASGGVGSYAV
FT                   QIAKALGAEVTGVCSAPKADLVASLGADHVIDYTRDDFADGSRHYDIVLDIAGNPSLNR
FT                   LRRALRPRGTAVFVGGEDAGALTGMGRQLRGALLSIFLKQRLALLVTKERGSDYDRLTE
FT                   MIEAGQLAASIDRIYPLEDAPHAVRQLQAGHVRGKVAITMER"
FT   gene            complement(452292..453275)
FT                   /locus_tag="Namu_0418"
FT   CDS_pept        complement(452292..453275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0418"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   scl:sce1535 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76840"
FT                   /db_xref="GOA:C8X669"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X669"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACV76840.1"
FT                   /translation="MVTQDRYGPPDVLAVVDRTVPVPGEGEVLVGVHAASINARDWHIM
FT                   RGEPRVARFLDAGTFSPRRPKMPVRGTDFAGTIQAIGPGVTGWRSGDPVFGEAAGTLAD
FT                   HVIADVQHLARIPDGVTFEQAAATPLAGVTALTCLAAAHPKPGQRILVNGASGGVGTFA
FT                   IQLAKAQGLHVTAVCSTRNLQQAEDLGAVDTIDYTVHDFTRDGRRYDIVIDLVGNRRLR
FT                   DLGRALAPGGTLVMSGGGVPGTGRIIGPLGLLIRAQLWSKFTRTRLVAPLGVPDTGNLT
FT                   ELSRALADGDIRPVVESVYPLHDAASAVRHMEIRHATGKVVVTTTG"
FT   gene            complement(453350..454204)
FT                   /locus_tag="Namu_0419"
FT   CDS_pept        complement(453350..454204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BRA0278 nitrous-oxide reductase, NosY
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76841"
FT                   /db_xref="GOA:C8X670"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C8X670"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76841.1"
FT                   /translation="MSTSPVTSHTQPWERPARPPNRPRLDIEPVTHTPRRIPLRRVVTV
FT                   ELRKSFDTRAGLWLLASIGIAAVLTTGAVIAWAPQTEFTYSRFTLAIGVPMTVILPIIA
FT                   VLSVTAEWSQRTGLTTFTLLPHRGRVLLAKGIGAVLVAVAATGVAFTAGALGTIVGAAM
FT                   AGIDTVWDQNLIDVVYFALGNILLILVGFTLGALLRNSPGAIVAYMVYAFVVPGLLAFL
FT                   AFNQAWFRDARGWLDPKYNQDLLLQAGDLTGEQWTQLATTTAVWLALPLTVAVLNLLRA
FT                   EVK"
FT   gene            complement(454201..455195)
FT                   /pseudo
FT                   /locus_tag="Namu_0420"
FT   gene            complement(455299..456042)
FT                   /locus_tag="Namu_0421"
FT   CDS_pept        complement(455299..456042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76842"
FT                   /db_xref="GOA:C8X671"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:C8X671"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76842.1"
FT                   /translation="MSTTIRPSHGAARRPVKDPTRRYSLAGGLFYIATFVASIPAWVLI
FT                   RSSINDDLSFIPGHETQLLWAGIGDWVTAMTGVGAAVALYPVVKRQSQALAIGYVTTRL
FT                   VEAAVIMVGVCSLLAVVTLQDLVGTAGSDPAALTAVGQGLVAVRDWSFLFGPGFMATFN
FT                   ALMLGTIMYRSGLVPRVIPAVGLIGAPLLFAANVATMFGYNEQTSTVTMLATLPIAFWE
FT                   LGVGFYLTVKGFRPCAVTAGLTTVD"
FT   gene            complement(456059..456397)
FT                   /locus_tag="Namu_0422"
FT   CDS_pept        complement(456059..456397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: MGC80202 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76843"
FT                   /db_xref="UniProtKB/TrEMBL:C8X672"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76843.1"
FT                   /translation="MNTPPATRPPEGNWYEIRLHGVLEQRWAAWFDGMNLTANQDGSST
FT                   LRGPLIDQAALHGVLQRLRDLGIPLIAVTALPPAATPAPTQPARPVDPAGPALPPTEPP
FT                   APAHPGTD"
FT   gene            complement(456617..459628)
FT                   /locus_tag="Namu_0423"
FT   CDS_pept        complement(456617..459628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0423"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: reh:H16_B0754 transcriptional
FT                   regulator, LuxR- family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76844"
FT                   /db_xref="GOA:C8X673"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C8X673"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV76844.1"
FT                   /translation="MRSPILHTKLYAARVRGRTVPRPRLTEHLTDFLSGGRLLLISAPA
FT                   GFGKTTTLAQWVQTLSADAATGDRTGTGPAPGQDTGSRGPGDPAVAQTTNPPAVVAWLS
FT                   LDPADNEPGRFCAYVLTAFQHASPGLGADQLHRLEQQAPATTAADATPMIAELLNDIAD
FT                   LPHDVVLVLEDYHLVESPDVHDQLAYLLEHAPPQLHVAVSTRVDPPLPLARMRVRGELT
FT                   EIRAADLRFTAAEADTYLNGLMQLGLTQPQVTALGSRAEGWIAALQLAALSMQGRDDVA
FT                   AFIADFTGDDRYIVDYLAEEVLARQPEQTRRFLLHTAVLDRLTGALCDALTGRDDGRRT
FT                   LEQLERANMFLVALDNQRRWYRYHHLFADVLRARLLDQQPTLIPQLHLAASRWYADDQQ
FT                   PEDAIRHALAGSHMDLAADLIEQAIEQSLRERTEATMRGWLKQLPPDVVAARPALGIAL
FT                   AGATLATGETAGVAQLLNQAEQRLNAPGDAHADTTGRLPGWVEVYRSGLAQAQHDTRGT
FT                   LTHARLALQRLDAGDSTGRAAASALVGLASWATGNLQGAHEAYTAAQSAFKATGYLTDV
FT                   LGCAVVLADIRKTQGRLQSALDTHLEALQYVTTKLHAAEPTQTPPRQGPADTGAAELTG
FT                   LRGIVDTYIGIADIHRERGNPTEATRLLRLAESAGESAGLPQAQYRRHVVQAQIARADG
FT                   DLETADQLLQNAQRLYVADFHPDVIPVAATRARLWVAQGRLDGVFAWARGRALALSDEP
FT                   AFTTEYEHLTLVRAHLAHLSADLSAHLRHHHAADGHPAGDPNRAPGVDQVLGFLDRLLT
FT                   HAEAGGRTGTVIDALIQRAIALRLAAGSRGNRPGQGTDESLRTFHRALDLAEPQGYART
FT                   FLDEGSVVTDLLRDALRAGLNSEYVTALLNQQPHSTTPDLTGTVAPTDAGPQTDRRMEV
FT                   VVERLSQRELDVLRLLATDLSGPDIARHLVVSLNTIRTHTKNLYAKLGVTNRRAAVRRA
FT                   EELHLLQGTVPRRA"
FT   gene            complement(459902..460693)
FT                   /locus_tag="Namu_0424"
FT   CDS_pept        complement(459902..460693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0424"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   atc:AGR_L_50 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76845"
FT                   /db_xref="GOA:C8X674"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C8X674"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACV76845.1"
FT                   /translation="MTAPIRRRRGLTEQAASAAIDTACRQLRLPTVRGLVTDMVTVAEK
FT                   EQLTYQGFLAELLLAECDDRARRRSVRRVKAAGFPREKWLADFDFDANPNINSATIHTL
FT                   AGCGWIRAGQPLCLIGDSGTGKSHLLIGLGTAAAENGFRVKYTLATKLVNELVEAADDK
FT                   ILAKTIARYGRVDLLCIDELGYMELDKRGAELLFQVLTEREEKNSVAIASNDSFSGWTK
FT                   TFTDARLCAAIVDRLTFGGNIIETGTDSYRLARTKAQQAAS"
FT   gene            complement(460690..463864)
FT                   /pseudo
FT                   /locus_tag="Namu_0425"
FT   gene            complement(461208..462596)
FT                   /locus_tag="Namu_0426"
FT   CDS_pept        complement(461208..462596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0426"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG:
FT                   bvi:Bcep1808_0454 transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76846"
FT                   /db_xref="GOA:C8X675"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C8X675"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACV76846.1"
FT                   /translation="MTMTEQSSSVPSSPVDDEVPGPARSTGRQLRELLADDVWLDELID
FT                   RAEAGGVRLTGEGGFLPEMIKAVLERGLAAELTGHLGYEAGDPAGRGSPNSRNGHTPKT
FT                   LSTEVGPVPLSVPRDRKSTFEPRLVPKGQRRLGGLDEQIISLYAGGMTVRDIQAHLART
FT                   LGTELSHDTISKITDAVLEEVKAWQSRPLEELYPIMYLDAIVVKVRDGHQVRNKSAYIA
FT                   VGVDMAGIKHVLGIWVQSTEGAKFWAGVCAELANRGVKDVLIVCCDGLTGLPEAIEATW
FT                   PRTTVQTCVVHLIRASMRFVSYTDRRAVVAQLKTIYTAPTVDAAETALLTFAETDLARR
FT                   YPACLRTWQDAWDRFIPFLAFPWPVRKIIYTTNAIESLNYQLRKIIKNRGHFPNDDAVV
FT                   KLLWLAIRDIEDKRARDRAAEKGKRVGRTAEGRLVEGQVTTGWKPALGALAIQYPDRIT
FT                   PRIS"
FT   gene            464049..465329
FT                   /locus_tag="Namu_0427"
FT   CDS_pept        464049..465329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0427"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ara:Arad_9746 florfenicol/chloramphenicol resistance
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76847"
FT                   /db_xref="GOA:C8X676"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X676"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV76847.1"
FT                   /translation="MRRGPAEPRLPAETNTSGQASGRVGAGVIALYALAFMASCLMLIA
FT                   PLLVTLALKVGDLVGAEAAPGRLALTLAAGSFLALFANPLFGKLSDRTTSRFGMRRPWM
FT                   LLGLAGGTVGIATIAYAQTLIVVVVGWCVAQVFFNALLAVQVAVLPDQVPAEQRGMVSG
FT                   VLGVCVPVASVCGTYLVNVFSPNTAAMFLGPVAVGAVFIVLFAAVLPDRRLTAGTLPRW
FT                   SWREFAGTFYVSPRRHRDFSWVFLSRFLFVMAFAFLTSYQVYYLLAHLGSSQERVPHQV
FT                   FVGTLVSSAGVVVASLLGGKLSDRCGRRRVFVLAAAVVYGVAMFIVGLAGDFSAFLVGV
FT                   AVSGVGLGVYVAVDLALVTQVLPSAAETAKDMGVFNIANALPYSVAPMVAPAILAVSGG
FT                   QYSALFAFAGACALASALAVSRVRAVR"
FT   gene            complement(465497..466090)
FT                   /locus_tag="Namu_0428"
FT   CDS_pept        complement(465497..466090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0428"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; Cupin
FT                   domain protein; helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: dat:HRM2_08460
FT                   transcriptional regulator (Cro/CI family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76848"
FT                   /db_xref="GOA:C8X677"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8X677"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACV76848.1"
FT                   /translation="MDDRAAMIAAALEQVGPRLKRLRTQRQVTLTALAAATGISKSTLS
FT                   RLETGQRKASLELLLPLAMAYNVPLDDLVGGPDIGDPRVRLKPRRVKGRTVIPLTQQPG
FT                   STQAWKIVIPTTKSTPEPRSHEGHEWLYVLSGRMRLVLGDRDLVLQPGEVVEFDTNIPH
FT                   WFGSTGHEPAEVLSLFGRHGEEMHTRVTGDSNPP"
FT   gene            466171..467106
FT                   /locus_tag="Namu_0429"
FT   CDS_pept        466171..467106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0429"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_B2548 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76849"
FT                   /db_xref="GOA:C8X678"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8X678"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACV76849.1"
FT                   /translation="MDEFDVVVIGGGAAGLSAALVLSRARRTVLVVDSGAPRNAPASHM
FT                   HGFLSRDGLPPADLLAAGRREVTGYGGRVVAGTVTDVTACGSDRFHLLLADGSRVSARR
FT                   LLLATGLRDELPDIPGLADRWGRDVLHCPYCHGYEVRDQRLAVLGWIPGAVRYAQIVRQ
FT                   WSGDVAYVTAGEPLTAADRGQLVARNIEVVDDSVSRLLVDGDRLTGLLTDGGRTVPCDA
FT                   LFVPPRFRPHDALLGRLAAHTDQDGWVTTGPTGRTNIPGLWVAGNVTNPRAQVITAAGE
FT                   GSAAAIDINADLVDDDVRQAVRETNHGLLA"
FT   gene            467153..467416
FT                   /locus_tag="Namu_0430"
FT   CDS_pept        467153..467416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76850"
FT                   /db_xref="GOA:C8X679"
FT                   /db_xref="UniProtKB/TrEMBL:C8X679"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76850.1"
FT                   /translation="MNATSATAASTRPAPPTKHQLALMIWLAVFPTLTVLNLALGSWLS
FT                   QLSPVLRTFVLATVAVPIVIYGLMPQLHRLRMMLIARAGGRG"
FT   gene            467440..467658
FT                   /locus_tag="Namu_0431"
FT   CDS_pept        467440..467658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76851"
FT                   /db_xref="UniProtKB/TrEMBL:C8X680"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76851.1"
FT                   /translation="MGSAATQGLIGAVRRADVFAVSALDEDSQMVDADASGRSAAPAWM
FT                   RALAAVLAMEGWAWLAAGRGPASAFAS"
FT   gene            complement(468102..469280)
FT                   /locus_tag="Namu_0432"
FT   CDS_pept        complement(468102..469280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0432"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mlo:mlr0475
FT                   bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76852"
FT                   /db_xref="GOA:C8X681"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C8X681"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV76852.1"
FT                   /translation="MGTIRGAGSLRQRRPGVWEIRVALGPDPVTGRSRVRSITVRGERA
FT                   AAQEARQQWAATAELLRDAGRPRPAITVAQLLRSWLAADHDWKPSTVSGYRSNVSFLCR
FT                   DPIGSRRAIDLTPTVLTAICHHWRDTGWHQPTVSNRFRVLRSAMGWAYTMRILDRHPLD
FT                   GVHGPPQCDSRKDVPIDQVRDLLACTKEQADQLSTRLVRSGRDTARRHRAEQLQLLSRL
FT                   VADSGARRAELAALRFDDLDGRVLTIARATSNEILGTTKGRRTRRITLGPTTVDLWTDL
FT                   TNRWRSRCPAGAEFGPWVFSRDPAHTTRLTTSTLGHWFSDACDRAGHPDITLHRLRHTV
FT                   ATALVGQGQVLQAQYRLGHRDASTTLRIYSHALPAADAQAAATIENMLAAGG"
FT   gene            469681..470493
FT                   /locus_tag="Namu_0433"
FT   CDS_pept        469681..470493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2916 PBS lyase heat domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76853"
FT                   /db_xref="UniProtKB/TrEMBL:C8X682"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76853.1"
FT                   /translation="MCAADRAQTAVDERGEARSGDDLSGLLAAVAAEGWGGDAGRRAVG
FT                   IMRSACRREATHWTRRAGWLTDEGLSDVWEQMDRLVRAGRFADAPGLLRIAVRRAYAAE
FT                   AAAAQTCMGSSSTRGLIGAVRRADVHAVTGLDEESQVVDTGGSSRPAAPAWMRTLAAVL
FT                   AIEGWSWPVPPLDAVMASAAGAASTSRRCRSTMAAHRTGVPAATWSALELLTLGSGPGC
FT                   RPEARATGAAMQIDALGAAGVRANRELVRVVRAAVEGRVVRTGRKRAA"
FT   gene            470493..471419
FT                   /locus_tag="Namu_0434"
FT   CDS_pept        470493..471419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76854"
FT                   /db_xref="UniProtKB/TrEMBL:C8X683"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76854.1"
FT                   /translation="MALHSVRGSDGFGADEGVDVDADAGFFEMSPAGAEQVTLQIRSMM
FT                   ERAWEYIAIAYQGRAHIALGYETWDEYVDDRLGDLRLTVPRQERGAVVQSLSRAQMSLR
FT                   AIAKVLGVDVATVHRALGADDPAGAAGREGVDDASPIRGRDGKQYPRRCRPTAMAVTCS
FT                   ICGEVHEGDPDECPWDLFAQGLGPRPVRQDCRSGASVDCREREEVVEVAVTSDHPEEAG
FT                   ATSSPDSTIDEEVQAATIVDSVTRAVFLVGELATLPELIEEIELVGVSAEPAELAAGIR
FT                   ELIEHLRVQAAAIVTLADRLERIAPQR"
FT   gene            complement(471851..473371)
FT                   /locus_tag="Namu_0435"
FT   CDS_pept        complement(471851..473371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76855"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C8X684"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76855.1"
FT                   /translation="MDASLPSWDQLILNLASENLGDNERRVFLTLNYDGLERRAETILH
FT                   LSKKARPAKQFDELIRDSLLKDPDELAPGELAEGIARLSQAYPRRTSILTTNYDWILEL
FT                   AIEGLGIKASDSHSFDSWDEWEHLNDADHRSNVMHVHGMLSRPSVGKREPLVLSENDFL
FT                   MHGPEIRTRLLDSLRGKLVVMLGVSLTDSNLLAPLHQLNGADGERYVVIVPPLCHNNLT
FT                   QLECAEYAVAHSESLAKYLNVRPIILKSFGQVAQLISDLGLAAREPALYRRPSGSLRVS
FT                   QSLMYGTRFTAALKDAYTSVGASARSGNMRDWDAVGLSNFMHELANSRGGPVKFLDKIR
FT                   LHHRGKCDVSENLGVFLWLRDLPNRPESIYGLRLIASSAYAHWKSWSSFRVEPIRSDSR
FT                   HAAVQAVFFNHAQGVNIDPDSHSGAWKGAFAIPLSIYDYRSTATVRGWSLDRLTIGALA
FT                   VNSDHFVDASSLDSPNPNQLSALSVLTQRELEGFAASLYKMAERIFGD"
FT   gene            complement(473974..474771)
FT                   /locus_tag="Namu_0436"
FT   CDS_pept        complement(473974..474771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0436"
FT                   /product="FRG domain protein"
FT                   /note="PFAM: FRG domain protein; KEGG: ppd:Ppro_2571
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76856"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:C8X685"
FT                   /inference="protein motif:PFAM:PF08867"
FT                   /protein_id="ACV76856.1"
FT                   /translation="MTIPTITPASWSELHDVLFDEPWPVHAGEFHSGLIHRGMTDYSWP
FT                   LMSSLDRLKLFTMEQHLLRNFQKYARLANFSPDRTWEWLAVAQHHGLPTRLMDWTYSPL
FT                   VALHFAIANPAYPRSSVVWSLDYVRVHSRLPTMVRSAIRGDAAAFTTDMLDRASIPVWP
FT                   KDWQELTDAYMVILEPPSIDDRIVNQYAGLSAFSSTKVAIEDWLATFSEPVALKIEVLP
FT                   HLKAEIREKLDKANINERVIYPGLDGLATWLTRYYSTPARTWI"
FT   gene            475240..475635
FT                   /locus_tag="Namu_0437"
FT   CDS_pept        475240..475635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76857"
FT                   /db_xref="GOA:C8X686"
FT                   /db_xref="UniProtKB/TrEMBL:C8X686"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76857.1"
FT                   /translation="MFRFLSAPDETTAPASPAPAGGGNPLTGATETTLPGLATFKGLVL
FT                   GLIPYALVACVAAFLIGAILWAVGAFGHNPQHSSRGKTTLIVALVAALLVGGAAYLVGW
FT                   FNNVGKSVSAPAPVTQLVEPAAPFLSA"
FT   gene            475756..477126
FT                   /locus_tag="Namu_0438"
FT   CDS_pept        475756..477126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0438"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   sun:SUN_1976 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76858"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C8X687"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV76858.1"
FT                   /translation="MTKSCTLDRLSVRADEDSVVSDAGLLVAATLAQRLDLAGLLREHV
FT                   TVPGSVGAHPDRKCLTVVHSLLAGGDCIDDVNALRAGSTSAVLGHRVAAPSTVGTFLRA
FT                   FGFGHARQLDVVTRRLLTRAVTAGAHPQFGRSVTVDIDSTLCETFGLAKDGAREVMRTG
FT                   RRGYHPLLAVISGTGDIAHARLRRGRSNDATAAPLFINETISRLRQAGATGQIVLRADS
FT                   GFYLHDVVAACRAADVRFSIGARMIGHLRGQIEAIPDEQWQPIEYFLPGAGVAEIPYTP
FT                   FAQDTHGRDRTDTVPLRLMVRRTPPTQAQVRNRGQDTDQAALFPVYDYHPIITDRDGDL
FT                   RDLEADHRRHAEVELTIRDLKHGMGLAHLPTKSFGGNAAWLILNTIAHNLTRWITRLGF
FT                   DQGHRMTKNIRRRVFNLAGRLVRTGRRTTLRLPSRWPWAHAIITAIKRLRDLPAATG"
FT   gene            477286..477993
FT                   /locus_tag="Namu_0439"
FT   CDS_pept        477286..477993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76859"
FT                   /db_xref="GOA:C8X688"
FT                   /db_xref="UniProtKB/TrEMBL:C8X688"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76859.1"
FT                   /translation="MLTPARSGGRRRWVLVAGGLGLAGLIVVTAVVAWSSKDPAASHAL
FT                   TTPASGAPSATAGVSRQSVSVSSSALLPGGRPDSTLVGGQTDHLVFARLVAQALLAYDP
FT                   STDFTARNQDLLNAAAPAPYGDEARLAQDLTALTPSGPALDSMRKNRTTVTLDLTDVEV
FT                   SVWAANRLAGIGASPGVYGIDVTGQQTITTKGGPPTAVPVALGITVACPPATTFCTLDG
FT                   VLPAHLQDALGSK"
FT   sig_peptide     477286..477387
FT                   /locus_tag="Namu_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.511 at
FT                   residue 34"
FT   gene            477990..479168
FT                   /locus_tag="Namu_0440"
FT   CDS_pept        477990..479168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0440"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76860"
FT                   /db_xref="GOA:C8X689"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C8X689"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ACV76860.1"
FT                   /translation="MISTVRRVQLIAPATVTLLVAMAAVVTVAAVAQPNPSVAVPGGSG
FT                   CVPVTGSTGGVLAAAQERNAKVVIGVALARGLGSTGAAIGVSVALAESTLFNYANDGTS
FT                   TLVGSAEGRQLTDAERAVARQSLAFPHDRVGNNLDSIGLFQQRPMTGWGTPAELIDPAI
FT                   AAGKFYDRLVQVPGWQGMPPWNAAQTVQGSPSSDGGIYRDMYTQATGIVANLTTDTGGT
FT                   SATVAPVAAAVGPGCGSAEVAHVAVTGGGGSAAWGGYQNGRIPAAALCPVPSAPGLLLE
FT                   CRAAAAFDELNAAFRAVFGQDIGITDGYRSYQEQVACRAEKGSLCADPGTSNHGWAKAV
FT                   DIGACCGVNTGSGAAFDWLTANAGAFGWVHPPWAQPGGSKPEPWHWEYGAIS"
FT   sig_peptide     477990..478088
FT                   /locus_tag="Namu_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.887 at
FT                   residue 33"
FT   gene            479165..479908
FT                   /locus_tag="Namu_0441"
FT   CDS_pept        479165..479908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76861"
FT                   /db_xref="GOA:C8X690"
FT                   /db_xref="UniProtKB/TrEMBL:C8X690"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76861.1"
FT                   /translation="MNWQPQSGTEAITGWINQGVLFALVLAVAAVVVCAATWAVGSLAA
FT                   NGAVVARARTGVAVSLAAALLLGGGVTWVHWTDTQAAAFAGDPKDYGIEDAPQTPAQWE
FT                   VLDLSEWWTGNINTIRARDGLPPLATDGGLAERARSCASSRAGQGGDCPRNYFSCRQDT
FT                   GMVYAAWDYGPGDLDKLNQDLAEAFIRSPNPWGGDDTHRTLDPSTDMRSAWVALRDNAN
FT                   KKAVVVALLENRAGLAEWNECGTFQ"
FT   sig_peptide     479165..479299
FT                   /locus_tag="Namu_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.504 at
FT                   residue 45"
FT   gene            479943..481400
FT                   /locus_tag="Namu_0442"
FT   CDS_pept        479943..481400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afe:Lferr_0251 P-type conjugative transfer
FT                   protein TrbL"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76862"
FT                   /db_xref="GOA:C8X691"
FT                   /db_xref="UniProtKB/TrEMBL:C8X691"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76862.1"
FT                   /translation="MTTMLAVDGVQDWLSDASDDVLKRIAAGAVNANQWMMLKAIDQIN
FT                   SGLRINLGADWLQDVLGMMRYLVLPVVGLLFVFQVVTAMLARSPSGLWRAVWGSALGLF
FT                   LGSACAVLTAGLLLIVDQFSNYLLGGAQAAAQDGIKKAFAMQGAIEGSGWLVVTLLAGF
FT                   GILAWATIIIILFLRKAMIIATLVFAPFAMAGLAYGKTKSWAVKWVELVFALALSKFVV
FT                   CVILTLAYSAVASSVTGDISDALLGSVWVLLAAFSPLAVLQFVHFASEQITAANTTGTA
FT                   AALRNAGRGLGMTRHGTAALAGGAGAVGGWLAGKAASGGKANQPTSPASAVGGRPAVAA
FT                   GAGAGKANVGGTVSGTGGSGSGTGSPLAGGDVSSPAAPSDVEPVGSSPAAATGSPVGES
FT                   PDAVQWPRLQEHFNQVAQQGGHHPSVHPAGAAQTLGIPRSQAERMFLVAETQGLLGPQQ
FT                   VDGSRRLLTTTPASTPILTPTPGGSRA"
FT   gene            481397..482860
FT                   /locus_tag="Namu_0443"
FT   CDS_pept        481397..482860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76863"
FT                   /db_xref="GOA:C8X692"
FT                   /db_xref="UniProtKB/TrEMBL:C8X692"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76863.1"
FT                   /translation="MTITEKPTSTPRTARLARRSRRGLILNLTAPQAITLFAAVVLVAA
FT                   AVPTFGIGAAFWVALLVGGPLAAVALVRWDGFPLVEWSPILWHFWRRKRTRQNGFRATA
FT                   TPRSAGRLALPGQEARLVTLTASDGSVTVHDPWTGGYTAVLRLRAPAFLLLDPETQDAQ
FT                   VNGWGRVLAGICQSNLISRIQVLEQCVPDSGDGLRDYHAQHADGQDLSVWAAENYRDLM
FT                   DIAGPASSRSDVLLALTLDAKRCRGLIRKSGGGHTGAVKVLAGQRRVVEAALAASSLAV
FT                   EGWLTPAELAYELRCAYDPAIRPMLDYTPTVGRDLTAAGPLAVQEHWDYLRTDTAYHCV
FT                   LWLIEWPRSLVYPTFLAPLVLTPGIDRRLSLIYEPVPTGKAMKQVQHDKTELISNAHDR
FT                   HRLGQVENLADTDELSDTLQREAEINAGHGDIGYAGLLVVSAPTLDQLTLAVGAVRQAA
FT                   IQAGCEARVLAGQQLQAFAAAALPLTRGF"
FT   sig_peptide     481397..481534
FT                   /locus_tag="Namu_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.303 at
FT                   residue 46"
FT   gene            482863..484392
FT                   /locus_tag="Namu_0444"
FT   CDS_pept        482863..484392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X693"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76864.1"
FT                   /translation="MRENNTATAHSGGYLPDEAKRKDRRTARRDWRAAADQLVREQQDL
FT                   AAAAKAAEVSMRRAEYRSRTPKAGEKRSWAGRTAHGLKLRKHRATTANLSHVYPFLADG
FT                   GLGSTGVYVGRDSYSGASFCYCGFDLYNRRPRLVSNTNIMMVGNIGWGKTNTAMALAVR
FT                   NLPFGRRIVVPGDPKDDWLRLAIALGGQGIRLGRGLPARLNPLDGGVKPAGKDPAMWER
FT                   EVWSRRQKLLVALVATAAPAIAPLEPLAVAALDLALAAAVQHSGTPTLPDVAHHLAAPD
FT                   PDRAKLAGYDAELLRHRGQPVYAVLSSLINGHLGGLFEGPSTVRFDPLAPMIALGSAAL
FT                   GDDDLLQSLVMLCCSAWVGSTMSDPAFGQRLFVYDEAWRIISGEAQLDRMNADLRLSRH
FT                   YGIANILAMHALSDPDKVGHADSAAVKKAQGLLSLCDTRVVFRQAPGELDRATADLALT
FT                   QAEREVVAGAGVGEALWKLPTKSFRVQTILSDREKQMFNTDQRMTNISKAL"
FT   gene            484400..485149
FT                   /locus_tag="Namu_0445"
FT   CDS_pept        484400..485149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apa:APP7_0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76865"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C8X694"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76865.1"
FT                   /translation="MFKTIALLTHRTPDRAGTSIDDRTSIAATARVAAGALVQGEAVVG
FT                   GSAVALGTVTVTDRAQLVEHGMLGGTARLQGRGVLSGWAAAIEQAVIDGDAWVFGRAVV
FT                   SGRASVAGHAQVFGDATVTAGAVVDGHAWIHGHATITGQAWVSGRAQVGGHALVCGTAS
FT                   ISGALRIGGHTVIGDGADITRPADVETHRLSWGEYVTLYRCDDGTVGLGRSENNHGPVT
FT                   LGRTHLPDGRLTALIEELTELWALARA"
FT   gene            complement(485158..485358)
FT                   /locus_tag="Namu_0446"
FT   CDS_pept        complement(485158..485358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76866"
FT                   /db_xref="GOA:C8X695"
FT                   /db_xref="UniProtKB/TrEMBL:C8X695"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76866.1"
FT                   /translation="MPHASDTTTRGWTIARYVGNGVLIVLGTAAAAVVLYFLVVIGSLI
FT                   LGLVLGLWLARVAARMMSGMY"
FT   gene            complement(485342..485626)
FT                   /locus_tag="Namu_0447"
FT   CDS_pept        complement(485342..485626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76867"
FT                   /db_xref="UniProtKB/TrEMBL:C8X696"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76867.1"
FT                   /translation="MNPMYTITITVLGTDAETSLREDVQSTIEVLRDGLDQWVEPGRKV
FT                   RWEIRCPSGRVTAGQITVYDGANTVRDVDRHLQTVRQVLTEEATDAARI"
FT   gene            complement(485736..486332)
FT                   /locus_tag="Namu_0448"
FT   CDS_pept        complement(485736..486332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76868"
FT                   /db_xref="UniProtKB/TrEMBL:C8X697"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76868.1"
FT                   /translation="MSVHHGRDPIAAAVRRATQTRAEKPPSAGQQIMATVDIAGEQDLR
FT                   VDTHGSGNRKDWGGHIAVSTDNLLIYLHDQLAARQYAVAWIDAWYNASRLPKTVTTGPS
FT                   DHGPVMMVRAHGTDTVDHVFDATQNLAIIRIGGLTWRIHDQAAWATTERKWREVSALAP
FT                   LVLPVNRYQAAKPRPTKDHEQRPAWAEIRGPRPTL"
FT   gene            complement(486329..486799)
FT                   /locus_tag="Namu_0449"
FT   CDS_pept        complement(486329..486799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76869"
FT                   /db_xref="UniProtKB/TrEMBL:C8X698"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76869.1"
FT                   /translation="MTGDVERHHAQLRAWAKGIYGLEAATELLIRGFDGRFADPGCPWV
FT                   HPTGSGHWIDFDAIPALMGALSGGEQRFLQIAASLSGNDTEVNLGGALAGLDRTHLHLV
FT                   LAGVAHASGTHEQQELTVRADGTVAFARPGAIYRRDQTEPAETACHPGGIGR"
FT   gene            complement(486799..487035)
FT                   /locus_tag="Namu_0450"
FT   CDS_pept        complement(486799..487035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76870"
FT                   /db_xref="UniProtKB/TrEMBL:C8X699"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76870.1"
FT                   /translation="MGYLVRTITAMQLQLGDVVIPDTGPRRHVTLHRLQGAHPVVAVQF
FT                   AEIPGATSYYPPTMPLLIEIPDATTSLPVGRSM"
FT   gene            complement(487124..487375)
FT                   /locus_tag="Namu_0451"
FT   CDS_pept        complement(487124..487375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76871"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6A0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76871.1"
FT                   /translation="MATSQHHDPTEYRTVRIPGSTDHAGQYLITVTLRWVCPTCGGPRG
FT                   QLRPAISYDGSRRLAFDGWTNPCGHVDFYADVRAEAGP"
FT   gene            487778..489643
FT                   /locus_tag="Namu_0452"
FT   CDS_pept        487778..489643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0452"
FT                   /product="Type IV secretory pathway VirD4 protein-like
FT                   protein"
FT                   /note="KEGG: rle:pRL100217 putative conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76872"
FT                   /db_xref="GOA:C8X6A1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6A1"
FT                   /inference="protein motif:COG:COG3505"
FT                   /protein_id="ACV76872.1"
FT                   /translation="MLTSKTKTPHRSADIDRLLVGVVLLVGVGGLLLWVGGQAASLLTG
FT                   NGFAAGPVTAGARALLADRDNPSAAWDSPMPDPAAYWWITATVTGLLLALGALGAVGFA
FT                   KVRGRVRLRGRLSEMATRPGMATSRDIKATVGPKRLRRSAPELRPTLAGRIGPRELGWC
FT                   WGTARGVGVWTSVRDSVVLLGPSGAGKGVYVVNNRILDAPGAVVATSTRPDVLSVTITH
FT                   RRNAGPVAVIATDGSMDGLPEIVRWSPIQECRDGRVAAARAQVLAAGSSSGVEDASFWQ
FT                   GWTEKVIKTLLHAAAWSGTGIDDLWRWSQSAVAARSALAVLQDLDGRDTGTGQRVEPGW
FT                   ADTLAQVVEGDDKFRGNLWAGVGKALAGLDLYSVRRRFDPRPGENFDPTAFLADRGTLY
FT                   LLAEADDPASRLLQCLVADITRTAKDLADHSPKSRLDPPLTLVLDEIANWAPLPALPTY
FT                   VSAYGGSGVVTIAVIQSRAQMARSWGSDAAKAIWDSATITGILGGVTDAENLRDFAAIA
FT                   GDRDETSWQASTGKDGGLLGLGSGRSYSEQTRTRAVLTTGEIRGLPEGTMLMFYKGLDP
FT                   MLVRMTAYYRRKERKTLLAGRAAIEARISETAAAGPVVAEPAEET"
FT   sig_peptide     487778..487897
FT                   /locus_tag="Namu_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.514 at
FT                   residue 40"
FT   gene            489645..490007
FT                   /locus_tag="Namu_0453"
FT   CDS_pept        489645..490007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sed:SeD_A2279 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76873"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6A2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76873.1"
FT                   /translation="MRPPRPGSAWRPSRWARRGWYADYMNSPAWVARKRQWFREHWEQT
FT                   HQPAACVICGRRPVDLHHMDYGRLGNEKNSDIICLCRAHHDRMHAAWDATPHLRRLGRR
FT                   AATVILVQAMRRGPDR"
FT   gene            complement(490142..490609)
FT                   /locus_tag="Namu_0454"
FT   CDS_pept        complement(490142..490609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0454"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76874"
FT                   /db_xref="GOA:C8X6A3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6A3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76874.1"
FT                   /translation="MSDFRFRFVKLPVTDLVRSAAWYRDVLGLRRQFEFAEHGQVRGVQ
FT                   LVDATGGVTIALRDRRYCADQPRLAGFDVVSFRATSRDTLVELASRCDRLDVRHADIQD
FT                   LPPFVSTLDLYDPDDTVLRFAFDHPTAPKGFVGVDVGDSGPTLYSEPRLDY"
FT   gene            complement(490771..491655)
FT                   /locus_tag="Namu_0455"
FT   CDS_pept        complement(490771..491655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76875"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6A4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76875.1"
FT                   /translation="MVVCWDDLDPSTYAHQLTELTDWISWLRATYRIPATVLPPCWFTH
FT                   PGLREDIGHLWTGWLLTRHPDAGVGMIGLDWDQRREAAISRLREATAITGCTATRHQAE
FT                   PEPPPAMSASAEQLWQNHLDTQTRQRVHAVARQAAVDQAVAILQAAELRHELAPAVLAA
FT                   VADDPANAGDDDRARVAERLRQLADDAVERAAQSALDAVRTVLDAHQHSAREGLVAEAR
FT                   DDLAHLFATATPTDQAPAGSDELAQRWLDALEKLLPAVIAADRAAAAANARTAAVDQRV
FT                   ARRRRSDIDDLLP"
FT   gene            complement(491715..492662)
FT                   /locus_tag="Namu_0456"
FT   CDS_pept        complement(491715..492662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76876"
FT                   /db_xref="UniProtKB/TrEMBL:C8X707"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76876.1"
FT                   /translation="MNAAPVDDVDHNEHFTAHVLQSLREDFRLRADEARLAFDRYLQRQ
FT                   TRRATPDEAAYDAYRWWTPTVEPSVVLAREAEQRAHAQSAGDQVPDRAEPGPVESVPVG
FT                   DDADVTRADAVETDLAAAEAALSLIRGQGQRRGFTGEHVELAGHVKQVLDESAVWDTIT
FT                   PDDQPDPAGLEPALRPETVRPGDDWDDIIALDASFAGRTVTVLRPPGQIGPFSYVFLAD
FT                   TPGTRFTKQGADTGTLGMIAAGDGEPDPARSAEYDDLGQQVRRHLIGLVDAVAEAREQG
FT                   QEQEGRRLHAAQTGLGGVAEAAYQRPQPARGTSR"
FT   gene            complement(492659..493351)
FT                   /locus_tag="Namu_0457"
FT   CDS_pept        complement(492659..493351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0457"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: wsu:WS1872 single-strand DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76877"
FT                   /db_xref="GOA:C8X708"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8X708"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACV76877.1"
FT                   /translation="MSARITIEGNLTADPDFGVSNAGTSWARLRVASHDRVKRNGVWTS
FT                   TDPEFFNVSLFGRAAEDAGDTLHKGDRVTVEGRPELELFDRRDGSTGAIVKVYARTVTL
FT                   TINDESPAVGSGRDVAADTTPTIHHTSEATMVVGVGRTATALHRTLKDHGFRWTAATTS
FT                   WNLPTDMDVHTRTARVSDVVSVVRENGRDIPVVNDPAPAAAPAMAVPTAGVAPSPVLDP
FT                   APANGRSL"
FT   gene            complement(493530..497239)
FT                   /pseudo
FT                   /locus_tag="Namu_0458"
FT   gene            497804..498319
FT                   /locus_tag="Namu_0459"
FT   CDS_pept        497804..498319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76878"
FT                   /db_xref="UniProtKB/TrEMBL:C8X709"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76878.1"
FT                   /translation="MIGDGLVVALALQTQGAADLAGGCAQALRQRGWDGDEELADQLGA
FT                   LLGTGPTPLLRPLPVDLEELAGVLEGDPTFGGGRVDRLTGQVWPQAAIDYARETGEEDE
FT                   DGSDDAERWLWVHCEGSRAGYHDMVQFIGTIDDTGRADRLGIAIEGRGAFRRFKDVLAR
FT                   WPGELDRW"
FT   gene            complement(498899..499492)
FT                   /locus_tag="Namu_0460"
FT   CDS_pept        complement(498899..499492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76879"
FT                   /db_xref="UniProtKB/TrEMBL:C8X710"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76879.1"
FT                   /translation="MAALREFLRAADPTLVTDNTEALNTDPRLSVTGDEVWDHAARLIV
FT                   PDPVRDAILMLERTFPDIDVLNAGPTRFDLSGRFSNPSRAAADALVRLEAFPSICVVAR
FT                   GRENRVAALARHQNVLLWIELRPNHNVWYRTYRLTGMRNALGIVNDNETARAARLSEPP
FT                   WTVVPQSARSVLHALRLDEQEFRDWQFADKGARY"
FT   gene            complement(499930..501249)
FT                   /locus_tag="Namu_0461"
FT   CDS_pept        complement(499930..501249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0461"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: pmy:Pmen_4491 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76880"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C8X711"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACV76880.1"
FT                   /translation="MDQSSSLLLDIDGLVVDQVVRDDVGRRVVHCSTDPQLAGWCPECG
FT                   EQSRSPKAWVTTRPRDVRLGEDRPILLWRKRKWRCQVDGCERKVFTECLPEQIPARARI
FT                   TTRARRLAAEAIGDHTRPVSGVAAEFGMDWRVAHDAFVAHAAQVLPEQPPPVTVLGVDE
FT                   TRRGKAHYETDPTTGAKTWVDRFDTGLVDLSGNGGLFAQVNGRTSKVLIEWLQAQDPDW
FT                   LANITHISMDTSATYARAARLALPDAVVVVDRFHLSALANKAVTDYRRELAWALRGRRG
FT                   RKSDPEWAQRNRLLRAAESLTDDELAKVQDAMRRADPSGGLEKCWQGKELLRKLLKLAG
FT                   TNPDRGRIFNALTAFYLHCADSGVAQLRRLAWTVHAWQNSIIAGLHTGISNGRTEGYNR
FT                   IVKHIGRIAFGFRNQDNQKRRVRYACTRKSRASTSHAKPC"
FT   gene            complement(501313..503091)
FT                   /locus_tag="Namu_0462"
FT   CDS_pept        complement(501313..503091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76881"
FT                   /db_xref="UniProtKB/TrEMBL:C8X712"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76881.1"
FT                   /translation="MPDGPTHAAVGAHVGGANLYAALYAESIQDDRQAREALFLTFNVD
FT                   LGFFEQRVLGLCRGAGAAVTVVADASIYAPDVRAVHGAGTSYIVGLASMRGAFHPKLAI
FT                   LVGPERAVIGIGSGNVTVGGWHGNDEIFCVLRASVVDGVPAAVGALAGFLDRLPEVVDM
FT                   APSAAIATRRTSAELATLASRGRPLSTGPRLVSTLDRPLIDQLPAGKVSTLALYAPFHD
FT                   PRGQALAALLARYAPDEVRIGVQPKSTVIHPAALVDVAAAAGVKLTFHQLEDVPYRHGK
FT                   LIQASDQDGIAWSLTGSANLSAAALLGAVGQGGNCELGLVTERSAALYPPAVGELGHHE
FT                   IEPRTIGPASIEGAPPASSSASHLLEAAVEGAQVRLSLSRAAREPLVVEASAYEDLPHN
FT                   YRGWAVIPADQQQVRVARPEWLTAGSRIRLGRSPGGSPRDVFLLDPALALRRVQPGSSQ
FT                   SNTALQPFDIFADPGQAERWMAGMYKLLASQRITQTSRPRGASTKSVNQSEVRIPATTG
FT                   WRTWDDPDEWARYSENAAIRLGEPLYRLGLGGLPRLKAKADTAELPGGRPIWDDRISGS
FT                   SDLIGLRASDLRRRVG"
FT   gene            complement(503099..504559)
FT                   /locus_tag="Namu_0463"
FT   CDS_pept        complement(503099..504559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76882"
FT                   /db_xref="UniProtKB/TrEMBL:C8X713"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76882.1"
FT                   /translation="MVDNMGLFPLAVERYLNRAVAIHAPGVTTVTNAARYYALHGLVAS
FT                   EAVTRGLSNSEAQHLLRRCEVVLGMATIAHQDADDHDRRWSPDAHGGDYLRRVVRTGPV
FT                   ELTAAAGDDGSSYARAKWGFWGPYRGSEMTLQVLSTDSLTPGPAYRDAETRAVLGPILE
FT                   IAASATALARSDFVGLEHLCLCQTNLGQDAAWLSHRFAGDIVAGGVAGVLGQTMRIIAS
FT                   AITTTAINSEDDVADFIRYDHRLLTHPRLVGHDATRRWRGITLRHQSVRAWRYLWEQIC
FT                   GHIEAKGAIFLDELRHWFMDAAPDASVDSFVASLPATSNTNGQPLPAESHATNVSQDIV
FT                   IQCLSVLALGARRLRELDGLELLGFQGEPHAAAAVEELSPHWMAASLNSWADRPMTEFY
FT                   GHLLDVLLNRSQRVAMRKSTFDTKTGRFVFPARIHIRDGIAFSVFPERARPPVLRIERL
FT                   MFMGEQVGLFARDNDGRWQLGDRGELVA"
FT   gene            505454..508588
FT                   /locus_tag="Namu_0464"
FT   CDS_pept        505454..508588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0464"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   bps:BPSL0763 putative helicase SNF2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76883"
FT                   /db_xref="GOA:C8X714"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C8X714"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACV76883.1"
FT                   /translation="MTTTTDVKNELASGRVVQVRGLRWVISDVVPFSSAGSGGRPTSTL
FT                   VELQSVEDDRFNEALSVIWEVEPDARVLPTSSLPDPNEGFDQPQRLAAFLDAVRWGAVA
FT                   SADVNALQAPFRSGVRVEDYQLEPVARALTAPRVNLLLADDVGLGKTIEAGLVAVELLL
FT                   RQRARRIMVICPAGLTVKWRQEMAEKFGREFTVVNSEQCAVLRRTHGSAANPFRVYPLT
FT                   IVSLPWLRSPRGQRLLDEVLPVEGPADTREFDLLILDEAHHVAPAAPKQRYAVDSQQTK
FT                   LIRRLAPHFEHRLFLTATPHNGYPESFEALLELVDNQRFARGVPPDRQAQREVVIRRLK
FT                   TEILEPDGSKRFRQRRTEPLPVQYPEDERQGHALLTEFAAARGIRLKTNRRGRRAADLV
FT                   TLLFKKRLFSSPAAFGRTVAVYRENQLAGSPSASSDAEPAWMDDFLGDIADLDDEDMAD
FT                   EEDDAVRRATVLQGGPSDTELELLERLRLWAEAHTPNPDAKASELLTYLRAVCHPDRDW
FT                   TNERVVVFTEYRDTQDWLVRLLQQDGLGAGVRVLHGGMNPVERENLRQAFQADPTEDPV
FT                   RILIATDAASEGIDLHWQCHRLINYDIPFNPNKLEQRIGRIDRYGQRFDPEVFHFVGTG
FT                   FGRAVDTYEADLEFLARVAEKVARMEEDLGAVNAVLADAVQRRMLGQHVDLDHAVEEPR
FT                   RTRKGRVASDADIAGQVQRLHDQLTDSVAALNLNPQSLKRVVDTALALSHQQSLTRAND
FT                   PDPVWDVPALTGTWEITTRDLPHPLRPDQRRPVTFDPEIAARRREDVVFAHLGHPLVTR
FT                   ATRLLRAAVTSTDIDLHRVAAVLSDDPGLEDTLAVSYARFLVVGGDGARLHEEVLHAGG
FT                   WVRPDGRFARVESFARLDAQLTAALAQGRSAPRQWTNRLAAGWSATQRGLFLALERRAA
FT                   NRRTTVGNLLDRRSQAEEDRITTNLDSFAKSLRQRLSEADDEGTEVGLFARHLADPNEA
FT                   AQFRRDRQSWEERLDRLPAERDAEISRIAARYAQPADHLFPVAVIFVVPTRLVTR"
FT   gene            508585..512628
FT                   /locus_tag="Namu_0465"
FT   CDS_pept        508585..512628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vei:Veis_1179 hypothetical protein; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76884"
FT                   /db_xref="GOA:C8X715"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8X715"
FT                   /inference="similar to AA sequence:KEGG:Veis_1179"
FT                   /protein_id="ACV76884.1"
FT                   /translation="MTGRPRRPAGVSVSRDEHLAWLALTEISGPFLTVPVLSRVWPTLE
FT                   ALDKPTRHALSLAHISGEDDPAVWIDWVLTGLLQWGDALDRALDIRVAVAEHDAEVVAS
FT                   FALRDPATSTAVLLGMVTPPGRLPTARVPDDNWPATPADRLALLCRSQDVPLGLVTDGR
FT                   WWALVWAPRGGVTTTAVFDSITWREAADRIVVRAFKSMLERRRFFGVPDDQRLPALLVE
FT                   SGDNQEEVTEQLGVQVRQAVELLVQAIGRDEQRTVDAGGTGLEATASEVYTGAVTVMMR
FT                   IVFLLYAEERRLLPSDSPVYQTAYSAARLGEQLQKRADEAGEESLQSSHTGWYRLLALF
FT                   NAVYAGIDHPQLTLHAYDGSIFDPAAHPWLSEVRVDDQAVLHMLAAVQRVTINRETRTL
FT                   SFRALDVEQIGYVYEGLLSFDAYRADDVVVGLVGKVGLEEEVRLTDLEAMWDDSADDDA
FT                   FAAELAATYKSSGIGTARAIAKRILPPKPAEESAGRGRLAAVTAGDTDLVDRLLDFQGL
FT                   LRDDLRGLPVVILPGALYVTASGLRASTGTHYTPRFLAEQVVQGALEPLIYSPGPLQTA
FT                   DKKEWKPRSSTEILALDVADIAMGSGAFLVAACRYLANALVEAWAREGDTRAIAATAKV
FT                   KEPATIDTEVDPVVTEARRQVIEHCLYGVDINPMAVEMAKLSLWLVSMDPQRPFTFLDD
FT                   RLLTGDSLLGITSLEQVETMHLDPKRGREIHQDGLLDLTSDIRGLVQEAAKERQRLAEM
FT                   AGGTLGELGAKRELLKELSKSLWNISTNADLLVAATLANASKGRVGLDLASKLAVSASR
FT                   EYASGREAAQDRVERERGDWLDTGLPSGGMPREPFHWPIAFPEVFIDGGFSAIVGNPPF
FT                   LGGQKITGTLGAAYRDHLVEVLADGIRGSADLVAYFLLRVHQLVSSSGIAGMIATDTLA
FT                   QGATRRAGLDQLAALGYEIFRAVSGEPWPSKSAALHYCVVGTTRVENMSESSTRFLDTR
FT                   SVGRISSKLEQQSRVSGLPNRLRENADLMFQGSIVLGMGFVLDPDEADRLIRTSDRNRE
FT                   VLFPYLNGQDLNQRVDGGPSRWVINFHDWDESRARTFEAVWEILERDVKPERQRLNDEG
FT                   QFVLRRPLPQRFWQYAEKRPGLVRAMHGLRRVLVCSEVTKHLTFSWSDARRVFSANLDV
FT                   FPSARPSDFAVLSSGIHDAWARKYCSHLETRLKYSIGNGFENFPRPSQSEMLTRLGAHL
FT                   VSERDKIQQGRLIGLTSLYNLLHDGDCSDPDISNLRDVHRKIDEAVAAAYGWNDLVDRG
FT                   LKHGFHESRDGVRYTFAAPIRQEMLDRLLELNHVRYAAEQAAGKPGKGRAKATRGPQQE
FT                   ELFG"
FT   gene            512625..516305
FT                   /locus_tag="Namu_0466"
FT   CDS_pept        512625..516305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0466"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: bps:BPSL0765
FT                   putative helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76885"
FT                   /db_xref="GOA:C8X716"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X716"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACV76885.1"
FT                   /translation="MTSPVGWQLPQEFEAATGSTVRDGMVELVSRDLLGPWGGEVEEFA
FT                   PRAAGPRDRYLIGMLGPRTIPGRPAEVEPGQADTETGGDTDGEADLPDVLSPQALGRIW
FT                   ASSMGLSFAIDSSVTSVAVEATWGAYEKVEFTQEEGRKVRIWRRQPVRHVRSIATHTVG
FT                   DDRVWLSDPKSEPFGIWLSVQVRDHDDGSGRPHRIVRVSLVNGQAEDVTPKDLAWLFQA
FT                   GLVVTAGVGGSSIFEPIGDVEAGAPVSDDPEEQHLALLFRNQLRHASGHNVAVHVDRRP
FT                   GERTAHRLSTTWLPSHDVPQVSATADPERLRGLELSMDALAELSDGPSADLVLALQPLV
FT                   TGYSTWLDEQSDVDIPDRVVKAGADALGRADVALNRLRAGIDHLRDNSQARAAFGFANR
FT                   AMALQRRNTQASQLRERDPDLSHRQALADRRIARPEAASWRPFQLAFVLLNLPGLTQPG
FT                   HPDRSDLVDLLFFPTGGGKTEAYLGLTAYTFALRRLQGSFGAGVAARDGRDGVAVLMRY
FT                   MLRLLTAQQFQRAAALVCAAEVLRRDDPDTWGTRRFGIGLWVGGSVTPNWYPEAAEAIA
FT                   EARETGRGSRTSVLQTLRCPWCGAQLAAHRDLHTEDFTREVILYCAEGEGRDACPFSRT
FT                   GAPGSGLPILTVDEQIYRHPPSLLIATVDKLAQLPWYGFAGMLFGRVTRECPRHGYRHP
FT                   DLDERIGCTDRHNASGGHPAVKSVPVVPLRPPDLIIQDELHLISGALGTTVGLFESAVD
FT                   ELTSWALPGGDRTGPKIIASTATTKRAAEQVRRLYARDLAVFPPQVLDAADTFFSVEVP
FT                   VDAANPGRRYLGICAHGVRLKSAEIRIAEILLLAGQTLFDIHGEAADAYATLVGYFNAT
FT                   RELAGMRRYLEDDVAVRLQRNGRRRGISDRLTRLNPALSLTELTSRVNSGDIADVLEQL
FT                   EKPFLIEQDTSARRRALFDAVMQARKAKDETFSMPRPSGAVDVVLATSMLQVGVDVQRL
FT                   GLMLVVGQPKNTAEYIQASSRVGRDAARPGLVVTLYNWTRPRDLAHFEDFEPYHASFYR
FT                   RVEALSVTPFSRRSLDRTTAATYIAAVRHAAPSYSANPDAFDVTFGDDPAVSVTRRMLN
FT                   RAERAGDPHARDYLQDRIDTLQDRWNQEKGGSSRLGYQTRKVKGQQLVGLIRPAGQGPW
FT                   DDLTVGRSMRETENEINLLVPASGMFTTSFAPAWTYATTPDGTGDDDDPGAGDELGEAG
FT                   P"
FT   gene            516307..518196
FT                   /locus_tag="Namu_0467"
FT   CDS_pept        516307..518196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76886"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniProtKB/TrEMBL:C8X717"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3851"
FT                   /protein_id="ACV76886.1"
FT                   /translation="MTEQYRRRVGTVRPSHLMFTGGVGAIVDLPNFAAMVGGIDDWRYD
FT                   QIPEWSPIAEPRLLAAVRNAVGGPEVKELRPAPWMPAADNDPSDPSLRIGVPVQPFPQW
FT                   LRCTRCDTLAGIDSGIYGFENSKARRPDEARFVHTNCGRRNRFAVTTRFLVACINGHLD
FT                   EFPYVTYVHKGTGCPKVSHPTLKMKDFAGNLGANVNIECTNCGAQRNMREALGRRGEEN
FT                   LPRCRARHPHLGIFEQDGCDVGTKLLVVGASNQWFGSTLSALSVPRTGASALAAMVEQL
FT                   WPSLEPVTSPDVLKFALTQPTFAPLGKWKPEEIWAAMQAHRSAPPASAHAALTQTDLLT
FT                   PEWEAFTNRPLPDATTDFTLREAEAIPRRWDWLFSEVIHAERLREVRALTGFTRLDAPD
FT                   PDDPDLVVRVGLSRDAVPSWVPASEVRGEGLFLRVQPDLVDAWTARLRGTPEEDAHAAA
FT                   YREFRKNRYSDRITATFDPMRGWPGPRYYLLHTLSHMMIRAIALECGYSAASLTERIYA
FT                   GDADQARQGILIYTAVPDAEGTLGGLVALGEPDALDRILRRALADAVNCSSDPLCAERA
FT                   PGPGDDFLHAAVCHVCGFVSETTCERGNRFLDRRFVVPVGRPELALIGSDRLP"
FT   gene            518193..518936
FT                   /locus_tag="Namu_0468"
FT   CDS_pept        518193..518936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0468"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipinsynthase-like protein"
FT                   /note="KEGG: ajs:Ajs_2205 phospholipase
FT                   D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76887"
FT                   /db_xref="GOA:C8X718"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C8X718"
FT                   /inference="protein motif:COG:COG1502"
FT                   /protein_id="ACV76887.1"
FT                   /translation="MTTFEQAVEKALGRASRDELCALAERIRDGGPIPSAWSGTAPVRI
FT                   AAIVDSLAGYAGSRPEAGAYLLGAAVGYEHRRREQWVQVVWGGPVVHGAPIRGMGQVLA
FT                   DVIGRAEQSLLLMTYSAKPYQPVIAALSGALERGVAVSVVVETLQGAGSAISGPEPAAA
FT                   FANLAGIELWHWPKKLRPNPKAKMHAKIAIGDRREMLVSSANLTASGIDASMEAGLLVR
FT                   GGEAPRRADDQIRELMTEGTIVRLT"
FT   gene            518969..520798
FT                   /locus_tag="Namu_0469"
FT   CDS_pept        518969..520798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0469"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: maq:Maqu_1316 protein
FT                   of unknown function DUF1524 RloF"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76888"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:C8X719"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ACV76888.1"
FT                   /translation="MQANTYELKKILMPERRYVIPTFQRDYEWTEEGQWRLLFDDLTVV
FT                   TERLSDAREQALAAGKPVAKADASVTPHFLGAVVCDQLPSAAGGLDVRAVIDGQQRLTT
FT                   LQLLVRGVLDVLIELDSKRVHQVRNLIENPEWMIHEDHDRHKLWPRRKDRDVWPIAMAD
FT                   TAPTGGDHLYLKARRFFANSTRTLADDGGDTVNALVDALLDLFKLVVIDLEDNDDAQVI
FT                   FEVLNGRQTPLTAADLVKNLLFLRGEFADEQELEKLYDLYWSQFDEDWWKQTVGVGHAA
FT                   RGRRDVLLSSWLTAVTGDEANVGHLYKEVRSYLDRTERSTTDVLRELHRYALAYRAITG
FT                   HGDPVPPALARPYRRIDDLRIQTAVPVLLWLRTIPEAELPAPDHERAVLAMESWIFRRL
FT                   VVGANTRGYAKFFVTVLRQGRSAHERGEPIAEAIIATLAAGSGQTAWPSDADIQTSFAN
FT                   NRYYGWFSQERLRFILGTIDDRLRQENPHAEPGDFDYQRLQIEHLLPQRWQDHWAVEAK
FT                   GPAEIELAQQRRGAYVDRIGNLTLVTGSFNASLSNSSWETKRKAIADQSVLQLNRPISS
FT                   IDGWTEAQIDSRASELAEIVCRVWPKTNETPTS"
FT   gene            520863..521621
FT                   /locus_tag="Namu_0470"
FT   CDS_pept        520863..521621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76889"
FT                   /db_xref="GOA:C8X720"
FT                   /db_xref="UniProtKB/TrEMBL:C8X720"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76889.1"
FT                   /translation="MNLREELAYMQRIVISWNLLAEAARRHPSGEIAHDWHHWYDSLQF
FT                   VIDSEHAILCNRAGGIHLLTPGNFGPWEPRPSGDGWGYAQTQGIRKTVRDFENVIGLPS
FT                   PKHTPKTTERTLVYRILAAICSISMIHGVLLDPRPGMIYDSNDYGSGIEEDQFSLFPLA
FT                   LKLLDGRGPDRRVDASKDFWFLVPRTLGSSESEAKGQALGVLHTSGQLWTRNGAEISLV
FT                   TRYDEISREFALLAGETFAVVTQESELFQT"
FT   gene            complement(521980..522606)
FT                   /locus_tag="Namu_0471"
FT   CDS_pept        complement(521980..522606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X721"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76890.1"
FT                   /translation="MNAEWVSCIVGDLAKDPTLVQRGDLIQYELWETPDGPARYRALIK
FT                   VAEVTPGSQVRIAGWEDTTYFDRDGAVTSTYSGYGSVFAARWDPIRVLRGGAPEIFEGE
FT                   RVDEVRAALDSYAAGNASFDDVKATVDTAVFSIGIGPGRNLEEVHRRAEEAPLTEPNTF
FT                   DQVLWLPLLSKQITLDQRGELFELAHFTNGGGGRPRRPSSDQPDE"
FT   gene            complement(522783..523010)
FT                   /locus_tag="Namu_0472"
FT   CDS_pept        complement(522783..523010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76891"
FT                   /db_xref="UniProtKB/TrEMBL:C8X722"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76891.1"
FT                   /translation="MERTSAATRTFQFRQIRSADVPWSQPEARLLGNDCGRVFGGNGDA
FT                   GHNQNLEFAIDNGARTLHDLRNEGKPVLLH"
FT   gene            complement(523033..524625)
FT                   /locus_tag="Namu_0473"
FT   CDS_pept        complement(523033..524625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0473"
FT                   /product="protein of unknown function DUF1152"
FT                   /note="PFAM: protein of unknown function DUF1152; NUDIX
FT                   hydrolase; KEGG: gbm:Gbem_3639 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76892"
FT                   /db_xref="GOA:C8X723"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C8X723"
FT                   /inference="protein motif:PFAM:PF06626"
FT                   /protein_id="ACV76892.1"
FT                   /translation="MERPLYVAAGGGGDALAATLLHRAYGPPGPATIATFSWDRLIVDP
FT                   LPGPRSFSNFKGLETVGRLEHVVTPRTRPIPPAGSTLPPLARDLVGPLASTLVLLDPTD
FT                   GAAGLREQLAASMQAIDADALVVVDVGGDVLATGKEAGLRSPLADALVLAAARGLSPDA
FT                   RVWVAGPGVDGELTADDVVSRAHSIGGVPLPPFPSDVAALALPILRWHPSEATALFVAA
FT                   AQGVRGLVDIRSGGMPVQLGAVSSDVYECGVDSAFEVSPLADSVADSRTLLDAEQRAIE
FT                   ICGISEIRFEARKAGAARLRDGFPPDVLDEIRAYAAEALGQGVTYATFRRLAELIRIRD
FT                   HASIQRNLGLNLPGAIESTLCNLAGLTSSGSAVCLPALPRPAAGRASMDDLPRHSVSVA
FT                   GIIIDVEGRILVVKRRDNGEWQPPGGVLELDETIEEGLRREVHEETGIDVHIDRLTGVY
FT                   KNMRLGVVALVFRCRPSAGSLQASSETEVARWMSAQEVESTLSPAFAIRVRDAIGEAAF
FT                   VAIRYHDGTGDVP"
FT   gene            524691..525431
FT                   /locus_tag="Namu_0474"
FT   CDS_pept        524691..525431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0474"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; SMART:
FT                   regulatory protein GntR HTH; KEGG: smd:Smed_4392 GntR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76893"
FT                   /db_xref="GOA:C8X724"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X724"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACV76893.1"
FT                   /translation="MGELPKFVQMANRVRDRILSGDLRPGDEVPSERALATEWGVARPT
FT                   AARALQELRSLGLVESRQGSGSYVREGTANVYRRAKDRYARSASAGRVYAEGEWARIVA
FT                   AKRAQAPGHVAKALGVDEGSTVGRRQRILGDGSGPTEISTSWFPIDIVEVAPNLMSRNR
FT                   IREGSLAYIESCTGRRGQVARDQLSARMASAAERRELYLDNPSAVLVVLHVVVDRKNQP
FT                   LEVVDAVYPPAGRWFLDQEYPLGS"
FT   gene            525622..525801
FT                   /locus_tag="Namu_0475"
FT   CDS_pept        525622..525801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0475"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76894"
FT                   /db_xref="GOA:C8X725"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8X725"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACV76894.1"
FT                   /translation="MDRVLLTAEEAADCLKVGRCKVYDLIRTGELQSIKIGRLRRIPVD
FT                   AVREFASKILADAD"
FT   gene            525801..526916
FT                   /locus_tag="Namu_0476"
FT   CDS_pept        525801..526916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0476"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bja:bll4526
FT                   site-specific integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76895"
FT                   /db_xref="GOA:C8X726"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C8X726"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACV76895.1"
FT                   /translation="MSGRNAVGEGSVYQRKDGRWVAAAYVPVADGTYRRVSHYVRTKAD
FT                   AKAKLREMNDRAAKNMPAPPPSLTVEAYLGEWLTHMKQHVRRSTWVAYESNARLHIVPR
FT                   IGRKKLSQLSVRDVRLMIDGLRKDGKGKRTVQYVHATLRAALEHAYREELVTRNVAKMV
FT                   RVERPTPTPKEPLSVAEARRLLTATRDDEDHALWVVMLLLGLRRSEVCGLRWDNVDLEN
FT                   RTLSVTHSVQRVDGKLRELPTKTRRSTRTVPLPAMVHQALVTHRAAMMPTSQYLPEPVY
FT                   VFGTKIGTPMEPRNLTRRWVTLAERQGIRRVPLHALRHSCVSLLLAQGVHPRTVMEIVG
FT                   HSAIEMTMNVYGHVNLETQRRALDELDRTLR"
FT   gene            complement(527001..527073)
FT                   /locus_tag="Namu_R0005"
FT                   /note="tRNA-Arg2"
FT   tRNA            complement(527001..527073)
FT                   /locus_tag="Namu_R0005"
FT                   /product="tRNA-Arg"
FT   gene            complement(527179..527266)
FT                   /locus_tag="Namu_R0006"
FT                   /note="tRNA-Ser2"
FT   tRNA            complement(527179..527266)
FT                   /locus_tag="Namu_R0006"
FT                   /product="tRNA-Ser"
FT   gene            527767..528144
FT                   /locus_tag="Namu_0477"
FT   CDS_pept        527767..528144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76896"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C8X727"
FT                   /inference="similar to AA sequence:KEGG:POPTR_795544"
FT                   /protein_id="ACV76896.1"
FT                   /translation="MTDRPAVTIGMINIDSADAAAAGRFWSALTGWEVVASGDGYSMVS
FT                   GGGHNLGFGTIPDYQPPAWPNEHGSKQFHLDLACADMAATEAKAVELGASVVDPQPGDT
FT                   WRVLIDPDGHPFCLTDAKNWG"
FT   gene            complement(528119..528760)
FT                   /locus_tag="Namu_0478"
FT   CDS_pept        complement(528119..528760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76897"
FT                   /db_xref="GOA:C8X728"
FT                   /db_xref="UniProtKB/TrEMBL:C8X728"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76897.1"
FT                   /translation="MKAHHIAALIGCVGLSGIALTDAFVQATTGHDSILAADDGPVGAI
FT                   VASDIWHGLTYAALTWVLITEAARFGAANRVARICRWVLVVCLAASAVSFVAIVPTLLL
FT                   TQSQDGAFAAVFGALGTPIFFGTILAAIVLGLSLIRMNPVGIGGRVLALILPVTAVIVA
FT                   LAFLAPAYAHPGWVETVVNFGIALIGVGAVSRSAAEAGAVAGFSPSSSRP"
FT   sig_peptide     complement(528695..528760)
FT                   /locus_tag="Namu_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.899 at
FT                   residue 22"
FT   gene            528868..530541
FT                   /locus_tag="Namu_0479"
FT   CDS_pept        528868..530541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0479"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76898"
FT                   /db_xref="GOA:C8X729"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X729"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACV76898.1"
FT                   /translation="MDESAVPPGRTGVVRTEDVRTPSGSYARAMAHPAVRVAALTALAV
FT                   ALAGALTVTAGAGVPEWIFGSVTTFALLLVLDHGLRSWRLAGRERRRTRTVLAVAPEVA
FT                   AREAVVDERRRLAVDIAAGLRESLTAIGERATAAVTATDPTAAIQDVHREARRATADLR
FT                   RHLGLLRDPPLPAAPVPDPVAAPRVPNGPDLLVAATVTALAVIEAIAYPLLEGWPRSWL
FT                   SVALTGLAAAAIVGRRTAPGPAALAIGLTYLVALAFGAPVTGGFWCLATVGGVLWTIAI
FT                   RPTSTGRDASCAGFLVVSAGASAWLLDPDNAALLMLVMLVALAGASIVRFVRSRTHRAL
FT                   ERARVHEEEVGAATAAALASERTAFAREIHDTVSHAVGLIAVQAAAAEVSWPGDPAATR
FT                   QALGVIAATATAAHADLVRLSPHRPARPRRPADLCELIDRIRAGGTQVRVVGLELIPPA
FT                   RLDVAYRLLQETLTNVLRHGGGAAAEVSVAVGEDLRIVVADAGGDGSGSGDPVARRGYG
FT                   LIGLAERVSFAGGSMIAGPGPAGGYRVEVTLPPVADRVVT"
FT   gene            530538..531182
FT                   /locus_tag="Namu_0480"
FT   CDS_pept        530538..531182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0480"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: scl:sce5431 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76899"
FT                   /db_xref="GOA:C8X730"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X730"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76899.1"
FT                   /translation="MSVRVVVVDDNELLRAGLVTVLTSDPDIEVVGQAADGPAGVRACR
FT                   EHRPDLVLMDVEMPGGDGIVATRRIVTDLPDVRVLILTMFDLDDYVVEALRAGAAGFLL
FT                   KTTPPRDLIRSVRQCAAGETTVGPTVMARLVDSYVGHQEPPPPGLAELTGRELDVLRCL
FT                   ADGRSNAEIAGELFLAETTVKTHVARILAKLGVRDRVQAVVIAHRCGLARG"
FT   gene            531317..531778
FT                   /locus_tag="Namu_0481"
FT   CDS_pept        531317..531778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76900"
FT                   /db_xref="UniProtKB/TrEMBL:C8X731"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76900.1"
FT                   /translation="MRSIRRIGVTGATVVALMGMGMGVASAQSKASAEQDGGIYFAGHA
FT                   SGSLTKASGGFEVYDTGPTDYEPWEYLSGKVICYSQNAAATKAVFTARVTKGDLDKAKT
FT                   ITFWFNDSDAPVMPNSFGYAVDVPGAPCTGTPQNVKSIEDGEGYYIDIR"
FT   sig_peptide     531317..531400
FT                   /locus_tag="Namu_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 28"
FT   gene            complement(531867..533450)
FT                   /locus_tag="Namu_0482"
FT   CDS_pept        complement(531867..533450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0482"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; TrkA-C domain protein; KEGG:
FT                   ank:AnaeK_1552 YidE/YbjL duplication"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76901"
FT                   /db_xref="GOA:C8X732"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C8X732"
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /protein_id="ACV76901.1"
FT                   /translation="MLQWFVDSPLLTIFFCVGVGSLLGKIKFGPVSFGPAGALFVALAL
FT                   SAIEPKVALPPIVTSLSLCVFCYMVGIAAGPSFVNALRSGWQPVVVSVLAIVAMAAAAL
FT                   GVGSWFGLDIGTVAGAFAGAGTATAALGAVQQQLAAGGPIPPEPAIGYAVAYPITVLLT
FT                   ILCCSYLISAGRRKPTAEDRKKLAPIAVRTLELVGDPALTVRGLSDRYQAVVSRLTRGG
FT                   TTVVAHDEEALADGDLLTITAREDEVQRMIGDLGRPAQEEPWMDRSDIDFRRITLSNSS
FT                   YVGRELVDLRLDEKYDAVVSRVRRGDVDIIATPDLVLASGDRLRVTAPREQLAAITKEL
FT                   GDSERTAGDINPVGLGLGLTLGLLAAFIEIPLPGGGTLVLGTATAPLILGVVLGALGRT
FT                   GPIIWALPGNVANTLNQYSLLVFLVAVGTGAGSGLITALAADWFPLVTLGLAISAAHAL
FT                   ICVIGLRTVLKYGTARSLGGLTGSQLNPAPYAFAIGKVPDQRVAIGYAVLFPVSMIVKV
FT                   LLAQLMVVYF"
FT   gene            complement(533541..535580)
FT                   /locus_tag="Namu_0483"
FT   CDS_pept        complement(533541..535580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0483"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD synthase;
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mno:Mnod_2890 NAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76902"
FT                   /db_xref="GOA:C8X733"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR041856"
FT                   /db_xref="UniProtKB/TrEMBL:C8X733"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ACV76902.1"
FT                   /translation="MTFRSLYAHGFARVAACTADVWIADPTRNAAGIAAVARQCSEQGV
FT                   AVALFPELSLTGYAIDDLLGQQALLDAVHAAIGELCTATADLLPVIIVGAPLRHRDRLF
FT                   NCAVVLHRGSVLGVVPKIHLPNYREFYERRQFASGDGIVGQSIPVAGQDAPFGTDLLFP
FT                   AADLPGLTIGVEICEDMFVPVPPSSGLALAGATVLLNLSGSPITIGRADTRAALCRAQS
FT                   MRCLSAYLYAAAGRGESTTDLSWDGQTSIFENGVLLAKGPRFAEDPVVTVADVDLDRLR
FT                   QERARQGTFDDNRRAVGGPVPRTVEFTLQPPDADLGLRRVVERFPFVPADPERLAQDCY
FT                   EAYNIQVDGLVQRLRAIGTRTVVIGVSGGLDSTHALIVAARAMDLLGYPRTNIRGFTMP
FT                   GFATGTSTKANAWALMRALGITANELDIRPAARQMLADLDHPFGRGEEVYDITFENVQA
FT                   GLRTDYLFRLANHHHGIVLGTGDLSELALGWSTYGVGDQMSHYNVNAGVPKTLIQHLIR
FT                   WVAGLADFSDDVDEILLSILGTEISPELIPVKDGEVPQSTEKSIGPYELQDFNLFYTLR
FT                   YGFPPSKIAFLAWHAWHDVDGGLWPIGFPPERRRAYDLAPIRQWLTVFVKRYFGFSQFK
FT                   RSAMPNGPKVSAGGSLSPRGDWRAPSDGNAAVWLAELERNVPTE"
FT   gene            complement(535641..537296)
FT                   /locus_tag="Namu_0484"
FT   CDS_pept        complement(535641..537296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0484"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dac:Daci_3575 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76903"
FT                   /db_xref="GOA:C8X734"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X734"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACV76903.1"
FT                   /translation="MSTTEPTQPATSTGPTVPTTDRRRWIGLVGISLAVALIIADSTIV
FT                   NVAVPYIVRDLSLTSTEVQWVQESYTLVFAATLLIWGALADRYGRRRILLIGVVVFMAA
FT                   SMVAAVAATGPLLIGARVLQGVGGAMILPTSLSLINSTFTGRDRGIAFAVWGSTIGGMA
FT                   AVGPLLGGWLTTAFSWRWAFGINLPVGLLIIALVLLFVPESRSPQTTGVDWVSALLTTV
FT                   GFGLLAFGLIEGRQYGWWTSVKPLTIDGWTWESTLSPIPVAFAVSALALVVFVIRAYRR
FT                   TRAGRSSLIDPGLFGITSFRNGNIAALIVSLGEFGIILSLPIWLQNVLGCTALQTGFVL
FT                   LGLAVGSFAASGLSVGLPAKIGAVGVVRIGIVAEIIGIAGVGLVVSPTTGWAPLVGLLF
FT                   VYGFGVGLATAQLTGVVLADVPVARSGEGSGIQSTSRQIGSALGIAVLGTVLFVSAGNS
FT                   LSTELTDQGVPAAATDQLVNAVVDSAGSAIPALAADPATAAAADAAKQAFSQGTSYSAY
FT                   VAAAFLVIGLIATLSLRNRWPQDGPTPDPAVAAS"
FT   gene            537363..537821
FT                   /locus_tag="Namu_0485"
FT   CDS_pept        537363..537821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0485"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cak:Caul_0809 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76904"
FT                   /db_xref="GOA:C8X735"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X735"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV76904.1"
FT                   /translation="MTPPVPAAGRSQLETQLLRQVQVTGSMAEQALARRLGVNGTDLAA
FT                   MGHVSAAEPPIGPRDLSQRLGLSPAAVTEVVDRLESAGHLVRERDTLDRRRVRLRPSAP
FT                   ATTRVLAELAPLMHDLDELAETFDDAERAAIRRYLRGVVDAFTRFQLP"
FT   gene            complement(537799..539025)
FT                   /locus_tag="Namu_0486"
FT   CDS_pept        complement(537799..539025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0486"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   bpy:Bphyt_2660 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76905"
FT                   /db_xref="GOA:C8X736"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X736"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV76905.1"
FT                   /translation="MTQVQQIVRDAAQRGLNLQLTLRALLAAFVLGTLAFLPPADAAEL
FT                   SWWVAGGYLVAVAGLTLWLRRGDRIALTWGWLGLYVDLIALLTLTQIAGWSADQSWTSY
FT                   VLQFGFFLIPVLAATQLRWGVCAGVVIPTVLLYAAEGLLTRDANEVEPIPSIVLRVVAL
FT                   AGVGLAAVWLSRIQRSRVASIQALVDDRTRLLTELMTATDSAHRAMAENLHDGALQYVL
FT                   AARMDLEDARDGAPDEAARSFDRLDDALTQTAKLLRSTVSELHPAVLEQSGLALAVGQL
FT                   AGTAAERGGLTVSVESAGWPDEARTDQDQLLFGVARELISNVVRHAHASRMAIGLELAD
FT                   GVAELTVSDDGIGFTPGTAARKLSEGHIGVDSQRVKVEAAGGRFSVDSPAAGGATVRVQ
FT                   VPVRAAGTG"
FT   sig_peptide     complement(538897..539025)
FT                   /locus_tag="Namu_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.975 at
FT                   residue 43"
FT   gene            complement(539037..539684)
FT                   /locus_tag="Namu_0487"
FT   CDS_pept        complement(539037..539684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0487"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: cak:Caul_0621 two component
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76906"
FT                   /db_xref="GOA:C8X737"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X737"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76906.1"
FT                   /translation="MLTSERRIEVVVIDDHPFFRDGVSRGLTNSGLITVVAEAENGRDG
FT                   LAAIAEHRPQVAVVDYQLPDLDGIAITQAVVRDQLPTKVLLLSAITDSAVVFRALEVGA
FT                   SGYLSKDARRAEIVDAVLTVSRGKTVVPPELAGSLAQEIRLRAQPTGPVLSERELQVLR
FT                   GFARGQSIPQLAKELYIGASTVKTHTQRLYEKLGVSDRAAAVAEAMRRGLLE"
FT   gene            complement(539738..540343)
FT                   /locus_tag="Namu_0488"
FT   CDS_pept        complement(539738..540343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76907"
FT                   /db_xref="GOA:C8X738"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C8X738"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76907.1"
FT                   /translation="MPESDSRRTFAAAAQAFAELVDRIPDDAWTGPGLGDWDLRALVGH
FT                   ASRSLVTVLTYLPRIAETEAVPTTAAYYAAAAQIMAAVTERGRQAGAALGNDPAATVRT
FT                   LVRDCARALAATTDDPVIESIAGGMRLSGYLVTRTFELVVHSLDIAAATGLSYDPPADA
FT                   LAESLALAVDVAVDRGQGARLLLALTGRASLASGFSVV"
FT   gene            complement(540443..541477)
FT                   /locus_tag="Namu_0489"
FT   CDS_pept        complement(540443..541477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0489"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   scl:sce1364 DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76908"
FT                   /db_xref="GOA:C8X739"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C8X739"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACV76908.1"
FT                   /translation="MAGWWLFHVDLDQFQVSVERLRRPDLRGRPVVVGGDGDPARARQV
FT                   VTCASYEARALGVRAGLPMRVAARKAPDAVFLPLDHAGYEAASAQVMDTLRGTGRPLEV
FT                   WGWDEAFLGVTADDPEPVAAGLQALVRDTTGLPCSIGIGDNKLRAKTATGFGKPAGMYR
FT                   LTGANWMSIMGDRPVRALWGVGARGAARFAEHGIATVRELAAADPAELVRWWGPTTGPR
FT                   YRALARGEGETEIRIEPWIARSRSHQRTYEQDLTERGVVERELRVLADQVVTDVVADDR
FT                   VITRVAVVVRNSSFFTESHLRTLPEPTTSAAVVGEAAVSLLDRFELRRPVRLLGVRVEL
FT                   APPP"
FT   gene            complement(541498..543315)
FT                   /locus_tag="Namu_0490"
FT   CDS_pept        complement(541498..543315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0490"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: smd:Smed_5235
FT                   citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76909"
FT                   /db_xref="GOA:C8X740"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C8X740"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ACV76909.1"
FT                   /translation="MSPATVSLIILVCSIALFVWNRLPVGVVAILTGLALYFTGVLDAN
FT                   QVVAGFGDPVVIFIATLFVVSEGLESSGVTTWAGQVIVGGAGSKPKKLLAAIMLLAGGL
FT                   SAAITPNGAAAALLPVTVSVARRARTAPSKMLIPMAFAASAGALLTLSGSPVNVIVSEG
FT                   SLSVGGPGFGFFEFAIVGLPLLLGTTAIALLVGNRLLPDRTSTQLPADYGSYAATVATH
FT                   YDLNRTIHRLRIRPTSTIRGVEVGNLALTDYPQLSLVGVQDSAGDAVGPDHALADGDRI
FT                   VLAGPDEQVTAFAAGSGVKITGSALATRQGASILSRTTGIAEVVIPPRSRLIGQTLFPG
FT                   MVRTGQLVVLAIQRVGTDVGLHPVTIAEGDAILYYGKWRAIESLSASRDVLLVNSPESV
FT                   RRQTIPLGRKAPQAIAVLVGMIVLLATGLVPPAIAGLMAVAALILLKVVEPQQAYRAVS
FT                   WQTVVLIGGLIPLSVAIQTSGAADLLAGALVSVVGGSGPYLLMLALFALTAALGQVISN
FT                   AATVLIVMPIALSAAAETGVSPQAILMLVAVAGAASLLTPIATPANMIVMPSGGYRFGD
FT                   YWKLGAVTMLFWLVVGVLMVPVVWPLYPG"
FT   gene            543469..543801
FT                   /locus_tag="Namu_0491"
FT   CDS_pept        543469..543801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0491"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   scl:sce1170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76910"
FT                   /db_xref="GOA:C8X741"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C8X741"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACV76910.1"
FT                   /translation="MLIVHVDIAVEPGRVDEFLRATIENATASIQEPGVIRFDAIQDEA
FT                   DPAHVVLVEIYTGADAAATHKETAHYATWRDTVAEMMARPRSSTKYTAVFPVAEADWSS
FT                   AASDRA"
FT   gene            543798..544952
FT                   /locus_tag="Namu_0492"
FT   CDS_pept        543798..544952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0492"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   mxa:MXAN_2881 alcohol dehydrogenase, iron- containing"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76911"
FT                   /db_xref="GOA:C8X742"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C8X742"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACV76911.1"
FT                   /translation="MSGPTFEFATATRIVFGPGRAQELPALVAGWGERVVVLTGSRPDR
FT                   HRALIDALPMDAAIVTVSGEPTVGVAREAVAAAREHGAQAVVSLGGGSVIDLGKTVAML
FT                   LGNGGDPLDYLEVIGRGQPIGRPSVPFAAVPTTAGTGAEVTMNAVLASPEHGRKASVRA
FT                   RSMLPALALVDPLLTVDCPPAVTAASGLDALTQCLEPLVSRNATPITDALAAQGLRHAA
FT                   AGLRAAYADGTDVAARTEMALCSLLGGLSLANAKLGAVHGFAGVIGGLVPVAHGAICAA
FT                   LLAPVTEANVRALRERAADHPALAAYRQAAELLTGRSDATVEDGVEWIAATVRQLGITG
FT                   LAAGGLDPALVDEVVDKTGSSSSTKGNPIELTPAELRQALVAAL"
FT   gene            545144..546280
FT                   /locus_tag="Namu_0493"
FT   CDS_pept        545144..546280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0493"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; KEGG:
FT                   mrd:Mrad2831_6025 PHB depolymerase family esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76912"
FT                   /db_xref="GOA:C8X743"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X743"
FT                   /inference="protein motif:TFAM:TIGR01840"
FT                   /protein_id="ACV76912.1"
FT                   /translation="MPTPSPTRKAATRSVKKAQRTVTKAARAATKSTTAVPRKRKSTAR
FT                   PARSSASALPELWQPPGGQQPDPASLGKGTWHQHRYTGVAGSLAYRVYIPRGLRRTTRA
FT                   PLVLALHGCTQSGLDFAAGTRWNDLADSHQFVVVYPDQSVTHHAQRCWNWFRPGHQQRA
FT                   AGEPAVLAGIVRRVVQETTRWRIDPHRIYATGISAGGGMALVLAATYPELFAAVGVHSA
FT                   PPFHSATGPADALAVMQGAGPTPTPSGPLPPLIVFQGTADGTVRSSNAERIVGQWSGAW
FT                   TGAADKGLRPTLGKGRQTRKDPPRTASGNGPRPHRITRWSVARQVVLELWVVEGLGHAW
FT                   SGGSVQGTYSDRRGPRASTAMWRFFAKHTASDPGLIGR"
FT   gene            546307..546711
FT                   /locus_tag="Namu_0494"
FT   CDS_pept        546307..546711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76913"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C8X744"
FT                   /inference="similar to AA sequence:KEGG:LPC_2016"
FT                   /protein_id="ACV76913.1"
FT                   /translation="MSVALLKEMFERMVVAKDPTLIPAYYHPDFRMTSNGVEQGYAEFA
FT                   AGHERVYGTAITYAVRYDEQAWVQAVDRVAGRLWITTSRPGRPATELEIVLVATFRDGL
FT                   IHRVWEVTWPDWSTLPELEAYEAAENIPNE"
FT   gene            546833..547984
FT                   /locus_tag="Namu_0495"
FT   CDS_pept        546833..547984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0495"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; globin; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: avn:Avin_51090 flavohemoglobin Hmp"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76914"
FT                   /db_xref="GOA:C8X745"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8X745"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACV76914.1"
FT                   /translation="MTDSTRPAPLDAALDTTAALKANFATVATHGDDVAAYFYAHLFLT
FT                   HPEVRELFPLAMTEQRDRLLGALIRIVTHVDRLAELAPYLAELGRDHRKFGALAGHYPA
FT                   VGASLLATLEHFSGARWSAALAAQWSAAYAAVSEAMIRAAADADAREPAWYDGEIVEID
FT                   RRTVDLAVLRVRTEQPVPYRAGQSMALQATRLRPRVWRPFTPATRPSGLEFDLHVRAID
FT                   GGTLSTALVRAARPGEPVRLGAPYGGLSLDPAAYRPLLMIAGGTGLAPMKAMIEQLIDS
FT                   GGRPTHLFHGVRTGREAYDQAWLAATAAEHHTWLSVCTATSHDERWAGPHGRIGELAAA
FT                   QADWAGYDVAVCGSPEMVEATVKALVARGVPDERIVFEEFGKA"
FT   gene            548018..548356
FT                   /locus_tag="Namu_0496"
FT   CDS_pept        548018..548356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76915"
FT                   /db_xref="UniProtKB/TrEMBL:C8X746"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76915.1"
FT                   /translation="MDDPAWAGVRHADRIDGRWLRAVLVPPARAFSRGYDRDATDGLLD
FT                   DCADVLDELTDQLHLAQREILDLRRQALTRAARRGRSRVNARTQTARSGHPRRRRVGAR
FT                   GVPAGRVG"
FT   gene            complement(548294..550492)
FT                   /locus_tag="Namu_0497"
FT   CDS_pept        complement(548294..550492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0497"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76916"
FT                   /db_xref="GOA:C8X747"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C8X747"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACV76916.1"
FT                   /translation="MSRLLTRLGYTAAVHPWRIIAGWVVALALTLALSATVGGSPHDDY
FT                   TVAGSASQAGSDLLTERFGDTYATDARVVVRDPDGSLDPAVVDALSGRLAGLPHVVAVD
FT                   PPRMSADGDTALLTVRYDVPVTDFTGSAAVDALRSATAPTEQAGLTVALGGQVPENFAP
FT                   PSGVAELVGVLIALLILVFAFGSVVAAGLPMAVALVGLGVGSSLIALLAAVADVSTVAP
FT                   TVAAMVGLGVGIDYALLLVTRFVEGLRAGLPVPDAAARANGTAGVSVVFAGTTVLVSLI
FT                   GLRLADLSTYTTVGIATLLVVLSVMLTSITLVPALCGLVGRRVLGRRARRAPGADAAAG
FT                   RPRAAEPGATATARWAHRVGRRPWPWALGALTLLLVLAAPVLGMRTWPQDAGSQPESNT
FT                   TRIAYDLVADEFGPGANGPFLLAVDLTGTAGSAGQTVVSQLTERVAADPGVAAVAPPVL
FT                   NPAGDAALIIVQPTTGPQDEATVELLHRLRAELPQTVRVTGLTAVFADISDRLADRLWV
FT                   VIAFVVGVSLLLLTAAFRSVIVAVKAAAMNLLSVAAAYGVMVAIFQWGWGAELLGLPHA
FT                   VAISSWVPILMFTILFGLSMDYQVFLLSRIREDYLATDDPRGSVVRGLAGTGRVITCAA
FT                   AIMVAVFVGFGLDADPVVKMMGVGMAVAVLIDATVVRMVLVPATMSILGRANWWLPRWL
FT                   DRVLPHLDTEGSDPRPVGSADPTGGDAASTHPAPAGVA"
FT   sig_peptide     complement(550379..550492)
FT                   /locus_tag="Namu_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.325 at
FT                   residue 38"
FT   gene            complement(550589..554041)
FT                   /locus_tag="Namu_0498"
FT   CDS_pept        complement(550589..554041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0498"
FT                   /product="transcriptional regulator, putative ATPase,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain protein; SMART: AAA
FT                   ATPase; KEGG: rlt:Rleg2_6475 adenylate/guanylate cyclase
FT                   with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76917"
FT                   /db_xref="GOA:C8X748"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C8X748"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACV76917.1"
FT                   /translation="MLRLRVLGALDASVDTGAGVLRPDLGGPRQRSVLALLLVARGQVV
FT                   SVDRLVEDLWNGEAPPRAIGALQAYVSHLRRALEPDRAPRTPATVLVSEPPGYAIRVPP
FT                   DAVDAWRFEALVRQAAEPDRQPQARALLQQALDLWRGPAYAEFGTESWAATEVGRLESL
FT                   RIVARERWCEAVLTAGDADEAVLAAEVLTREYPLREEGWRLLAMGLYLTGRQADALAAL
FT                   RRARDILADELGMDPGAALLEVEADVLAQRLSRPAPAAAPVPVPISTASPTTTATTDSA
FT                   TATVARPAPSDEASGPAPTDGSFVGREDELNTLHTVAHDARTRSDRRVVLVAGEAGAGK
FT                   SALIERVAQELRADRWRLVLGRCPESAGAPPAWAWVEVVRALAADVDPGPFAPALAPLL
FT                   DETARPAAESDASFGRFLLGRALVGYLTAAARTGPLVIVLDDLHRGDSETVALLDTVAS
FT                   ETAGVPLLMVAAYRPAEVQPGLRDALAGLAALPPTRLALPGLDTRQAARLIRSVAGTQP
FT                   DPATLAALVERTAGNPFYLAESARLLGSEGSLVAVSKVPEGVRDVLRRRFARLPEVTVS
FT                   VLRLAAVIGRDVDIDVLVHAAEVDEDTVLDALEAGVLAGLLIEPAPGRVRFAHVLVRDT
FT                   LYEDAPQLRRSRWHGRIADAVTAVHPDDAAALAHHYHHAGTPATARRAVDAGVRAADMA
FT                   VARYAHETAADLYEQALADLARVPEGPAGAGPAAGPAVGPGAGPDSRLAERIELLSRLS
FT                   RSQLAAGAGVRALATRNRAIREADRAGRVDLLVRSLTAWDLPTPWINRPYGVVDEEMVA
FT                   TIKRALASTDPRPDDATRCRLLCALAGELDEAEVVLPYAEAAEAIARRLDDPVLLGLAL
FT                   HAKVSFIGPEHDAERAARIGDELREIGRRPGLAVFALIGHYMAVRAAGIRGDHRTMAGH
FT                   VDQIEELVARYRWRQALGLLSMHRGAIAHIAGRLDESEAHYARGAESLRGSGALDAVGI
FT                   TTLAFLTLRMTQGRAAEFTDALTSVDTQAPDVIADLFAIPLLAAGRRAEAIEFRRGIRP
FT                   VRRDFFHGLLLTMRGIIVAALADPVEAAGVYADLLAYRGQLGGGGSGSYAVGPVDTVLG
FT                   DLARVLGDREAARQFYRAGADLAAACGNRYWVDEATRRARALD"
FT   gene            554198..554866
FT                   /locus_tag="Namu_0499"
FT   CDS_pept        554198..554866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0499"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: dar:Daro_0364 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76918"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C8X749"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACV76918.1"
FT                   /translation="MTAATNARPDTFEMVFVHNAFRQQFGAMPGLIRGVADGDRDRASV
FT                   VVGFFTEMTRSLHHHHEAEDDLMWPLLLQRAPMDSALILRMEEQHERIAELYRCAERSA
FT                   VTFAERADPVSREQWAANLDELIDALTEHLHDEEVEVLPLVEKVLTVPEWEALGERGRA
FT                   GIPKDRLLVFLGFLLQANTPEHGRDFLGRMPPPARLAWAVLGRRSFRKEYRRVYGVDPS
FT                   "
FT   gene            complement(555022..555597)
FT                   /locus_tag="Namu_0500"
FT   CDS_pept        complement(555022..555597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0500"
FT                   /product="transferase hexapeptide protein"
FT                   /note="KEGG: rfr:Rfer_2653 transferase hexapeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76919"
FT                   /db_xref="GOA:C8X750"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C8X750"
FT                   /inference="similar to AA sequence:KEGG:Rfer_2653"
FT                   /protein_id="ACV76919.1"
FT                   /translation="MTDHSPLISLPGRTPQVADSAWIAPTAAVIGAVTIGEGSGVFYSA
FT                   VVRGDTSTITIGAGSNLQDGVVVHADPGFACSIGSGVSVGHAAVVHGSTIEDDCLIGMG
FT                   AVVLNGAVVGRGSMVAAGAVVLEGAQIPPGSLVAGVPGKVRRELTEQEQTGVKENARHY
FT                   TELTATHRAASEARAAVLSPQKENSNPG"
FT   gene            complement(555597..556142)
FT                   /locus_tag="Namu_0501"
FT   CDS_pept        complement(555597..556142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0501"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   mrd:Mrad2831_1113 putative phosphohistidine phosphatase,
FT                   SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76920"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C8X751"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACV76920.1"
FT                   /translation="MSPPPPRTLILLRHGKSAYPAGVPDHARPLADRGRRQAALAGEHI
FT                   RTLLHRGEAAIDLVLCSTAERTRQTLAASGLDAGTTVEYRDEIYGAESDELLDLIATLP
FT                   ETAATVLVVGHFPGLPDLAEDLAGPDSDRPALAALARKFPTSAFAVLTVDGPWSGVPAG
FT                   GRLIAVTIPRDHPAPQES"
FT   gene            556219..557166
FT                   /locus_tag="Namu_0502"
FT   CDS_pept        556219..557166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0502"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   aha:AHA_1635 cytosolic long-chain acyl-CoA thioester
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76921"
FT                   /db_xref="GOA:C8X752"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C8X752"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACV76921.1"
FT                   /translation="MATGQSEITLRFLAAPTDVATLGGSIHGGRVLEWIDKAAYALAVG
FT                   WSGHYCVTAYVGDIRFTRPIESGNLVEVTARLMRTGRSSMDVHVTVSSADPQDAVYTEA
FT                   TTCVVVFVAVDAQGRSTAVPAWTPVTELDHRLLSDALERVTVRRNIENAMAEQTYTSQG
FT                   TAPSMTLRFLAAPTDVNWGGKAHGGTVMRWIDEAAYAVAAGWCKGAAIAAYSGGVRFYR
FT                   PIQIGHVVELEARLLRTGRSSMHIAVLVSSGSPITGEMQLTTHCLTIFVALDEAGKAKP
FT                   VPRWRPQSAEDKALDAHALHLVELRRQIQPTALD"
FT   gene            complement(557192..558442)
FT                   /locus_tag="Namu_0503"
FT   CDS_pept        complement(557192..558442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0503"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mxa:MXAN_7270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76922"
FT                   /db_xref="GOA:C8X753"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C8X753"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACV76922.1"
FT                   /translation="MFGRRSPGAGRAVAADPDSRTGADGGTDADDLAGHRPTGPVSTAS
FT                   ARRLERGLVEYSQWTLRLLIIGVGLFAAFWILGQLWSVVLPILLGLLLATILWPPVRFM
FT                   RRKLPNALAAIVALIGLLVIFSGLIAVLAPQVTSQAGELVDRATAGLTTLQSWLAGPPF
FT                   NLGPDALGGLLDKGISEIQSNSQEVLGVVLGSLSAIGSAVITLVLALVLCFFFLKDGPK
FT                   FVPWLRTWIGRAAGTHFAELSDRVWTALGQYVWSQAAVAAVDGVFIGVGVWLLGVPFAL
FT                   PIAVLTFFGGFVPIVGAFVAGSVAVLVALVSNGIWTAVGVLAIVLVVQQLEGNVMQPIL
FT                   VGKTMNIHAAVTIAVVALGGTLFGIVGAFLAVPAVAVVQVIARYTREQLQEAPDSARDS
FT                   APNSAPNSGPTPDPDPA"
FT   gene            558610..559548
FT                   /locus_tag="Namu_0504"
FT   CDS_pept        558610..559548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76923"
FT                   /db_xref="GOA:C8X754"
FT                   /db_xref="UniProtKB/TrEMBL:C8X754"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76923.1"
FT                   /translation="MDGEPIGGIAGRRAAVAIAVSLGVVLLVAAAVVLVTGNTGVAGEA
FT                   VAAPVSERPQAGDCLLDDPIGVVYGSPGGSSELPALRTAACDGARYGEVVTIGAGTDQD
FT                   TAADDGTQDQCWSAAYGYLGVPDPVTTDLDRVPVADVWPLLIGPDDRQRAAGQVWSACV
FT                   VHLAPSKSDDGVTIDHSLRGAWARPEDAHLFSMCLVDGDSQDPINCAWSHGAEQISYAW
FT                   GDSTQTPETATAACRADAVDALGSPAALDRGDLAVSVVASRYDDGELVTGPEAASADGD
FT                   YFLDCLLVPARAGQELVGPLRGLGEAPAPLR"
FT   gene            complement(559574..560566)
FT                   /locus_tag="Namu_0505"
FT   CDS_pept        complement(559574..560566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0505"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bja:blr3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76924"
FT                   /db_xref="GOA:C8X755"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:C8X755"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACV76924.1"
FT                   /translation="MSTSLNSPARPGSWGPAGPDGPVALVVHRRLAESSAPAYQAWQEQ
FT                   VAARLASWPGFLDRRVIPPNPPVQVDWVIVQRFRDVHSARAWLQSPDRADLAAQISDHF
FT                   VGNDEIHLIVENNRDRSTAVSALISSRVAPGLERDFLAWQRTVAAAESRFDGFVGHKVQ
FT                   RPVPGVQEDWVVLLSFDSDEHLDAWLASPERTALLADGERFTQQLRLVRSAYGFGFWSG
FT                   QEPTAAPDPVFKSNLLVLLMLYPVVFAWGYFIADPLFAAHGVPFWLSLFIGNLVSTQLL
FT                   GWLLVPWAFRRFKWWMRPGPARTQVAGYAIIVALYVVSMAVYAVLLALR"
FT   gene            complement(560572..561969)
FT                   /locus_tag="Namu_0506"
FT   CDS_pept        complement(560572..561969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0506"
FT                   /product="guanine deaminase"
FT                   /note="TIGRFAM: guanine deaminase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: bja:blr3880 guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76925"
FT                   /db_xref="GOA:C8X756"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C8X756"
FT                   /inference="protein motif:TFAM:TIGR02967"
FT                   /protein_id="ACV76925.1"
FT                   /translation="MATTAVRGTFLDFVDDPWRHVGAEQESARFHADGLLVISDGRVAD
FT                   FGPYAEVRARHPQVPVTEIADRLILPGFVDGHIHFPQTRVLGAYGEQLLPWLQKSVFPE
FT                   ERKYADREYAQLGGQHFFDNLLASGTTTIQAFTSSAPVCTEELFLEATRRNLRVISGIT
FT                   AIDQNAPDWFTISPADFEAAAKDQIARFHRQGRNLYAITPRFAFGATEELFRTCQRLKH
FT                   EYPDLWVHTHISENPAEVRGVPPLHPGCTDYLSVYEKFDLVGPKFTGGHGVWLTNDEFR
FT                   RLSASGGAVTFCPCSNLYLGSGLFRLGRATDPEHRVKLTFGTDMGGGNRFSMLNVLEDA
FT                   YKVGMLNNTLLDGSVVPSEQDLAESERNKLSPYRAFYSITLGGAQALEIDDLVGNFDVG
FT                   KEADFVVLDWNGGPPATAWHMSLLLPDGAPRTMQDAAEVLFGIMMVGDERAVEQTWLMG
FT                   ERAYRKP"
FT   gene            562148..566197
FT                   /locus_tag="Namu_0507"
FT   CDS_pept        562148..566197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0507"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: esa:ESA_01693 ATP-dependent RNA helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; protein of unknown
FT                   function DUF1605; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76926"
FT                   /db_xref="GOA:C8X757"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X757"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ACV76926.1"
FT                   /translation="MSVHQAPDAERTERLADLTIVDRRRLQGRLRSAERIPDPAKRDLV
FT                   LAEIDHQLEAGAARLARRQAAVPTITFPAQLPVSARVQDLARTIAEHQVVIVAGETGSG
FT                   KSTQLPKLCLQLGRGVRGMIGHTQPRRIAARALAERIAEETGTQLGGAIGYSIRFGDHT
FT                   GPTTLVKLMTDGILLTEIARDRMLWAYDTIIIDEAHERSLNIDFLLGYLQGLLPQRPDL
FT                   KLIITSATIDPGKFSRHFADAPVVEVSGRTFPVEIRYRPYGLDALPEVDDPDAEQSRGS
FT                   SESADQGQAITAAVDELLAAGDGDILVFLSGEREITDTTEVLRGHLAGRRGLTEVLPLY
FT                   GRLSSADQHKVFSAHPGRRIVLSTNVAETSLTVPGIRYVIDPGTARISRYSPRSKVQRL
FT                   PIEPISQASAGQRAGRCGRVANGICIRLYSEKDFDERPAYTDPEIARTSLASVILQMAA
FT                   LELGDIVDFPFLDPPDQRQITDGVTVLTELGAIDRSAGDRVRLTPTGREMADLPLDPRL
FT                   ARMLVEGERRNVRREMLVLVSALAVIDVREYPLDERDKATAAHARFVDGNSDFNALISL
FT                   WAYLEEQAKTQSGNAFRRMCRREYLNYLRIREWQDLHAQLSQLLDGGRRRGGRRRPDRP
FT                   APADRGSLPQRRDPDATQGGRGSLAVDVDTERVHTALLAGLLSHIGLRKEGTREYQGTR
FT                   GISYSIWPGSALARTGPVLVVAAELVETSRLWARICARVEPGWVEQVGADLLRRNYSEP
FT                   RWNGKRASVEATEKVTLLGVTLIAARTVQFDRIDPELSRELFIRHALVERDWQTRHRFF
FT                   ADNQRALEQVTEWEERARRRDILIDDDTMFALYDARIPPQVTSGRHFDSWWKKASRTQP
FT                   DLLTLTPDMLIAAGAERFDSAAFPDRFTSGEVELPLDYVFDPGRADDGVTVSIPLPVLA
FT                   RVDPAGFEAQIPGLRADLAVALIRTLPKTLRRNFVPAPDFARAALDRIDAARPLAEELA
FT                   GALTRMTGVVVRTADFDPDKVPEHLRMNFRIVDEHGATVASGRDLPTLQSTLRTDTQRA
FT                   VVQATKSLERHGLTAFPEPGVPRRVRARVAGHEVTGYPALVVEGPGTVGVAVFDSEADQ
FT                   RRAMRAGTIELLAAALTPSLTRVRQLLTREQQITLATAPGTTIPTLVADATRAAVDALL
FT                   DWAGGPSWSAAGFAAVRTKLTPSMLTSVRDVLAAAETVLSAAGAAARALDTAERGPGAA
FT                   AVADLTRDMRAQWRAAVAPGFIVATGAAGLPDRARQLQALRIRAERVREAAGRDRERLA
FT                   EIRELQAEVDRAVEELPEERRSDPDVQALHHLLAEYRVALFAQPMRTSVPVSAKRIRSA
FT                   AAALGG"
FT   gene            566249..567295
FT                   /locus_tag="Namu_0508"
FT   CDS_pept        566249..567295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0508"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase-like
FT                   protein"
FT                   /note="KEGG: ara:Arad_7409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76927"
FT                   /db_xref="GOA:C8X758"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X758"
FT                   /inference="protein motif:COG:COG1506"
FT                   /protein_id="ACV76927.1"
FT                   /translation="MKPARTAIAVLAGALLLAACGSAATPRPAPASTTAPSASVPSAVG
FT                   PAAPVDPAGPAASDDPAGPPSEQAGDPSGDAPGDPSGALPAAFSDDETMVWIPAGDHRV
FT                   PGTLALPAAAPGRPVPAVLLLHGDLSSRDENAQMFARLAAALAARGIASLRIDFAGTGD
FT                   SEEPDLALDYPDMVADATASLDYLRADEVVDPARVAVLGLSRGGGVGATVTGTEPGVAA
FT                   FVSWSGAVYNGYDEDPDGHDLAREDGYVPLDVGDRTFKLGLNWFDTIEQSHPLDDISGY
FT                   TGPVLAVVGSDDQIVDPEVSTIFLDTVASPDTTLHVVDGADHGFSADQAVGDEAIGVTT
FT                   DWLVARLG"
FT   sig_peptide     566249..566320
FT                   /locus_tag="Namu_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.553 at
FT                   residue 24"
FT   gene            complement(567302..567508)
FT                   /locus_tag="Namu_0509"
FT   CDS_pept        complement(567302..567508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76928"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:C8X759"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76928.1"
FT                   /translation="MVDFNELKDKAQGLVAQHADTIKDGITKTGDFVGDKVGHDKVDPI
FT                   EQKLHGLVDQAAGTDQQPPPPVV"
FT   gene            complement(567561..569171)
FT                   /locus_tag="Namu_0510"
FT   CDS_pept        complement(567561..569171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76929"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR021478"
FT                   /db_xref="UniProtKB/TrEMBL:C8X760"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76929.1"
FT                   /translation="MTSFNRRTLLIGGAAVAAAGAFGITTSTAAADPRPPGAGGPGPRP
FT                   GDGLPAAAVRQVRRWAADTWASLVAMTDERTGLTADNIDGPLAAPHRSGYTSPTNIGGY
FT                   LWSAIVARELGLISKPECSSRIRSTLRTLSTMTRHEPSGMFYNWYDEATGEVLTTWPTD
FT                   GSRVYPFLSSVDNGWLAAALMVVQQADRPNAALARKLWDPMNFAVFYNPAARADLGVGL
FT                   LRGGFWDGEKPDKETTAVRGNYLGSGPEVWYTGFHYDTTVSETRIASYIAIARGQVPAQ
FT                   HYFGTWRTFPDVGCAWSWQEQRPIGQTRTYLGIDVFEGAYTYRGMRIVPGWGGSMFESL
FT                   MPAMFVPEEEWAPRSWGVNHRLTVRAQREHGLDEAQYGYWGFSPASEPGGGYREYGVDA
FT                   IGLNPDGYLSDAEKTNYDAGYDGCRAGTNPTPTYGDGVVTPHALFLAMHMEPGPAYDNL
FT                   VKLVDLGAYGEGGFYDAVAVRSRTVAKRYLSLDQAMIMGSIGNVIGGGVIRNAFATGDI
FT                   RRQIRPLIEIEEFGAGLQS"
FT   sig_peptide     complement(569076..569171)
FT                   /locus_tag="Namu_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.521 at
FT                   residue 32"
FT   gene            complement(569259..570464)
FT                   /locus_tag="Namu_0511"
FT   CDS_pept        complement(569259..570464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0511"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   cak:Caul_5280 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76930"
FT                   /db_xref="GOA:C8X761"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8X761"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACV76930.1"
FT                   /translation="MTTTATLAFPEGFAWGAATAAHQVEGNTVNNDWWAREHTPGSGIA
FT                   EPSGDACDSYHRYREDMALLADAGLNAYRFSLEWSRIEPEEGFVSRAAIDHYRRMVAAC
FT                   HEFGLTPMVTMLHFTVPRWMDARGGWRHPDAVDRFARFTEFSLPIVADGVDWVCTINEP
FT                   NIVSMIHGRRETDLVASGLPAPDEAISEVMRQAHVRSRQVLGSAPALRTGWSVATQAFH
FT                   AEPGCEQQTRDYGYPREDFFLDAARGDDWVGVQAYTRTFIGPDGPRPIPEGTETTLTGW
FT                   EYFPPALGIGVRNAWARTGGVPVFVTENGIATADDQRRIDYTRGALTGLHQAMSDGVDV
FT                   LGYLHWSALDNYEWGSYRPTFGLIAWDRQTFARHPKNSLGWLGRVARANALGPADERVG
FT                   TP"
FT   gene            complement(570538..571434)
FT                   /locus_tag="Namu_0512"
FT   CDS_pept        complement(570538..571434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0512"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1924 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76931"
FT                   /db_xref="GOA:C8X762"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X762"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV76931.1"
FT                   /translation="MTISDETPLALEPGGAPTLTANPRRRSRRRRRLIVYLLLVIGVVA
FT                   TLMPFVWMLLGSVKTDGEILRDPSGFLPQEPTLSNYATWFTDLNISTFFVNSLIVAVVT
FT                   VLGNLLFCSMIGYALAKMEFAGKRLLFLLAMLTLMVPGVVTFVPLFVLVSKLGLLNTYP
FT                   ALILPFLTSPLGVFLMRQFMMGIPDSLIEAARIDGAGELRIFFRVVIPLCGPPLATLGI
FT                   LTFLGSWNNFLWPLVAAQSEQMYTLPVALSLYSTGENATNYGLLQAGSVLVIGPIVLLF
FT                   VLLQRFFVQSVATAGIK"
FT   gene            complement(571443..572387)
FT                   /locus_tag="Namu_0513"
FT   CDS_pept        complement(571443..572387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0513"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xop:PXO_00881 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76932"
FT                   /db_xref="GOA:C8X763"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8X763"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV76932.1"
FT                   /translation="MATTTALPGAVAGPGGARVDPGISRRRRQTLIAWLFALPFVLVFS
FT                   VFMVFPLLSSFLMSFTDFTSRDVTTPLAVGFVGIDQYADLFGNPQFLRSLVNTGYFVIV
FT                   GIPLTMMVALLLAVALNSGITKFRTVFRVGFYTPVVTSIVAIAVVWRFILQPDGLLNSV
FT                   LSWVGITGPDWLNSTTWAMPALILMAVWRSMGTLMIIFPAGLQTIPEDVKEAAAIDGAG
FT                   PWQRFARITLPLLRPTLLLGAVLSSVGYLQFFEEPFVMTKGGPLDSTLSISYFTFNQFG
FT                   FGKYGYASAASYVLFVAIALLSVVQFRALRSKD"
FT   gene            complement(572390..573670)
FT                   /locus_tag="Namu_0514"
FT   CDS_pept        complement(572390..573670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0514"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: xca:xccb100_1974 periplasmic binding protein
FT                   precursor of a sugar import ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76933"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C8X764"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACV76933.1"
FT                   /translation="MFRKKAITAGLLAGLVVLSACGRSSDTAGAAGTSAPAASISAGPA
FT                   TGKLTMWAQGAEGQDLPALLDEFEAANPGVTVDVTAIPWDAAHNKYQTAIAGGQTPDIA
FT                   QMGTTWMGDFADAFDPTPAELTDAGFFPGSVNSTEVDGTAVGVPWYVDTRVVFYRKDLA
FT                   EKAGYTTFPTNYDDFKAMAKALQDKAGAQWGIQLLAGGTDSFQSTLPFGWSAGASLMDS
FT                   GNDAWTLDSPQWVDALTYYQSFFTEGIANPAPNMGAGAAESAFVDGSAPMMISGPYEIG
FT                   NLEKAGGADFTDKYAVATLPKDKSATSFVGGSNLVVFKDSPNRDAAWKLVQWLSQPEVQ
FT                   VKWYQATGDLPSVQSAWQEGVLADDPMLSVFGDQLKDTNSPPAVPTWTQVSAAADSQVE
FT                   QIVKAGKDPAQALQELQSQAASIGIGR"
FT   sig_peptide     complement(573584..573670)
FT                   /locus_tag="Namu_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.194 at
FT                   residue 29"
FT   gene            complement(573852..574961)
FT                   /locus_tag="Namu_0515"
FT   CDS_pept        complement(573852..574961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0515"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: cak:Caul_0415 LacI family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76934"
FT                   /db_xref="GOA:C8X765"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8X765"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACV76934.1"
FT                   /translation="MAKAPTVYDVAERAGVSIATVSFAFRRPEKVKASTRDMVLAVARE
FT                   MGYVPSASARGLAHGRTRAIGLFAFDYLLDSLDRQPPTAAAGSGPADPAGVVEVADPNE
FT                   DFRLFPLYVDEIQRGVGLECWRRGYALLIGGRGHADTDAVIADIAGRVDALAVFPRTVP
FT                   ADTLQRISRRMPVVELSEPGQLDELNHVTVDNVRGTRAVTDHLITAHRLTDFGFLGDTT
FT                   GSDQQARFTGFRAALRAAGLRVPRKSLSPNGTTTFDTGAIVDRLVASGHLPKALVCATD
FT                   QDALAAIDALRRAGVTVPGDVAVVGFDGIVAGRIGHPTLTTVRQPMEQMGREVVDILVS
FT                   QLDQPGQPPIRRELPTRVVIRESCGCPTS"
FT   gene            575083..575589
FT                   /pseudo
FT                   /locus_tag="Namu_0516"
FT   gene            complement(575599..576417)
FT                   /locus_tag="Namu_0517"
FT   CDS_pept        complement(575599..576417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0517"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_C0683
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76935"
FT                   /db_xref="GOA:C8X766"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X766"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76935.1"
FT                   /translation="MTDAAGPASSLTVPVSRGRRMHVTLVGPVDGRPTVALHGLGGRTE
FT                   QNLPALTALSQRYGLRIYAIDLPNHGRSGTVGLLHFRVRHFSALITETVRALGIEPTVL
FT                   VGHSFGGQLAALMAADLAGAELQPIFINPALGAPWDSKLRRCWRQPWRFLRLVQELGYD
FT                   DSNVDRNELYHAGRLLQSILDMLLDRELRPYRRLQATLALLLSCRTAAILDDLNLRGIR
FT                   PVIVQGMLDRSTPANDGVHLVDGFHSWLHEADGPRALLAALDRVFPGKLP"
FT   gene            576887..577783
FT                   /locus_tag="Namu_0518"
FT   CDS_pept        576887..577783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0518"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: pla:Plav_1900 putative
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76936"
FT                   /db_xref="GOA:C8X767"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C8X767"
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /protein_id="ACV76936.1"
FT                   /translation="MPTADGPVRRRWRKVARRTLAKAWGDSLFGMSAQAAFWSALSTAP
FT                   LLLALLGLSGYVARAIGPNTTGEIREQVNVFLHTIFNQEVADNLIGNTVDVILNSSQTD
FT                   VVSVGLIISLWAGSSAMTAFVESIAIAYGQHEFRHPVLERFFALGLYVGALAAGIVMVP
FT                   LLAIGPDYLPRLFPPDWRSAVSEIIGWLYYPGLAIGLILLLTTLYKVAPKDKHRWMRGL
FT                   PGAFLAAAVFLTASTGLRLYLSYVYEHGLTYGALATPITFLLFYYFISMAIIIGAQFNN
FT                   ALLEYYPPRTSRRQRRG"
FT   gene            complement(577792..578925)
FT                   /locus_tag="Namu_0519"
FT   CDS_pept        complement(577792..578925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0519"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   sme:SMc04326 putative aminotransferase protein; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76937"
FT                   /db_xref="GOA:C8X768"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8X768"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV76937.1"
FT                   /translation="MTTLPPFRLESYFARWEFTAKYHLTASDAQTTTIGELLAMGTDDD
FT                   RAAFTELPLGYVPTWGSDALRTAVADTYQQCGPEDILLFAGAEEALFWLLQLVAEPRQH
FT                   AIVTVPNYQALETIPVAAGLQVTGVPLDPDDHWRLDLDAVRAALRPTTRVIAVNFPNNP
FT                   TGAVPDQQTWSELVQLCEERGIRLICDEVYRGLELDPARTLRQAADASPTAVSVNVMSK
FT                   SYGLPGLRVGWIACRDHALLERLERHKHYTSICNAGPSEFLATLALRRGPEIQARNRQI
FT                   IADNIPVLDEFFAGYPDLFDWAPPQGGAVAFPRYRGADGVEAFCRRLVETEGVLLLPAS
FT                   VYTSDLAPVPADRFRIGVGRRDPGAALVALRRYLDGR"
FT   gene            complement(578922..579536)
FT                   /locus_tag="Namu_0520"
FT   CDS_pept        complement(578922..579536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0520"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: sme:SMc04327
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76938"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C8X769"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ACV76938.1"
FT                   /translation="MDDQWWAPQAPVVAAVVALFHPHVEVVAHDIRRDRVVAVWNPLSG
FT                   RKIGDPSLLEPELLQAQRSDAVIGPYPKVDEHGGRWTSVSVPLGQGQGLLCINFDRSAV
FT                   DGAAELLTRFAAAVQPRPDALFERDWPHEVNVLVDDWCRAAQVPRSRLSRPQRLELVAH
FT                   LDGKGVFAVRHAAGHVATSLGVSRATVYDLLKTVRTREESR"
FT   gene            complement(579643..580341)
FT                   /locus_tag="Namu_0521"
FT   CDS_pept        complement(579643..580341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPOA0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76939"
FT                   /db_xref="GOA:C8X770"
FT                   /db_xref="UniProtKB/TrEMBL:C8X770"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76939.1"
FT                   /translation="MTSTVTPTAGIQTTAESRTGRVLTRLGGIALIASPLLTLGGNLTS
FT                   PPQPDESSAGYIASLAADPGISAVSAGLYHYGWITLAFGVLAAIGLVRGPRGRAWTAAA
FT                   AVIAAFGAMQFSGFLLADHYVAALGVLPPDVGAGIFDAANGSIWTQFWLSSAMVTALLG
FT                   VPLMLAGLARAGVIGWWAAPVYVAVWVVPAFLPAPWGALVAGLASAPLVVVGLRLIQRA
FT                   NLTVPQPVAG"
FT   gene            580563..581762
FT                   /locus_tag="Namu_0522"
FT   CDS_pept        580563..581762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0522"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase; PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76940"
FT                   /db_xref="GOA:C8X771"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X771"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACV76940.1"
FT                   /translation="MRPPANRISLTAAVGGAVGIVLGVASLLEASTDPAGVGLDAQTVT
FT                   TALAIALGCGIAPFLPVLGLAVGLAPMVLAVLVFPATPGPAGSLLIALILLVGYASFRL
FT                   PPRPGLAAYVAASLVSGTCVAVQSGSVWEAVFFPLILGAGYGFGVLLRRERFRSAELAR
FT                   LADELRAEREARTRDAVLAERARISRELHDAVAHTVSVMTLQAGVVRRRMPDGSPEQEM
FT                   LRSVEGLGRRSVDELRQVVGLLRTGPSGFESADEVGRQPSLRNLPDLTADVRAAGLPVR
FT                   LDVRGEAVELPDAVDRSAYRIVQEALSNTSRHAGPGTTATVRIDYGPDRVVIEVLDDGR
FT                   PGVVEPASGGGYGLVGMRERVSLIGGSLTAGPLAQGGFSVRADLPVTAGATGGSTAVRR
FT                   "
FT   sig_peptide     580563..580655
FT                   /locus_tag="Namu_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.745 at
FT                   residue 31"
FT   gene            581759..582451
FT                   /locus_tag="Namu_0523"
FT   CDS_pept        581759..582451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0523"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   scl:sce5431 two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76941"
FT                   /db_xref="GOA:C8X772"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X772"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76941.1"
FT                   /translation="MTTSADALRVVLADDEALVRAGLRMLIDGEPDMQVVGEAGDTAAV
FT                   VAVVGRTRPDVVLMDVRMPGGGGIEATRRLAAQSPQVRVIVLTTFDEDAAIDGALRLGA
FT                   AGFLLKTSPPEMLLDAIRRVAAGGGQLDPMVVPRVIAGYAAAPRMGERAPELDRLTPRE
FT                   TEVLQLVARGHNNAEIAALLHLGETTVKTHLGRVLDKLGLRDRNKAIAFAYDSGLVTPD
FT                   AGGPPRRR"
FT   gene            complement(582470..583054)
FT                   /locus_tag="Namu_0524"
FT   CDS_pept        complement(582470..583054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0524"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   bcj:BCAM1818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76942"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:C8X773"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ACV76942.1"
FT                   /translation="MSADQGPARFFAWSSDDGRRLETVRVVITERGLRASGYLVRVGRN
FT                   SFGASYSVLCDAAGRTRRVTLHSDSAITERGLSLTRTPGGPWLDGAGKSPPMPDLDLAL
FT                   DVDFVASVFSNSMAIRRLGLHQRLGQESVVVAEVNFPDLTVEPVVHHYRTIELTEHGAR
FT                   LRHQGPNGHHELSVDSEGFVLDVAHLSYRLR"
FT   gene            583202..584884
FT                   /locus_tag="Namu_0525"
FT   CDS_pept        583202..584884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0525"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: geo:Geob_0745 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76943"
FT                   /db_xref="GOA:C8X774"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X774"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV76943.1"
FT                   /translation="MGHLEFSAVSLALPDGRPLLSDVSFRVSAGDVTALVGPNGTGKTT
FT                   LLRVAAGSVVPDEGAAVCSGSLAYMPQFVGSVRDSSTVRDLLLAVSPEPVRRAAAAIDA
FT                   AELEMMTDESEPVALAYAQALADWADVDGYGHENAFDKATVAALGIHYDRAKYRSVTSL
FT                   SGGEQKRLVLELLLGGSADVLLLDEPDNYLDVPGKQWLEQRLAASAKAVLLVSHDRELL
FT                   ATAASRIVTLEPGAAGATAWVHGGSFATYHQAREDRNSRLEELRRRWDEEHAKLKALVL
FT                   MYKTKAAFNDGLASRYQAAQTRLAKFEQAGPPLAVPHQQRVSMRLGGGRTAKRALVCRR
FT                   LELTGLMQPFDLEVHFGDRVAVLGANGSGKSHFLRLLAAGGSDPDVEHQPVSDEPIEPV
FT                   PHTGSVVLGSRVRPGYFRQTHGHAEWQGRTLLDILHRGDEHRAGMGREQAARVLDRYGL
FT                   ARSSEQLFPTLSGGQQARLQILLLELSGATLLLLDEPTDNLDLHSAEALEQALDAFDGT
FT                   VVAVTHDRAFARTFDAYLIFDADGTVRLSDEPDWAIARVRRAR"
FT   gene            complement(585145..586599)
FT                   /locus_tag="Namu_0526"
FT   CDS_pept        complement(585145..586599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0526"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   scl:sce2733 bis(5'-nucleosyl)- tetraphosphatase
FT                   (symmetrical)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76944"
FT                   /db_xref="GOA:C8X775"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X775"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACV76944.1"
FT                   /translation="MIDLPRPALVVLVGPSGAGKTTWARTHFAANEVVSADALRATVGS
FT                   GEGDLDASVDAFAVLDTVVAARLRRGLTTVIDTLGLDGDRRRTAVALGRRAGLPCVAVV
FT                   FTTALEVCRTRNRARDRPVPAPALRSQHRRTAEIELGDDGFDRILRVDTAGEPVRAGVA
FT                   AAGPAPPPRPGLRFGLQVSAFGWGADPRGWLRDVAVAAERAGFAALSVMDHLLQIPQVG
FT                   RAWDPIPEAYVTLGYLAGVTERIELGPLVTPVTFRSAPLLAKMLATLDTVAPGRVFCGL
FT                   GAGWYAREHAAYGLPGSAFEAIDLPSPRARLDALEETIGVLRAFWGAGTKPYGPFPETT
FT                   CYPRPGPIPILVGGGGERHTLRIAATLADGCNLPSTVDLDRKLAVFRAHAVAAGRDPAG
FT                   LRITVLDVPIVGADPDAVARLVERHRGRSKATAYAAAHHAGTPDAHVARYTRLAEAGVD
FT                   TVFVSLPDLSGPAEIEQFAPVISAFG"
FT   gene            complement(586596..587066)
FT                   /locus_tag="Namu_0527"
FT   CDS_pept        complement(586596..587066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0527"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: azo:azo3923
FT                   leucine-responsive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76945"
FT                   /db_xref="GOA:C8X776"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X776"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACV76945.1"
FT                   /translation="MTIDRLDAQILELFSAEPRVGVLEAARRIGAARNTVQARLDRMQR
FT                   SGVIADLAPTVDPAALGFPVTAFVTVEIAQGRGRRDVVDHLSAIPEVIEVHTITGQADL
FT                   LVQVVSRDNADLQRVIDDVVRDPAVVRASTAIALDTPVRHRTGPLVRSVAGR"
FT   gene            587219..588424
FT                   /locus_tag="Namu_0528"
FT   CDS_pept        587219..588424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0528"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: expressed hypothetical protein; K00457 4-
FT                   hydroxyphenylpyruvate dioxygenase; TIGRFAM:
FT                   4-hydroxyphenylpyruvate dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76946"
FT                   /db_xref="GOA:C8X777"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:C8X777"
FT                   /inference="protein motif:TFAM:TIGR01263"
FT                   /protein_id="ACV76946.1"
FT                   /translation="MTLSFEDTRRAAPDEPTDEALRDLVGLVDHDVTTDPFPVLGMDAV
FT                   VFVCGNATQSAQYFQAVWGMDPFAYRGPETGHRGDVAYALKSGSARFVLTGGVAPDSPL
FT                   LDIHREHGDAVVDLAMEVGDVDRCIEQARRQGARILAEPHDETDEHGTVRSAAIATYGH
FT                   VRHTLIDRRRYTGPYLPGFRPVTTTAVRPDGAPRRLFQALDHAVGNVELGRMDEWVDFY
FT                   NRVMGFVNMAEFVGDDIATEYSALMSKVVANGNHRVKFPLNEPAAGKRKSQIDEYLEFH
FT                   AGPGCQHLALATGDILGTVDALRDRGVRFLDTPDAYYDDPELAARIGPVRVPVAELKKR
FT                   RILVDRDEDGYLLQIFTKPLGDRPTIFFEIIERHGSLGFGKGNFKALFESIEREQAARG
FT                   NL"
FT   gene            complement(588439..589644)
FT                   /locus_tag="Namu_0529"
FT   CDS_pept        complement(588439..589644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0529"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="KEGG: hypothetical protein; K01555
FT                   fumarylacetoacetase; TIGRFAM: fumarylacetoacetase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase; Domain of unknown
FT                   function DUF1969"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76947"
FT                   /db_xref="GOA:C8X778"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C8X778"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ACV76947.1"
FT                   /translation="MASWVPGAAGSGFDDDHLPYGVFDAGAGRRVGVRIGSSVLDLAAV
FT                   ADTPELAGVLAAGSLDPLLAAGPATWAAARSLAHRAVTDPDCRTLVESHLHPLESVRLL
FT                   LPFTVADYVDFYASQWHATAVGRMFRPDADPLPPNWKHLPIGYHGRAGSVVVSGTPVSR
FT                   PRGQTRLPGAAPTFGPTQRLDLEAEVAFVVGVGSPLGSPVPAGAFARHVFGVGLLNDWS
FT                   ARDIQAWEYRPLGPMLGKSFATSVGPWITPLAALAAARVAPPPRTHRLLPYLADDAGLP
FT                   WGLDLALTVEVNGTVVSRPPFAAMYWTGPQLIAHLTSNGARLRTGDLLASGTVSGPAAD
FT                   QAGSLLELSANGTRPVPLGDGTSRTFLADGDVVTITATAPSTGGGRLTLGEVTGAVRPA
FT                   AG"
FT   gene            589673..590893
FT                   /locus_tag="Namu_0530"
FT   CDS_pept        589673..590893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0530"
FT                   /product="homogentisate 12-dioxygenase"
FT                   /note="PFAM: homogentisate 12-dioxygenase; Cupin 2
FT                   conserved barrel domain protein; KEGG: shm:Shewmr7_2363
FT                   homogentisate 1,2- dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76948"
FT                   /db_xref="GOA:C8X779"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8X779"
FT                   /inference="protein motif:PFAM:PF04209"
FT                   /protein_id="ACV76948.1"
FT                   /translation="MAHYRRVGEVPPKRHTQFRDAGGQLRREELMGEEGFSSDSSLLYH
FT                   RGIPSAMVDARIWELPDLGTTPNHPLMPRHLKLHDLFASGEGIDGQGIDGGGIDAVIGR
FT                   RLVLGNGDVRISYVVAAEPSPLYRNAIGDECVFVEAGSGTVQTVFGELPVQAGDFVVIP
FT                   RATVHRWVPDGPLRAYIVEANSHIGPPRKYLSRFGQLLEHSPYCERDLHGPATPLLMDG
FT                   PDVPVYVKHRGNGPSGIVGSIVVGPHHPFDVVGWDGCLYPYTFNVRDFEPITGRVHQPP
FT                   PVHQVFEGTNFVICAFVPRKVDYHPLAIPVPYYHSNVDSDEIMFYVAGDYEARKGSGIG
FT                   PGSVSVHPGGHSHGPQRGAVEASLGKDSFDELAVMVDTFRPLELGEGGRAVDDGAYAWS
FT                   WSGRGPG"
FT   gene            complement(590915..591580)
FT                   /locus_tag="Namu_0531"
FT   CDS_pept        complement(590915..591580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0531"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; Tellurite resistance methyltransferase, TehB,
FT                   core; thiopurine S-methyltransferase; KEGG:
FT                   afw:Anae109_3264 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76949"
FT                   /db_xref="GOA:C8X780"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8X780"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACV76949.1"
FT                   /translation="MTPPHTHTGHGAGTTTDDPREFWENRYREKDGIWSGRANTMLVRT
FT                   VAELPPGRALDLGSGEGGDAIWLAERGWQVTGVELSGIAIARAVAAAADRGVATGRVNF
FT                   VAADLQTWRTDERYDLVCACFLQSPVEFARDEVLRRAATLVAPGGHLLVVAHAAAPPWS
FT                   GLAGDPSIVFPTPAGDLAALALSDDWDVLVCEVRTRPATGPDGQESTLEDSVVLVRRP"
FT   gene            complement(591639..592673)
FT                   /pseudo
FT                   /locus_tag="Namu_0532"
FT   gene            592783..593277
FT                   /locus_tag="Namu_0533"
FT   CDS_pept        592783..593277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76950"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:C8X781"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76950.1"
FT                   /translation="MSTAGTNTTEGFGVAVTREDSTWRCSLLAPELLDDLDGVITGLRR
FT                   VASSGPVFAMLAVDDEFFVIVRPIPGGAALLLSDATAGLDYDIAADVLDLLQVQIPEDD
FT                   EVDDEPWPEGDLGLLADLGVAEQEMQLIVDDVDLYPDEQLSMIAARCGFADAFSAILEK
FT                   V"
FT   gene            593289..593768
FT                   /locus_tag="Namu_0534"
FT   CDS_pept        593289..593768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0534"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   ade:Adeh_3638 tRNA-adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76951"
FT                   /db_xref="GOA:C8X782"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C8X782"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACV76951.1"
FT                   /translation="MPGARDAADAELIRQALNLARRAPDTGDLPIGALVLDPDGVVIGR
FT                   GRNAREATGDPTAHAEILALRQAAAARGQWNLTGCTLAVTVEPCTMCAGAVVLARIETV
FT                   VFGCWEPKTGAAGSLWDVLRDRRLTHRVQVRGGVLEQESAQLLRTFFADHRQPGE"
FT   gene            593775..594824
FT                   /locus_tag="Namu_0535"
FT   CDS_pept        593775..594824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0535"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   ara:Arad_3301 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76952"
FT                   /db_xref="GOA:C8X783"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C8X783"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACV76952.1"
FT                   /translation="MQLGVYSFGDIHPNPVTHEKVSPAQRMADLLERIRLAEQVGLDFF
FT                   GIGEHHRPDYAVSAPATVLAAAAGQTSRIGLGSAVTVLSTEDPVRVYQQYATIDLISRG
FT                   RVELMAGRGSFIESYPLFGAELSDYDALYDEKIQLLLQIDAGNPVTWSGQFRPRLDKAV
FT                   ILPRPYPKPELGEHLRISVATGGNPESSVRAGLLGLPVNYAIIGGQPARFAPLVDLYRR
FT                   ACAQSERRGAVPQVAVSGMGFISDDGRALDTFFPYWFDSMRRIARERRFPAPDRASYEA
FT                   QAAPGGAYFIGTPEQVAERIVTLHGVLGHDRQLFQMDLSSVPQADSLRAIELLGTAVVP
FT                   LVRAEIGTA"
FT   gene            595051..596076
FT                   /locus_tag="Namu_0536"
FT   CDS_pept        595051..596076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0536"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bra:BRADO4353 putative alcohol dehydrogenase
FT                   (zinc-containing)(AdhT-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76953"
FT                   /db_xref="GOA:C8X784"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X784"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACV76953.1"
FT                   /translation="MRAVRVVGYHRNLELTEVPKPEITGPHDVIVKIGGAGVCRTDLHI
FT                   LEGQWEPKTHVALPYTIGHENAGWVDAVGSAVTNVKVGDKVIMHPLITCGLCRACRFGD
FT                   DVHCENSQFPGIDTEGGYADYLKTSARSVVKIDDSLEPADVAALADAGLTAYHAAAKAA
FT                   RKLRPGDRCVMIGAGGLGHIGIQVLKALSPADLIVVDRNPAALELAKSIGADITVVADG
FT                   TEVQQILDITGGHGAEQVIDFVGEGGSTAKGLDMTRRAGDYHVVGYGENVDIATIDLIS
FT                   TERNIIGNLVGSYNDLVELMALAARGKVTLHTAKYRLDQFQDALDDLDAGKVRGRAILI
FT                   P"
FT   gene            complement(596164..597738)
FT                   /locus_tag="Namu_0537"
FT   CDS_pept        complement(596164..597738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0537"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   plu:plu3561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76954"
FT                   /db_xref="GOA:C8X785"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X785"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV76954.1"
FT                   /translation="MTSTLHPIATSATGAPVTLSTTPSAGPRAGVREWIALAVLMLPVL
FT                   LVAVDATVLSFALPSISQSLTPTGTQLLWMVDIYPLVLAGLLVSMGSLADRIGRRRLLL
FT                   IGAVGFAAVSALAAYAPSAQWLIAARAALGFFGAMLMPATLSLLRNLFVDRQQRRLAIA
FT                   IWAAGFSGGAALGPIVGGFLLEHYWWGSAFLMAVPVLVLLLILAPIFVPESKDPNPGRL
FT                   DLVSIALSLLTMAPLVYAIKAVAHDGISTLAIGLVAVGLLAGSAFVRRQLTRPNPMLDV
FT                   RLFRRSAFTGAVLANLLAVFALVGFLFFVAQHLQLVLGHSPMQAGLILLPGLIVTIVAG
FT                   LAVVPLVRVVPPRVVVAGGLLISAAGYTAILFTANDPSAFGLGAAFVLLSLGIGAAETI
FT                   SNDVIVSSVPADKAGAASAISETAYELGAVLGTAVLGGILSAVYSARVVVPAGLDAAAA
FT                   TSASETLGGATTVAATLPEPAATELLDSARHAFDGGVVLTSGIAVVLVLAAAALVWVTL
FT                   RGKGAES"
FT   sig_peptide     complement(597661..597738)
FT                   /locus_tag="Namu_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.796 at
FT                   residue 26"
FT   gene            597854..598441
FT                   /locus_tag="Namu_0538"
FT   CDS_pept        597854..598441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0538"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mno:Mnod_1665
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76955"
FT                   /db_xref="GOA:C8X786"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C8X786"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV76955.1"
FT                   /translation="MPPPPAARDRVLDALERLLVASGERAATLEAVAREAGVSKGGLIY
FT                   HFPSREAMVEGLLDRMRARAADDLALMAAAPEGVVAYFLRTSQNADTPFDRSLVAATRL
FT                   RSHASAREALGEVQRQWYDAILTAVGDQTVAQMVMLMGDGLYYNASAPDALASVGTPQY
FT                   QAKVEDMVELVAALVRLRGEAGQGRSTPAQPV"
FT   gene            598450..598539
FT                   /locus_tag="Namu_R0007"
FT                   /note="tRNA-Ser4"
FT   tRNA            598450..598539
FT                   /locus_tag="Namu_R0007"
FT                   /product="tRNA-Ser"
FT   gene            598840..599184
FT                   /locus_tag="Namu_0539"
FT   CDS_pept        598840..599184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76956"
FT                   /db_xref="UniProtKB/TrEMBL:C8X787"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76956.1"
FT                   /translation="MVSDGQPRSHLLGTFARIVTEEMAGERKAASDPNWKGRLLSEVLE
FT                   ETGGQYEYVLDIPDRVMADLQRHVDLVDDPVARQVLETGRLVVPFENLNGLDPATTRVA
FT                   LGFGFGGHPA"
FT   gene            complement(599324..600052)
FT                   /pseudo
FT                   /locus_tag="Namu_0540"
FT   gene            complement(601016..603217)
FT                   /locus_tag="Namu_0541"
FT   CDS_pept        complement(601016..603217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC1623 chromosome segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76957"
FT                   /db_xref="UniProtKB/TrEMBL:C8X788"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76957.1"
FT                   /translation="MASERFKLALDQVGPDNWREFEVLAAEFLVTDYPSLRTMAASTGD
FT                   KGRDGELFSPSENSSSVAIQYSVAENWKDKISKTLKRLEETMPNLRTLIYVTNQRIGPS
FT                   ADELKRKIQEKGITVDVRDQSWFLERELTSPQRQVAAAELAERFVDPLLSARGVKQTVA
FT                   TVLDDSEAQVALLHLALDVQDKATDKGLTKTSFETLVIAALEGTTSDRTIGSDQIIQRV
FT                   CAMMPSGNPRQVQEQATSALRRLTSKGGPVHFHKSSDSYCLSHEKATQVRERMAEYVND
FT                   ETSLELQIKDLVNAAADGEIGAIEGEVFDACARNLRGAIEQLLLEKGEAFAGAVSSGRM
FT                   VQLDAEQVRAAVVSLVPTEFPVTVEQAVGIIVEVMQRPLGSTRRHLRRLADAYTLFAFL
FT                   RQVPDVQKTIVKLFDGGHIWLDTTVILPMLAETLILEPSERPFTVLLKAARESGIQLFV
FT                   TSGIVEEVERHINRSLTFARGTREKWRGSVPFLYGVFALSGRSRASFSGWTEEFRGDVR
FT                   PEDDVAEALWGLFRVGKRDLLQYSDAADLSLRGAVQEVWQEAHDRRRGTGANSDLDSMT
FT                   VNRLVAHDVENCVGVIQLRKGQPASPVGYRSWFLTMDRTAFSLVDELPRRIGPKAPGSP
FT                   IISPDFLSEFLRLGSLRTAIDQELRVNLPVVTDLGRFGNFPVNLVETAEEIRRESGEIS
FT                   ERLIRRRVRDTLDAERLRLGVKAYGGLSAVREEFASKFG"
FT   gene            complement(603794..605113)
FT                   /locus_tag="Namu_0542"
FT   CDS_pept        complement(603794..605113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0542"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: pmy:Pmen_4491 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76958"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C8X711"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACV76958.1"
FT                   /translation="MDQSSSLLLDIDGLVVDQVVRDDVGRRVVHCSTDPQLAGWCPECG
FT                   EQSRSPKAWVTTRPRDVRLGEDRPILLWRKRKWRCQVDGCERKVFTECLPEQIPARARI
FT                   TTRARRLAAEAIGDHTRPVSGVAAEFGMDWRVAHDAFVAHAAQVLPEQPPPVTVLGVDE
FT                   TRRGKAHYETDPTTGAKTWVDRFDTGLVDLSGNGGLFAQVNGRTSKVLIEWLQAQDPDW
FT                   LANITHISMDTSATYARAARLALPDAVVVVDRFHLSALANKAVTDYRRELAWALRGRRG
FT                   RKSDPEWAQRNRLLRAAESLTDDELAKVQDAMRRADPSGGLEKCWQGKELLRKLLKLAG
FT                   TNPDRGRIFNALTAFYLHCADSGVAQLRRLAWTVHAWQNSIIAGLHTGISNGRTEGYNR
FT                   IVKHIGRIAFGFRNQDNQKRRVRYACTRKSRASTSHAKPC"
FT   gene            605376..606047
FT                   /locus_tag="Namu_0543"
FT   CDS_pept        605376..606047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0543"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   domain protein"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: bra:BRADO0997 putative
FT                   flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76959"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X790"
FT                   /inference="protein motif:PFAM:PF01210"
FT                   /protein_id="ACV76959.1"
FT                   /translation="MAVSKTQHVVVVGAAGAIGRLVAVDLLRKGHEVSAVVRSPGKFQD
FT                   LDVTRELTTDQAQRLRIVQADARDAATLTTVITPKSIVVTAFGVSKRRSNGLFAEAAVA
FT                   IVDAMRCCGAARVIAITSSGVRADDHELAAWYRLLVRPLLRDVYEDMARMEQIFTNAEL
FT                   EWCFVRPVFLTDREGEDPPRIEDAQTPAGGRTVSRGAVARFIVGEIESRRWTRKAPTLA
FT                   V"
FT   gene            complement(606074..606721)
FT                   /locus_tag="Namu_0544"
FT   CDS_pept        complement(606074..606721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0544"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: scl:sce5431 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76960"
FT                   /db_xref="GOA:C8X791"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X791"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV76960.1"
FT                   /translation="MSIRVLIADDQPIVRTGLTMLLDAQPGIDVVGAAADGREAVRLAL
FT                   QLRPDVGLFDIRMPLMDGIEATRLLAGPDVTDPLPIVVITTFDLDEYVHGALKAGARGF
FT                   LLKDAGPALLTQAIHAAADGDALIAPSVTVRLLAAFAQAPTSPPRQPLEPLTAREEEVL
FT                   VTVAQGRTNSEIASQLFITSSTVKAHVASLMRKLGARNRVEVAMWAHETGRI"
FT   gene            complement(606718..607866)
FT                   /locus_tag="Namu_0545"
FT   CDS_pept        complement(606718..607866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0545"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76961"
FT                   /db_xref="GOA:C8X792"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X792"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACV76961.1"
FT                   /translation="MATSALRSLWAEPRPTNAPDLGPRDWALVAALTCWSVIEAVLRQD
FT                   LASGPLLLLAALAVIGPLLWRRTHPLLAVVVCFGTLTIVDLVRILTGPHGALLNSTAAT
FT                   LILTYALFRWGSGREAVCGLGIVLLWLPITIHGADPTSLAEAVAGYAFFLFAAALGAAI
FT                   RYRTKIRIREIDHAKAREREQLARELHDTVAHHVSGIVIQAQAGRAVAASHPEQAVEAL
FT                   AVIEDAATRTLTELRAIVGVLRASQDTELAPQPGVAQVEQLATDGLTRPCVEVTLSGEF
FT                   DNLSPAVGAAIYRLAQESITNARRHARHATQVSVAVHGDADQVRLTVDDDGSAAGGRGP
FT                   AGYGLVGMRERALLLGGTFDAGPAAERGWRVEAVLPRTGRPR"
FT   gene            608028..608552
FT                   /locus_tag="Namu_0546"
FT   CDS_pept        608028..608552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76962"
FT                   /db_xref="GOA:C8X793"
FT                   /db_xref="UniProtKB/TrEMBL:C8X793"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76962.1"
FT                   /translation="MRTLQSHTAQENPPSRSPLEVLRLPVQAKLAAAWTSLMFFVIYID
FT                   YFHLYQPGAIDQIRGGGVYEFDITPTLVTIFLVVIGIPALMVMLSMTLPGRVNRATNVI
FT                   AASLYIPVMVFNAAGASSDWAFYYGLSIGVEVVLLAFIVRSAWTWPRRTASPATLAAGL
FT                   NNEPPRTTQQA"
FT   gene            608609..609181
FT                   /locus_tag="Namu_0547"
FT   CDS_pept        608609..609181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0547"
FT                   /product="aminoglycoside 3-N-acetyltransferase"
FT                   /note="PFAM: aminoglycoside 3-N-acetyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76963"
FT                   /db_xref="GOA:C8X794"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C8X794"
FT                   /inference="protein motif:PFAM:PF02522"
FT                   /protein_id="ACV76963.1"
FT                   /translation="MALVTVEQLVGDLGALGIARSSVVLAHTSLSRLGRVVGGEQAVIA
FT                   ALLQAIGPAGTLVMPSQSWQLCDPGYLDDPDVPPEVWPLVRDHLPAYDPAGTPTRTMGA
FT                   VAELFRTLPGAVRSHHPHRSFAALGPHAAEIVAVHDLDCPNGERSPLKTMYDLDSWTLL
FT                   LGVGGRPEVLRPGRAARRSRSPAPHLG"
FT   gene            complement(609126..609497)
FT                   /locus_tag="Namu_0548"
FT   CDS_pept        complement(609126..609497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0548"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: spe:Spro_3719 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76964"
FT                   /db_xref="GOA:C8X795"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8X795"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACV76964.1"
FT                   /translation="MAGMNVVIDPESAVPPFEQVRAQLAHRIADGTLPVGTKLPTVRAL
FT                   AADLSLATNTVARAYRELETAGMIETRGRAGTFVAASGDASRTRVAAAAADYVTTVDRL
FT                   GVSRDEALAIVTAALRGRA"
FT   gene            complement(609541..609921)
FT                   /locus_tag="Namu_0549"
FT   CDS_pept        complement(609541..609921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0549"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: afw:Anae109_3157
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76965"
FT                   /db_xref="GOA:C8X796"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C8X796"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACV76965.1"
FT                   /translation="MLTDSPAFSGFAVSDVETARRFYTDVLGLRVEQNTEMGGLLTLHL
FT                   GGDTNVLVYPRPNHEPASYTVLNFPVADVGAAVRELTGRGVRFERYPGMPQDEDGVMRG
FT                   NGPDIAWFTDPAGNIFSVIARD"
FT   gene            complement(609975..611918)
FT                   /locus_tag="Namu_0550"
FT   CDS_pept        complement(609975..611918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0550"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: ade:Adeh_2705 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76966"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C8X797"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACV76966.1"
FT                   /translation="MTARRRYSYRAYDGGPDPLAPPFDLREAIDRIGADVLDGSSPRQA
FT                   LQELLRRGLGERRGLDELTRQLWQRRRELQRNNRLDGTLQQVRELLDRALTAERKALAR
FT                   QDSDDARFGELQLDALPTDAAGAVRELENYDWQSPDGRAAYEQIRDLLGREMLDQRFAG
FT                   MKQALENATSQDVQAIRDMLADLNELLSAHARLEDTTERFGEFMNRHGHFFPEQPRTTD
FT                   ELIDVLAARSAAAQRMMNSLSADQRAELAALTEQAFGDPRLAQSLAQLDAMLQQLRPGQ
FT                   DWDGSGRFRGDNPMGMGEATRALEELGRLESLGEQLAQGYPGASLDDIDLDLLQDVLGE
FT                   QARVDARALAELERELREQGLLERAADGSLQLSPKALRRLGQTALRDIADQVAGRSGER
FT                   ETRRSGPAGEASGATRPWAFGDTEPWHVPRTLLNAQVRRAGGDPRVLDVTDVEVVETER
FT                   RARAAVALCVDTSWSMVQEGRWVPMKRTALALHQLISTRFRGDDLALITFGRHAEKVEL
FT                   GQLVGLEGAYVQGTNLHHALLLAGAHLRRHPDATPVVLVVTDGEPTAHLEPDGSPHFSY
FT                   PPDPETVHATVGELDRLTGLRAAVTFFILGDDPRLALFTDKLARRCGGRVVAPDLDGLG
FT                   ASVVADYLRHRR"
FT   gene            complement(611922..613316)
FT                   /locus_tag="Namu_0551"
FT   CDS_pept        complement(611922..613316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0551"
FT                   /product="Mg-chelatase subunit ChlI-like protein"
FT                   /note="KEGG: rpe:RPE_1306 magnesium chelatase ATPase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76967"
FT                   /db_xref="GOA:C8X798"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X798"
FT                   /inference="protein motif:COG:COG1239"
FT                   /protein_id="ACV76967.1"
FT                   /translation="MTITAPADLPRTLGALRASGHRLRGVRDEIRENLMLSLRSGVNPW
FT                   SGIVGFDTTVLPQLERALLAGHDIVLLGERGQGKTRLLRTLPLLLDEWSPVIEGSDLGE
FT                   HPYEPITPVSVRRANDLGDDLPVAWRHRSQRYAEKLATPDTAVADLIGDVDPVKVAEGR
FT                   SLGDPETIHYGLVPRAHRGIIAINELPDLAERIQVSLLNVMEERDIQVRGYTLRLPLDV
FT                   LLVASANPEDYTNRGRIITPLKDRFGAEIRTHYPLELSDEVAVIRQEAHLVAAVPEHLL
FT                   EILARFTRLLRESSAIDQGSGVSARFSVAAAETVAAAALRRAALSRESTATARPVDLLS
FT                   VPSVLRGKLEFAAGEEGREDEILEHLLRRATADTARRALRGVDLTPLAEAVTATPVRTG
FT                   DLVPAAAVVASLPPVATVTDVATRLGAAGTEDPGPMASAAELALELLFLTRKLAKSADD
FT                   DTVQYG"
FT   gene            613439..613654
FT                   /locus_tag="Namu_0552"
FT   CDS_pept        613439..613654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76968"
FT                   /db_xref="GOA:C8X799"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C8X799"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76968.1"
FT                   /translation="MAKRKWSELSTPAKVGVVGLAAVEAVVTTIAARDLAGRTDSQVNG
FT                   PRWLWRVAFFVQPFGPAGYLLFGRKR"
FT   gene            complement(613886..614893)
FT                   /locus_tag="Namu_0553"
FT   CDS_pept        complement(613886..614893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0553"
FT                   /product="DNA primase small subunit"
FT                   /note="PFAM: DNA primase small subunit; KEGG:
FT                   afw:Anae109_0939 DNA ligase D"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76969"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A0"
FT                   /inference="protein motif:PFAM:PF01896"
FT                   /protein_id="ACV76969.1"
FT                   /translation="MAPDSARPRRRPRPAETRDGVELTNLDVPLADGPETKRELVDYLD
FT                   AVADRLIPVLADRALSVVRVRPGQPPFMQKNLPTYTPDWVATTTVWAHASHREIRYALG
FT                   NDRRTLLWFANQRAVEYHPALIPVGRTGPTHLILDLDPPPGAGFDVVVATAHLVRRTLD
FT                   ELGLAGAVKTSGSKGVHIFVPLTDDVEVEESAAATRAIAVRAAQLDPQVATTAYIVEDR
FT                   AGKVFIDATRSGGATVVAAYSPRLRPGLPVSFPVSWAELDRCHPSDFTIGNAAARLGDA
FT                   DPWRASMPPPQRLPAELVEHGRTIPVARVAAMHEGKRRARARRAATPTPDAGPS"
FT   gene            614948..615847
FT                   /locus_tag="Namu_0554"
FT   CDS_pept        614948..615847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0554"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: dac:Daci_4251
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76970"
FT                   /db_xref="GOA:C8X7A1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A1"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACV76970.1"
FT                   /translation="MRKAPLPVRDGLNPSRIRLPDEGSGTVVEYLLERFAADATRVREK
FT                   VDAGEVVDGEGRVVDPSTPLTSSQWVFLYRDPAPEPRVPFEIEILHRDSDLLVVDKPHF
FT                   LATMPRGLHIVESALVRLRRELDLPELSPIHRLDRVTAGVLVFSLRPANRGAYQTLFAQ
FT                   RKVTKYYEAVAGHRADLTLPTTVESRIVKFRGTPTAQQVPGEPNARTVVERLAARGERA
FT                   LYGLHPHTGKVHQLRLHMTSLGVPIVGDNFYPTLLDTPRDDYSDPLQLLARSIEFPDPF
FT                   TGRRRRFESRRTLAAWPG"
FT   gene            615966..617771
FT                   /locus_tag="Namu_0555"
FT   CDS_pept        615966..617771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0555"
FT                   /product="anti-sigma-factor antagonist"
FT                   /EC_number="3.5.1.2"
FT                   /note="KEGG: bja:bll3935 putative glutaminase; PFAM:
FT                   Glutaminase, core; Sulfate transporter/antisigma-factor
FT                   antagonist STAS; cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76971"
FT                   /db_xref="GOA:C8X7A2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A2"
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /protein_id="ACV76971.1"
FT                   /translation="MKSLVQDYIDGVYRDLTGERSGSVADYIPELAVVDPDSFAICLAT
FT                   SDGYVYEAGDSRKKFAIQSISKPFTYALALADRGLAAVATKVDVEPSGEPFNEISLDPV
FT                   TERPRNPMINAGAITSASLVAGATVAERFERIRRFYSRFAGRELTLNESMFESEDRTGN
FT                   RNRAIGYLLREYGILEEDPQTTLGVYFRQCSIEVDCRDLSLMAATLADSGVHPVSGDRV
FT                   LDAGLNERVLSVMTTCGMYNAAGDWVTEVGLPAKSGVGGGILAVLPGQLGLAVFSPRLD
FT                   EHGNSVRGVRSCRRISKDLELHFMHVSRAARSAVRASYDVIDRPSRRRRSPAEHDLLLR
FT                   VGQRARIYELHGDLLFAGAESVVRKLTLDADELDVIVLDIRGVDETAAVTRTMMRTVRD
FT                   WLRADGVEAVIVDPQSTVLELDPDPAKRLRHFGDLNEAVGYAEDVLLARHAGADAQARA
FT                   IPIRDHPLLSGLPPEQLEAIVTRLVPHTYDAGDSVVRSGDPTQGLFLITAGPVEVSVEL
FT                   AGTRHHLSMFTAGTTFGVAYAVAGREYDVDATAQGEVAAMVLPAPAIAELTATAPDLML
FT                   TLMSRLVTGAFDHLDWVTRALVSPS"
FT   gene            complement(617772..618983)
FT                   /locus_tag="Namu_0556"
FT   CDS_pept        complement(617772..618983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0556"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xac:XAC2234 MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76972"
FT                   /db_xref="GOA:C8X7A3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV76972.1"
FT                   /translation="MSEPHTPAPSRVGATVGLVLLALNLRGPLVAISAVAVDLQTDLGM
FT                   TAGTVGLLTSLPVLCFGLASPAASGLIGRLGIEIAVLATLLVIFIGILVRSAGAVPAAF
FT                   VGTLLIGLAITVGNVLGPLIVGRDFRTRVAQMTGAYTAALNVGSMVALAVSGPLAVAFG
FT                   WQVALAAGAVVPVLAAVVWVPLTARARRRRAAAAARPTPAQPDRPRESVPRVSVLRRPS
FT                   TWLLTGAFAGQAYAYYGLTAWLPTVLGDQVGMTRGEAGAASSIFQIAALIGAFGAPVII
FT                   NRMGGPLVAFLVNGVLWTALPLGLLLAPELWAVWSAASGIAQGGGFVTIFTVVVWRARS
FT                   LRENRQLSSVVQTGGYCVACLGPTVLGVLRDSTGAWSASLLTAVVGTMTLMVLGALASV
FT                   GLKR"
FT   gene            619121..620020
FT                   /locus_tag="Namu_0557"
FT   CDS_pept        619121..620020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0557"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76973"
FT                   /db_xref="GOA:C8X7A4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4Y7D"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACV76973.1"
FT                   /translation="MATSEASRDESVQTVSTARGEVDCVIVGAGPPVLVVHGSPGGHDA
FT                   GLAMARFLVAEGLRAIVVDRPGYFGTPLGSGVTPDEQAELYAALFDALGLAAAGVLCWS
FT                   GGGPSSYRLAARHPDRVRALVSVAAVSHRYHFDGEKGAEKVLMGTGLGRRMLQLMAAHT
FT                   PEKLVSATIAAEGHLSKEHVAERVAQIMADPDKERFTLELAVSANHSGPRKAGFDNDMD
FT                   QFARIDSLELDRITAPTLVVSGTADSDVDPEFSRFAAAQIAGSELVHLDAGTHLAFWVH
FT                   PDSGPVRRRAAELLRAGG"
FT   gene            complement(620034..620444)
FT                   /locus_tag="Namu_0558"
FT   CDS_pept        complement(620034..620444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0558"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bba:Bd3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76974"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A5"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACV76974.1"
FT                   /translation="MTSRPVGLTRDAGFQIGVSRSVAVPLEQVWDTLVSDAGVRTWLGA
FT                   DVQLPSAAGAPYRTATGTTGEVRSFHPHDRVRLTWRPPDWNHESTVQVTVSRRNGRTVL
FT                   RFHQERLADPDERDRQRAHWQSVLDSLVEQLP"
FT   gene            complement(620444..621037)
FT                   /locus_tag="Namu_0559"
FT   CDS_pept        complement(620444..621037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0559"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   cak:Caul_4029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76975"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A6"
FT                   /inference="protein motif:PFAM:PF07336"
FT                   /protein_id="ACV76975.1"
FT                   /translation="MVGPGIVLTPRHGGAWRFDPGALFLEFLLTGGPGELAVFDRLHEP
FT                   DDLRHWIGASRLGLAGTDVAVSPADLGPARLLRDALWRATRAASAGIAVTDGDTRAIER
FT                   IAAAPPLIPLWGSRWHTPAGAPAVLSTIARDAITVLAVDGHRVRECAADDCRLVFLDTS
FT                   RPGARRWCSMQRCGNRHKVRDYRSRESSPPDGDD"
FT   gene            621095..622369
FT                   /locus_tag="Namu_0560"
FT   CDS_pept        621095..622369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0560"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: gsu:GSU2619 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: queuine tRNA-ribosyltransferase; tRNA- guanine
FT                   transglycosylase, various specificities; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76976"
FT                   /db_xref="GOA:C8X7A7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A7"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ACV76976.1"
FT                   /translation="MHNGSGFGFVVGSRLPDRQGRTGVITTPHGTIRTPAFVAVGTKAT
FT                   VKSLLPESVAQLGAQAVLANAYHLYLQPGPDIVEAAGGLGAFMHWPGPTFTDSGGFQVM
FT                   SLGVGFKKVLAMNTAGLQSDDVIAPGKNRLATVDEDGVTFKSHLDGSLHRFSPEISMGI
FT                   QHQLGADIIFAFDECTTLMNTRGYQERSVVRTHEWAARCVAEHRRLTDERVGRPYQALF
FT                   GVVQGAQYEDLRRQATRDLLTLGFDGFGIGGALEKENLGTIVRWVCEELPEHLPRHLLG
FT                   ISEPDDMFTAIENGTDTFDCVSPSRVARNGSLYTERGRINITNARFKRDFGPLDEDCDC
FT                   HTCAHYTRAYVHHLFRAKEMLSATLATIHNERFVVRLVDRIRDSIDDGSFDEFRAHFLG
FT                   RYYAARGGAPAPVLLPGPVNGGENP"
FT   gene            622366..623838
FT                   /locus_tag="Namu_0561"
FT   CDS_pept        622366..623838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0561"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pfo:Pfl01_1044
FT                   gamma-aminobutyraldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76977"
FT                   /db_xref="GOA:C8X7A8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A8"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACV76977.1"
FT                   /translation="MSQFINGQVRTSSSTGETAPVIDPSTGAIIEQVALAGPAEVDEAV
FT                   RAATAAYRSWSRATPGERSAVLGRFARLLADRAEDFAQVESRQAGKPIRLTREFDVPGT
FT                   IDNIDFFAGAARNLEGKATAEYSADHTSSIRREPVGVIGSIAPWNYPLQMAAWKILPAI
FT                   AAGNTIVLKPAEITPLTSVMFAQAAQAAGLPDGVVNVITGRGPVAGAALLRHPAVAMLS
FT                   FTGSTAVGRTVLEAAATTAKRVHLELGGKAPFVVFDDADLDAAIHGAVAGSLINTGQDC
FT                   TAATRAIVHRSLYPDFVAGVAELYGRVVLGPTADPATDLGPLVSMAHRDKVAGMVERAR
FT                   GLARVIGGGIPGGELAAGSYYRPTLVADAPVDSEIVRDEVFGPVLAAYSFDSDEQAIEL
FT                   ANDTPYGLAASVWTRDVYRALRATGEIRAGCVWVNDHIPIISEMPHGGMKQSGFGKDMS
FT                   SYSFDEYTVLKHVMYDRTARVRKDWHRTIFTG"
FT   gene            624034..624210
FT                   /locus_tag="Namu_0562"
FT   CDS_pept        624034..624210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76978"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7A9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76978.1"
FT                   /translation="MNVFRKTAVAVLAAAALTGIGAGVASAAPATNLTGGQQDVRFFNA
FT                   SPTGCSSPGSTRA"
FT   sig_peptide     624034..624117
FT                   /locus_tag="Namu_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            624180..625175
FT                   /locus_tag="Namu_0563"
FT   CDS_pept        624180..625175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_2g04620 putative membrane-anchored
FT                   cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76979"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76979.1"
FT                   /translation="MFVARVDQGLSPMIQDIEPGQSATMSAAQLAGLNGQLEVGEIDNA
FT                   QNVADIDAIAVSGYQPGVAACQPVPGRSNAPEMGCLVQTPNVLAGESGPMQVSIWTLNP
FT                   KHNGATTNLDANAGDKVAMGNWLSGLAALNPAYVTFDPNVDTVGWGYGPQAQAGPAVWN
FT                   CGAGNANETIGGGATHEESTNVTGTFSITQGIKLFDTVDTEISASISVGHTWTNSTTDS
FT                   YTIGHDIPSKSVGWLGSIPSTETVSGTVTATTQSGYPVSISNITFTEPGVDKTNNPALE
FT                   YQYVPHDRPMTADEINTYCSVGSAANTTRHDSIVTGGIVPDVTAGARAAA"
FT   gene            complement(625256..625558)
FT                   /pseudo
FT                   /locus_tag="Namu_0564"
FT   gene            complement(625592..625939)
FT                   /locus_tag="Namu_0565"
FT   CDS_pept        complement(625592..625939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76980"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76980.1"
FT                   /translation="MVQLADARKSADQRRSHDLEIEGASPRYKPGEFAAMEIALALTAS
FT                   TPTEHQQIARARRLQAKAPDAWDAWIAGDINEAKAHQISHALRKLERADSKRMLNLDVV
FT                   VAARPLTDPAG"
FT   gene            complement(625978..627576)
FT                   /locus_tag="Namu_0566"
FT   CDS_pept        complement(625978..627576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0566"
FT                   /product="transcriptional regulator, PucR family"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   pag:PLES_34081 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76981"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B2"
FT                   /inference="protein motif:PFAM:PF07905"
FT                   /protein_id="ACV76981.1"
FT                   /translation="MIPTVREVLTLPVVAPGRPTVVGGARHLDKPVRWVHSSDVTDLTG
FT                   LLQGGELVLSTGLAFVGRPQAVPDYLRMLAHLRVSALVIELLHIDELPPGSGELADRLA
FT                   LPVITLAGSVPFVEVTEQVHRMIVADRYDELQFARTTHETFTRLNIGRASPTDIVTRAS
FT                   QILAAPLVLEDLNRHVLAYCSAGRPAARLLDGWSQRSRQHSAAGEGWTAVPVGVGAEQW
FT                   GRLVLPAEAADAGRARMVLERATQSLQLQRMIERDRDALLVQALGGLLDDLTSGRITDE
FT                   SEALARAGALGLTVGARYLPLVIKVPRRTGADALAQGAVDRRVLAAARQSVTAAGLSAI
FT                   GSVRREGTVALVMGCPHPAAADRSLDAVCAGLQERLAGRAGIGGWVAGTASASAGLIDA
FT                   AAGLVEADHVAEVGLTMVGGGTAGQRLFRSSDVRLRGLFTLLRGDRRVQAFAETELGRL
FT                   LDHDARTGEDLMAVLRAYLGCGGSKTRTAQATGLSRPTLYARLSVIERILGVSLEPVES
FT                   RTSLHAALMIIDARD"
FT   gene            627718..629109
FT                   /locus_tag="Namu_0567"
FT   CDS_pept        627718..629109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0567"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bac:BamMC406_5857 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76982"
FT                   /db_xref="GOA:C8X7B3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B3"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACV76982.1"
FT                   /translation="MTALIQPAASDVTGSNGAADHLWMHFSRMGTFADKPVPVIERGEG
FT                   AYLWDTKGRKYLDALSALFVVQAGYGVEEIAAAADAQARKLCYFPVWSYATPPAIELAD
FT                   RLAELAPGDLNKVFFSSGGGESVETAWKVAKQFFKLTGKPTKTKVISRAIAYHGTTQGA
FT                   LSITGVPGFQIPFAPLVPGAIKVPNTDFYRAPEHLAGDEKEFGRWAADQFEEAILREGP
FT                   DSVAAVFVEPVQNAGGSFPPPAGYFERVREICDTYDVLLVSDEVICAYGRLGTMFGAQK
FT                   FGYQPDIITSAKGLTSGYAALGAAIISDRIFEPFGRGTTTFPHGYTFGGHPVACAAALA
FT                   NLDVFAERDLLGNVLRHEGALEATLKQLLDLPIVGDVRGNGYFWSVELVRDQATKEPFT
FT                   RDDCERILRGVVAPGMWEAGVYCRADDRGQAVVQFAPPLMCGQAEFDQIESAMRSVLTD
FT                   AWTKL"
FT   gene            629178..630308
FT                   /locus_tag="Namu_0568"
FT   CDS_pept        629178..630308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0568"
FT                   /product="alanine dehydrogenase"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein; KEGG: lpp:lpp0986
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76983"
FT                   /db_xref="GOA:C8X7B4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B4"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ACV76983.1"
FT                   /translation="MSALVVGVPKEIKNNENRVSVQPDGVAELVHHGHQVLVESGAGVG
FT                   SRFSDAEYSAAGAKVVGTADEVFAAADLIVKVKEPVPAEYHRFREGQQLFTYLHLAADR
FT                   ELTEFLLAKKIDSIAYETVQTPDRKLPLLTPMSEVAGRMSVQAAARALESPAGGAGILL
FT                   GGVPGTPAAKVTIIGGGVSGTEAAKIALGMRAIVRVFDTNPTRLAYLSDIFGGRLDLVT
FT                   PNRARMAAYIADSDVVIGAVLVPGAKAPKLVSREMIASMRPGSVAVDIAIDQGGCFETS
FT                   RATTHADPTYIEEGVVHYCVANIPGAVARTSTLALTSATLPYLVKVADRGIAGAAQTDP
FT                   ALLLGLSTLGGHLVNEPVAQAHALAYRNPADLLVGV"
FT   gene            complement(630340..631029)
FT                   /locus_tag="Namu_0569"
FT   CDS_pept        complement(630340..631029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0569"
FT                   /product="hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: xau:Xaut_4165
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76984"
FT                   /db_xref="GOA:C8X7B5"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B5"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACV76984.1"
FT                   /translation="MTELPPDPTLSGSKPRLGNYDLIVVLFCGLLLISNIGATKLIQFG
FT                   PIITDGGAILFPLTYILGDVLSEVYGFRRAKRAILMGFGLSVLAAVTFYLVQIAPAADA
FT                   YTNQEAFEAVLGFVPRIVLASILGYLAGQLLNAYVLVKIKERTKEGKLWLRLIGSTVVG
FT                   ELADTLVFCTIAFFGVITGWEFFSYVLTGYLYKVLIEVVFLPITYPVIAMVKRHEPDYV
FT                   PGAAVRV"
FT   gene            complement(631086..632045)
FT                   /locus_tag="Namu_0570"
FT   CDS_pept        complement(631086..632045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0570"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   ade:Adeh_0295 glutamate--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76985"
FT                   /db_xref="GOA:C8X7B6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B6"
FT                   /inference="protein motif:PRIAM:6.1.1.17"
FT                   /protein_id="ACV76985.1"
FT                   /translation="MSAPTTPQVTEPAGAGRFAPSPSGDLHVGNLRTALLAWLFARSTG
FT                   RGFLVRMEDLDRVRPGAAARQLADLAALGLDWDGPVVQQSARTDRYAQAIDSLTDRGLT
FT                   YPCFCTRREIQQAASAPHPDPTRPGADGAYPGTCRALTAAQVEQRRAAGRPGALRLRAQ
FT                   VDRWTVPDLLVGPFTGAVDDLVLRRNDGVAAYNLAVVVDDAAQGIDQVVRGDDLLTSAP
FT                   RQAYLAALLDRPPVQYAHVPLALNQEGQRLAKRDGAVTLAELAAAGVPAGRVLGLIAGS
FT                   LGLAAPGEQVSPAQLLTRFDPAALPRAPWVVRPADLLA"
FT   gene            632086..632859
FT                   /locus_tag="Namu_0571"
FT   CDS_pept        632086..632859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0571"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76986"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B7"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACV76986.1"
FT                   /translation="MPAESVDPAVTGYLSELARRCTDLLGPELLGVYTGGSLALDGYQA
FT                   GRSDIDVAVLVRAALSRSTTQALVTALRQENLPCPARGLELVVYRAEIAAAGDLAPGFE
FT                   IELNTGPRMPFRAGEPADRPAADGSFWYGIDRSILAAAGVPILGPPAGEVFVSPDPTDL
FT                   ATLLIQSLDWHLASAVPLADDAVLNACRARYRTVTGRWLAKPAAGRAVLGSADPVDAAV
FT                   IVQALAARAGGPAPDPDRVRRFLSDVRDDLAAPAP"
FT   gene            complement(632863..633672)
FT                   /locus_tag="Namu_0572"
FT   CDS_pept        complement(632863..633672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76987"
FT                   /db_xref="GOA:C8X7B8"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76987.1"
FT                   /translation="MGQWWQENIIEPGKLPLLLCFAAFIVTFLSTRLITRLIRAGIGPF
FT                   RNNVSSSGVHVHHAVPGILLLILGTIMALRGPDSPWIEIAGVLSGIGISLILDEFALIL
FT                   HLQDVYWSNEGRISVEMIGLATAVFGFVLLGFSPLGVDELSVDDVELRLTLTTAAVLHF
FT                   VLLVVCVLKGKYRSALVGCFVSPVAWWAAFRLARPGSRWGQRYRGRKLERAKRREAKFQ
FT                   AKWDPRWRWLSDAIAGAPSRPDPPPEPDPDHDQAPAAVPPPASGPAS"
FT   gene            complement(633694..634437)
FT                   /locus_tag="Namu_0573"
FT   CDS_pept        complement(633694..634437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76988"
FT                   /db_xref="GOA:C8X7B9"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7B9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76988.1"
FT                   /translation="MSQWWYDNIVEPAKLPLLLCLLAFVVTFLATRVVTRMIRAGIGPF
FT                   RNNVSAGGLHIHHAVPGIILLILGALMALRLPESPWFEIAAVLVGVGTSLVLDEFALIL
FT                   HLDDVYWANEGRISVEMTGLAAACIGLALLGFSPLGVDDLTVGDIRIRITLLVGALIHG
FT                   ALLLVCVLKGKYRSALIGCFVPLVAWYSAVRLARPGTWWARHRYRGRTLERCRRREAAF
FT                   DEKWDPRWQWLSDVIAGAPTEPPRE"
FT   gene            complement(634434..635756)
FT                   /locus_tag="Namu_0574"
FT   CDS_pept        complement(634434..635756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0574"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   noc:Noc_1010 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76989"
FT                   /db_xref="GOA:C8X7C0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV76989.1"
FT                   /translation="MSAPAIEPGTAGRPVPTGRVVAWGVWDWGSAAYNAVILTFVFSVY
FT                   LTDAVGVDLPGGITANTWLGWSLGLAGLFIAVLAPVTGQRADAGGRRRLSLGVWTALTV
FT                   ITMAGLFFVQDDYHYLWLGLLLLSLGSIFFEFASVSYNAMLHQVSTPRTIGRVSAFGWS
FT                   MGYFGGIVLLLICYVGFIAPDVGWFGVTSQDGLNIRMVAIFAALWFALFGLPVLFAVPE
FT                   ITGAPAAKRVGFFASYGVLFRDLREMFRTSPHTVYFLGASALFRDGLAAVFTFGAVLAV
FT                   TVYGINSADVLIFGVVANVVSAIGALTAGRFDDRLGPKTVIVFSLSGMLISGTILLFVS
FT                   GPTMFWIFGLFLCLFVGPAQSSSRTFLARLAPVGKEGQLFGLYATTGRAVSFLAPTLFG
FT                   FFTFVFDADRAGIVGILLVLGLGLLALLPVRPPATAAAPPA"
FT   gene            complement(635809..637149)
FT                   /locus_tag="Namu_0575"
FT   CDS_pept        complement(635809..637149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0575"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   sme:SMc03160 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76990"
FT                   /db_xref="GOA:C8X7C1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C1"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACV76990.1"
FT                   /translation="MTRLFGVASAAMQIEGAAGTAGRTASIWDVFATLPGRIEDGSSPA
FT                   RAADHHARWSTDLDLLAALGVDAYRLTLSWSRVQPGGTGPVNPAGLDFYDALVDGLLAR
FT                   GIEPWVSLYRWDLPLELMLEGGWLRRDTAERFGDYAAAVAARLGDRVGAWASLEDPFPH
FT                   LALGHAVGVDAPGLTLLGGALPVTHHLLLGHARATAALRAAGAGRVGLINHHTTVRPAG
FT                   PSGRDRWAAAFYDEYHNRQFADPVLLGRYPDRLLALPGVPDGVIADGDLAAIAAPLDFY
FT                   GVSYEHPVVVAAVPENRSVPLTLVPLEGVPRTAGDLPIDPPALEQVLVDLARRYPHLPP
FT                   VVVTTGGAFDDRPDGDDRPRIAFLDEHLAAVDRAAGRGVPVAGYFHWSLLDGWAGTPGH
FT                   VRTGLVRVDPDTLERTPRAAFAHYRDLIAHRSGDTSVTAPADRPARS"
FT   gene            complement(637146..637778)
FT                   /locus_tag="Namu_0576"
FT   CDS_pept        complement(637146..637778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0576"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mlr3851
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76991"
FT                   /db_xref="GOA:C8X7C2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACV76991.1"
FT                   /translation="MPGAVERTRPARTGRRPGNPDTRTAILDAARATFAASGFDGASIR
FT                   RIAAAAGVDPALVHHYFGTKDELFLATIDLPIDLPTLLAGIGAAGPDGVGVRLAGLIVS
FT                   VWESPMAPGLAGWLRTALADEQRAALIRQFVVARMVGPFTAALGIPEPERTRRAGLVMS
FT                   QILGVIVSRYLLFLDPVVQLTGEQLIASVGQTLQRYLTEPLPPAGRP"
FT   gene            complement(637802..638545)
FT                   /locus_tag="Namu_0577"
FT   CDS_pept        complement(637802..638545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0577"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: smt:Smal_1356
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76992"
FT                   /db_xref="GOA:C8X7C3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACV76992.1"
FT                   /translation="MSVISPGILAATTTRILRQLRHDPRTVGLLIAVPIVLMGLVYAMY
FT                   DGSPAVSRILLIMLGIFPFVIMFLITSIAMLRERTSGTLERLMTTRTGKGDLLAGYGIA
FT                   FGAAAAGQAVIASACAYWLYGMSTAGSAALVVLIAVLTALLGVGLGLACSALARTEFQA
FT                   VQMLPVVVIPQILLCGLFVPRAEMAGWLSALSDVMPLSYAVEALQQVGDNAEPTSTFWV
FT                   DLAVVGGCVILGLILAAASLRRRTP"
FT   gene            complement(638542..639258)
FT                   /locus_tag="Namu_0578"
FT   CDS_pept        complement(638542..639258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0578"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bmi:BMEA_B0442 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76993"
FT                   /db_xref="GOA:C8X7C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV76993.1"
FT                   /translation="MADAITVTELVVRRGKATVLDGLTCRIAAGRITGLLGPSGAGKTT
FT                   LIRAVVGVQVVRAGTVTVLGRPAGTPALRDKIGYVSQSPSIYLDLTVAENTNYFAAVAG
FT                   VDRSAARAAIEQVGLAEAAGQLAGNLSGGQQSRASLACAIVGDPPVLVLDEPTVGLDPV
FT                   LREELWDFFAQRARDGVSVLVSSHVMDEANRCDTLLLMRAGELLADETPAAIKQRAGTD
FT                   DMDRAFLNLIRAGAAR"
FT   gene            639398..641491
FT                   /locus_tag="Namu_0579"
FT   CDS_pept        639398..641491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0579"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: net:Neut_1995 phosphate acetyltransferase;
FT                   TIGRFAM: phosphate acetyltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase; DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76994"
FT                   /db_xref="GOA:C8X7C5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C5"
FT                   /inference="protein motif:TFAM:TIGR00651"
FT                   /protein_id="ACV76994.1"
FT                   /translation="MTGPVSLSPMSRSLYIASPEALSGKSAVALGLVDLLSRRVGRVGV
FT                   FRPIVNADPQRDSVVELLIAQPGIRQDYDEAVGVTYAQWHADQDAALSRIVDRFGELSA
FT                   EYDAVVVVGSDYTDVTTGNEWASNARIAANLGSPVVLVVHGRDRTPAVIAATVELARSE
FT                   LVAWHAHPVAAIANRVDPDAVEDVRERLSRAGLVAGALPNIPLLGAPTVADLRDACGAT
FT                   LWRGDEDLLTRESLGFLVAAMTPPNVLRRLRPSMTVIAPGDRSDMLPALILAHQSATFP
FT                   DLASVVLTGGYEPPASIAKLIDGIRADVPILLTDGGTFETATGLGQVRGRLTADSSVKL
FT                   EKALQAFAEGVDADAIVDALDLADPTVVTPMMFQYRLIERARADRRHVVLPEGEEERIL
FT                   RAAAILLRLDVADLTLLGDETLIRAKADTLGLDIAKARIVSPTTPELVATFAAEYARLR
FT                   AHKGITLELATDIVSDVSYFGTMMVHLGMADGMVSGAVHTTAHTIRPSFEIIKTAPGTT
FT                   VVSSVFLMCLADRVLVYGDCAVNPDPTAEQLAEIAISSAQTAAQFGVDPRVAMLSYSTG
FT                   SSGSGADVEKVRTATDIVHTKRPDLLVEGPIQYDAAVDPGVAVTKLPDSQVAGRATVLI
FT                   FPDLNTGNNTYKAVQRSAGAVAIGPVLQGLNKPVNDLSRGALVADIVNTVAITAIQAQG
FT                   ETA"
FT   gene            641488..642687
FT                   /locus_tag="Namu_0580"
FT   CDS_pept        641488..642687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0580"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: gur:Gura_2656 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76995"
FT                   /db_xref="GOA:C8X7C6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C6"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACV76995.1"
FT                   /translation="MIQHPILVVNSGSSSMKYQLIDPDEGQAVTTGLIERIGVAGAEPG
FT                   RATHRQDGKDFDYTGEIADHAAAIEVMRSLFDRSGRPIQRTGLFAVGHRVVHGGSLFGE
FT                   PTLVDAQVLAEIKALSVLAPLHNPANATGIEEAMAAFPGVAQVAVFDTAFFRDLPAAAA
FT                   TYAIDRTVAAEHQVRRYGFHGTSHQYVSQQVAAVLGRELAQLRQIVLHLGNGASVSAVD
FT                   GGRAVETSMGLTPLEGLVMGTRSGDIDPGVVFHLARTAGLSIDEIDSLLNRRSGMLGLA
FT                   GVSDFRDIDRLIEQGDTDAALALDVYCHRVRKYIGAYLAVLGGADVITFTAGVGENAAG
FT                   VRAKVLAGLEPLGIRLDPARNAERGGARVISTDDSPVTVLVVPTNEELAIARATLALVR
FT                   "
FT   gene            642694..643617
FT                   /locus_tag="Namu_0581"
FT   CDS_pept        642694..643617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0581"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mrd:Mrad2831_4098
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76996"
FT                   /db_xref="GOA:C8X7C7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C7"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACV76996.1"
FT                   /translation="MLAVLQGLATIGIVVGVGYLLARTSLLPSGTPVVLSRLVFFVATP
FT                   ALLLETLAGASISAVLSAGLAVTALTTTVAWSLYLLVARLWWKRDTASVVVGSLASSYV
FT                   NAGNLGIPLAVYVFGDAALVAPVMLYQLVVLAPVAFVVLDMVESGRRPSWRRVLIQPVR
FT                   NPVIVASVIGISLAATGAHIPQLIDAPLKLIAGMAVPGALIAFGISLRGAPIPGRGGRA
FT                   ADLSLAAALKLVVMPVAAYALGRWVFGMSGVPLLASTMCAALPTAQNVFVYAVRYKAAV
FT                   PLARDAVATSTLLCIPVLVVIAGLLS"
FT   gene            complement(643610..644605)
FT                   /locus_tag="Namu_0582"
FT   CDS_pept        complement(643610..644605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0582"
FT                   /product="alpha/beta hydrolase fold family protein"
FT                   /note="KEGG: abb:ABBFA_001367 alpha/beta hydrolase fold
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76997"
FT                   /db_xref="GOA:C8X7C8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C8"
FT                   /inference="similar to AA sequence:KEGG:ABBFA_001367"
FT                   /protein_id="ACV76997.1"
FT                   /translation="MPNPSVEVFTDPRPDFFGAPYEALTLQLPDDREGPVVATLVRRRT
FT                   DRPATGAALYLHGFSDYFHQKELAEFHLARGEDFYAVDLRKNGRSLLPHQTPTRMGDVA
FT                   DYYPELDAAVATIRADGHERIVFNAHSTGGLIGVLWLHDAPHRDADLSAVRAVVLNSPF
FT                   LDVPANWAVRALAPRPFAVLARNRPELVLQQPTRSQYQISIHATERGEWTFNPDWKPVT
FT                   GGVVRAEWLAAAQRAIARAHAGLTLTMPILVMCSNRTVRAREWSDELLRGDAVLNADAL
FT                   ARWSTQLGRHVTCLRIVDGMHDLLLSTPPVRAEVYAQLARWLDAYGAGVS"
FT   gene            644650..645102
FT                   /locus_tag="Namu_0583"
FT   CDS_pept        644650..645102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0583"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: afw:Anae109_2791
FT                   UspA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76998"
FT                   /db_xref="GOA:C8X7C9"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7C9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACV76998.1"
FT                   /translation="MTEADEFERGTDGPKVIVAAVDGSTTSLRAAAYAAGLARRQGAEL
FT                   VVVYVVAGSAMVGLVPAAGLALSDAEHQVADELRVQIGEAARRAGLRARFIETTGDPYT
FT                   EITRVCEKVLADAVVVGASTSAGHRIIGSVGVRLVRAGKWPVTVVP"
FT   gene            complement(645136..646125)
FT                   /locus_tag="Namu_0584"
FT   CDS_pept        complement(645136..646125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0584"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; PFAM: DNA primase small subunit; KEGG:
FT                   afw:Anae109_2830 DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76999"
FT                   /db_xref="GOA:C8X7D0"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7D0"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ACV76999.1"
FT                   /translation="MARSRDTSEPVELTVGERTVRVTHPERVYFPATGATKLDLVEYYL
FT                   SVGDGIVNALRERPCMMHRFPEGLAGDKVHQKRLPRGAPPWVQTVTLFFPRFKRTADEL
FT                   CVTELASVIWAVQMSTVEFHPWNSRRADTEKPDEWRIDLDPMPDCDFARVRRVAHVAHE
FT                   VLDELGAVGWPKTSGGKGLHIYVRIPPQWGFADVRRAALAFAREVERRAPQDVTTAWWR
FT                   KDRDPAMLFVDYNQNARDHTIASAYSVRGTPRGTVSTPIRWTEIDDVLPDDFTIATVPA
FT                   RYAELGDLHAGIDQAVFPIDQLLQWADRDERDGRPDPGGADAVDLDAP"
FT   gene            complement(646154..646810)
FT                   /locus_tag="Namu_0585"
FT   CDS_pept        complement(646154..646810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0585"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; short-
FT                   chain dehydrogenase/reductase SDR; KEGG: xcv:XCV0076
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77000"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7D1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACV77000.1"
FT                   /translation="MRVVIAGGHGKIGLRLARLLGEREEHAISLIRSLAQEADVVALGA
FT                   HPLVFDLESGSAQDLARILDGADAVVFAAGAGPGSGVARKDTVDRGAAVLLAQACELAG
FT                   VRRYVMVSSMGADAPPPPGTDEVFAAYLVAKKAADDDLRTRDLDWTILRPGALTMESGT
FT                   GLVHLAEHTGRGQVPREDVAAVLLALLDEPRTAGLTLELVAGDTPIDEAVAGLLS"
FT   gene            646893..647366
FT                   /locus_tag="Namu_0586"
FT   CDS_pept        646893..647366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77001"
FT                   /db_xref="GOA:C8X7D2"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:C8X7D2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV77001.1"
FT                   /translation="MPDWLSLVLAMVPIVLAAAFGTRQVIYSKRAREWPAVPSGWVRAQ
FT                   GVVVDEQALGRRRPAKDGTAQRIRRPVITFRAADGREITFTSRIRAAGTPGVGSLVEVY
FT                   HDPFDPTMASIAPQSLPNVVPALGLAEKWVVVNIWIMVVVIGVIIGLVVLHRS"
FT   sig_peptide     646893..646946
FT                   /locus_tag="Namu_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.619 at
FT                   residue 18"
FT   gene            647578..647781
FT                   /locus_tag="Namu_0587"
FT   CDS_pept        647578..647781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0587"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: xfn:XfasM23_1465 cold-shock
FT                   DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77002"
FT                   /db_xref="GOA:C8X826"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C8X826"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACV77002.1"
FT                   /translation="MAQGTVKWFNAEKGFGFITPNEGGPDVFVHYSEIQAGGYRSLEEN
FT                   QQVTYTVTQGTKGPQATQVTPL"
FT   gene            complement(647890..648720)
FT                   /locus_tag="Namu_0588"
FT   CDS_pept        complement(647890..648720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0588"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: bbr:BB3436 phenylacetic acid degradation
FT                   operon negative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77003"
FT                   /db_xref="GOA:C8X827"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8X827"
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /protein_id="ACV77003.1"
FT                   /translation="MAAPTGSAVLPPDRPGSPSSVIVSFAGSFLREIGGAIAVSDLIRC
FT                   LAAAGVAEPAVRQALSRLKARGFLDPDRVDGRAGYRLTAAGLADLNSGDRRIFHRPSTS
FT                   EADGWVLAVFSVPESERAQRHRLRSELSWLGFGTVAAGVWAAPRHLAEPTRQVLAAADL
FT                   DHYVTWFQAHHLSPIQVGQWWDLPALRDQYEQFLRQHSSDLAVPDEELTDEQAFAHYLR
FT                   VIDSWRVFPRIDPGLPATLLPPDWPAAQAWSTFASLHDRWAQRGLAHVWAVVAG"
FT   gene            complement(648723..649976)
FT                   /locus_tag="Namu_0589"
FT   CDS_pept        complement(648723..649976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0589"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: mlo:mll0621
FT                   kynureninase (kyurenine hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77004"
FT                   /db_xref="GOA:C8X828"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8X828"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACV77004.1"
FT                   /translation="MSSLTTGAITGSITRAQAQDLDRTDPLAGFRDRYLPATDDVVAYL
FT                   DGNSLGRPLAAIADSWQRFTHEQWAGRLIRGWSEGWMDLPELVGDELAAAALGAAPGQT
FT                   IIADSTTVNFYKAMRAALNLRPGRTKIILDRDNFPTNRYVAESLARDLGLELVWLEPPI
FT                   DGGVTPEAVAAVIDERTAVVTLSHIAYQSAFLADAPAITEVAHRAGALVVWDLCHSVGS
FT                   TEIELDAWDVDFAVGCTYKFVGAGPGAPALLYANARHHAGLDQPIWGWLGRQDSFEMEQ
FT                   GYRPAAGIRSMMSGTPPLLGLLAVREGAAVIAEAGIAAIRAKAVALTEMVTAIAEDTLV
FT                   PQGFTVMSPCDPARRGGHVSIARPDARELSQRLTEAGVLIDFRAPQAIRIGLSPLPASF
FT                   TEVWDAMEVIRTLSAPAH"
FT   sig_peptide     complement(649920..649976)
FT                   /locus_tag="Namu_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.981 at
FT                   residue 19"
FT   gene            complement(649973..650830)
FT                   /locus_tag="Namu_0590"
FT   CDS_pept        complement(649973..650830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0590"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /note="TIGRFAM: tryptophan 2,3-dioxygenase; PFAM:
FT                   tryptophan 23-dioxygenase; KEGG: spe:Spro_3022 tryptophan
FT                   23-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77005"
FT                   /db_xref="GOA:C8X829"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:C8X829"
FT                   /inference="protein motif:TFAM:TIGR03036"
FT                   /protein_id="ACV77005.1"
FT                   /translation="MTGNIRPLEDGIERDLQGLNYGSYLHLDELLHAQQPVSDHHDEML
FT                   FIVVHHVTELWMKLIIHEIRSAISLLAQDELGPALKRLARVKHIQRQMIEQWAVLATLT
FT                   PSEYAQFRDVLGKSSGFQSAQYRTLEFLLGNKNRAMIAVFAHEPQTAAQLDRDLHAPSL
FT                   YDEFLLYLARRGYPIPAELLERDFAEPHTRNEELVGILTAVYADPEHQWDVYETCEELV
FT                   DIEDTFQTWRFRHLKTVERIIGYKRGTGGSSGVAFLSRALSLTFFPELYAVRTEIGAPA
FT                   KEHA"
FT   gene            651208..651651
FT                   /locus_tag="Namu_0591"
FT   CDS_pept        651208..651651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0591"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: hch:HCH_04806
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77006"
FT                   /db_xref="GOA:C8X830"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C8X830"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACV77006.1"
FT                   /translation="MATMTRSSDTSTSARSAVATATGLVVLRVVLGAVMIVHGWQKFFV
FT                   DGISGVSGFFGQMGVPLAGFSAAAVATVELVGGVLLILGLGTRVVGALYALCMVGAIVF
FT                   VHGANGFLAAAGGYEFVLVLAAVSAALALLGGGRYALDALIKR"
FT   gene            complement(651654..652136)
FT                   /locus_tag="Namu_0592"
FT   CDS_pept        complement(651654..652136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0592"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   gsu:GSU0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77007"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:C8X831"
FT                   /inference="protein motif:PFAM:PF06172"
FT                   /protein_id="ACV77007.1"
FT                   /translation="MSTDPAELDAGRALAQSLQLEPLALEGGRFRRTFTGGGISAILYM
FT                   LIGSDFSAMHRLGSDEVYFHHQGAPLRLLLIEPTGAAHEVVLGPDVAAGQLPQLHVPGG
FT                   WWQGSSSAGAWTLVSTVVAPEFSWDDIVLGDRQELTALAPGAAERIGQLTRDEPPR"
FT   gene            complement(652133..653491)
FT                   /locus_tag="Namu_0593"
FT   CDS_pept        complement(652133..653491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0593"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: hypothetical protein; K06001 tryptophan
FT                   synthase beta chain; TIGRFAM: pyridoxal-phosphate dependent
FT                   TrpB-like enzyme; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77008"
FT                   /db_xref="GOA:C8X832"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C8X832"
FT                   /inference="protein motif:TFAM:TIGR01415"
FT                   /protein_id="ACV77008.1"
FT                   /translation="MPIRQHKYLLDESEMPTSWYNIVPDLPAPPPPPLHPGTHEPVGPD
FT                   DLAPLFPMDLILQEVSTERYIPIPDEVQDVYRLWRPSPLFRAHRLEQALGTPARIYYKY
FT                   EGVSPAGSHKPNTAVPQVYYNAKAGVKKLTTETGAGQWGTALAFACSLFDVECEVWQVG
FT                   ASYDAKPYRRTVIETFGGTVHRSPSQLTSAGRAFAADHPGSLGIAISEAVEKAAGAADT
FT                   KYALGSVLNHVLLHQTVIGEEALLQLAKAGETGADLVIGCTGGGSNFGGLAFPFLREKL
FT                   AGRQNPVIRAVEPASCPSLTRGEYRYDFGDTAGFTPLMKMHTLGHDFVPDPIHAGGLRY
FT                   HGMAPLISHIYELGLMEALSIEQTECFAAAVRFARTEGIVPAPEPTHALAATMREALAC
FT                   KESGEEKVIVTALCGHGLLDLGAYDAYLNDRMVDSGLSDADLDAALSTIPVLT"
FT   gene            complement(653558..655588)
FT                   /locus_tag="Namu_0594"
FT   CDS_pept        complement(653558..655588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0594"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rpt:Rpal_3142
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77009"
FT                   /db_xref="GOA:C8X833"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C8X833"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACV77009.1"
FT                   /translation="MFDTGWDAGLDDAQLSAVVHGDGPLVILAGAGTGKTRTLTARVAS
FT                   LLDRGVPAERVLLLTFTRRAADEMVSRAARLCTQPDAGQRLAGGTFHAVAHAVIGRHTE
FT                   ALGLPPAVSVLDRADATDVMDLLRHDHGLDGTDRRFPRAATLVDIYSRAVNTGVPARAL
FT                   IKTDFGWVQPHVDAVMELFRAYVARKRDRGLLDFDDLLLAWRSLLADPVVGPQIAGRWD
FT                   HVLVDEYQDVNATQVDIVHALRPGGHGLTVVGDDAQAIYGFRGSDHAHLRSLVQELPEV
FT                   TVVRLERNFRSHQRLLDLANVVRPGAEGEHRITLHSDRREGRPARLVRCHDAPAEARII
FT                   VDSVLEAHQKGRRLREQAVLMRAAAHSDLLEVELTARGVPFVKYGGLKFLEAAHVKDFV
FT                   AAVRLLDNPRDEVAWYRLLRLHDGIGPARARSLLGSLADPELSADLDRHAEAVAAAPAM
FT                   SRVALAASLSTLADARSRNRIGERARGCLELLRPLLTARYRDWSARLGDLERLVGAADQ
FT                   SPDLAAFVAELTLDPPASTSDLAGPPSQDDDYLVLSTVHSAKGLEWPVVHVLHLVDGSF
FT                   PSDMALGTPEGVEEEARLFYVALTRAADELNLYAPLRMPHHRHARDDRHSMAPLSRFLD
FT                   DAALDRVEVVDLTPPRPGADPAGAAARGTRVALPDLADLWA"
FT   gene            complement(655642..656544)
FT                   /locus_tag="Namu_0595"
FT   CDS_pept        complement(655642..656544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0595"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase-like protein"
FT                   /note="KEGG: afr:AFE_1848 base excision repair protein,
FT                   HhH-GPD family"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77010"
FT                   /db_xref="GOA:C8X834"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C8X834"
FT                   /inference="protein motif:COG:COG0122"
FT                   /protein_id="ACV77010.1"
FT                   /translation="MTSFSITPTTPFRLQESAEFGFGGRAADSFDGVMRMAFCLDGYAD
FT                   QVGVAVRQDADGTVHGRVDGVGPDRVDAVRAQVARVLSLDQDGGEFLDVGHRDPVIGRL
FT                   QEVAPGLLPPLFYSPYEAALWSVLSARRPAQQMAQVRTQLSERHGRTFELAGRRLAAMP
FT                   TPEQLLRVTEFPGLTPEKIHRMHGIARQALTGTLDVARLRHIGPTACQDDMQRLKGIGP
FT                   FYASLITIRAVGFTDVLPVDEPMLLELVGLHYRVDGPVTRAAFEQIAEPWRPYRTWTSV
FT                   LIRAASSRIGVVGSRRRAG"
FT   gene            complement(656597..657565)
FT                   /locus_tag="Namu_0596"
FT   CDS_pept        complement(656597..657565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bba:Bd3745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77011"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:C8X835"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV77011.1"
FT                   /translation="MRIDRRRGIAVVAAAALVGLAGCAAPTAGTAVMDPAATRPSASSD
FT                   PTSPTPDPTPAAYVPATQPTTDPTTPPPTTPPPTTVAAEPAPAPVAAPTTEAAPEPAPA
FT                   AEPAPEPAPWSEASDDDIRGAAAAAVAVTQRFWAESFAGRVGADGSPEAWSAPELWNGD
FT                   GFYDSDTGSVADCGDGKNYTANAFFCGNSTDGTGFLAWDLQFFHQHQDLGRTMVFMVIA
FT                   HETGHAVQARLVHDGVDGALFDGSKRYELQADCFGGAALGKAVRDGYLTLPATAQDEMV
FT                   AMTTAFGGDPAGHGDPDERDASFQRGFASGDMNTCLIDPAS"
FT   sig_peptide     complement(657479..657565)
FT                   /locus_tag="Namu_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.502 at
FT                   residue 29"
FT   gene            657842..658858
FT                   /locus_tag="Namu_0597"
FT   CDS_pept        657842..658858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0597"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   xfm:Xfasm12_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77012"
FT                   /db_xref="GOA:C8X836"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X836"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACV77012.1"
FT                   /translation="MSGLVDLAVAATVLAAPMAGGPSTPDLVTATAAAGSLGFLAGGYR
FT                   TAAQLAAQIAEVRAITPTFGVNLFAPNPIPVDPQAYAQYAARLAERADHFGVVLPPRPI
FT                   EDDDGWPDKLDLLIEDPVPLVSFTFGLPPARAIRALQRAGSAVAQTVTGPAEARWALDA
FT                   GADLLIVQSADAGGHSAVFDPSVRPPSPALPDLIRQIAATTPRPLIAAGGLSSADRVAA
FT                   ALRAGAAAVMVGTALLLADEAGTSAVHRAAIAGRPGPTVITRAFTGRPARGLVNEFIVQ
FT                   FEPRAPLGYPALHHLTSPLRKAAAAAGDPEWVHLWAGTGHGAVTPGPVADILRRLAV"
FT   gene            658949..659233
FT                   /locus_tag="Namu_0598"
FT   CDS_pept        658949..659233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0598"
FT                   /product="FHA domain-containing protein"
FT                   /note="KEGG: ade:Adeh_3741 FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77013"
FT                   /db_xref="UniProtKB/TrEMBL:C8X837"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3741"
FT                   /protein_id="ACV77013.1"
FT                   /translation="MTDQDRTPDASADVRERAGATEDYGGVPISDAELAQVWMSPDAAE
FT                   AAGAADPDNAESAGAPESEPPADESAAAAQGAVTRPEVPADDPAPAEPA"
FT   gene            complement(659247..661661)
FT                   /locus_tag="Namu_0599"
FT   CDS_pept        complement(659247..661661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0599"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: afw:Anae109_2098 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: AAA ATPase
FT                   central domain protein; peptidase S16 lon domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77014"
FT                   /db_xref="GOA:C8X838"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C8X838"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACV77014.1"
FT                   /translation="MTDIRRLPVLSLTDVVVLPGMVVPIELDEAAQAALDAAQAAAQDG
FT                   TGDEAGDRTGTKGELLLAPRLSDRYATYGVVASIEQVGRLAGGAPAAVLRAGQRARIGT
FT                   GVAGPGAALWVQAELVSDESTAEQAARAKELAAEYKSLVIANLQKRDAWQVIDTVEKMT
FT                   EPSVLADAAGWAPYLTAEQKRQVLETPDVIERLELLIEWTRAHLNEMDVAEKIRDDVRE
FT                   GMEKSQREFLLRQQLAAIRKELGDVTAEGTDDTADYRSRVEQADLPDKVREAALREVGR
FT                   LERASDQSPESGWIRTWLDTVLELPWQSKTEDKTDVTAAREVLDADHHGLDDVKDRITE
FT                   YLAVRGRRAERGLQVVGGRGSGAVLVLVGPPGVGKTSLGESVARALGRKFVRVALGGVR
FT                   DEAEIRGHRRTYVGALPGRIVRAITEAGSMNPVMLLDEIDKVGADYRGDPAAALLEVLD
FT                   PAQNHTFRDHYLDVDLDLSDVLFLATANVLETIPSALLDRMELITMDGYTEEDKVAIAR
FT                   THLLPRQLERAALSADEVELTNAALRKLAADYTREAGVRQLERLLAKVFRKVATKLSGG
FT                   ATAPIVVDEPDLRALIGRPRFTSETAERTSVPGVATGLAVTGMGGDVLFIEASAEPVAA
FT                   GAEPGKGSLTLTGQLGDVMKESAQIALSFVRSHSAEVGVEPGALNRTIHLHVPAGAVPK
FT                   DGPSAGVTMVTALTSLATGRAVRSDVAMTGEVTLNGKVLPIGGVKQKLLAAQRAGVSTV
FT                   FIPLRNEPDLDDVPAEVLDALTVIPVGDVRQILDQALEPAVQPAPVQTAAA"
FT   gene            complement(661777..662775)
FT                   /locus_tag="Namu_0600"
FT   CDS_pept        complement(661777..662775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0600"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: atc:AGR_pAT_567 ribose
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77015"
FT                   /db_xref="GOA:C8X839"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C8X839"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACV77015.1"
FT                   /translation="MATLRDVALAAGVSTSTASRVLDERLPPSRTAAADRVRQAAADLG
FT                   YVRDPLAAGLRRSGTSTIGVVVPRLTDTVMAMLYEEIAAGALARGLFAVVATTHDRPEA
FT                   ERLAVESLLRRRVDGIIRTTARTDAPLRIDESQFGARQVLALRADGIHSTSIGDDTLGG
FT                   YLATRKLIDHGHRRIGLVMGPGYATTATNRRDGYRNALVEAGIPLDDALIVGDSFSMEA
FT                   GESAAHALLDLADPPTAIFAVNDNNAIGVMAAAAARGLRIPDDLSVIGYNDIPVVSKLP
FT                   VPLTTIREPFNLIARGAIDLLLEDTPGDEPRTLVATPTLIPRKSTAAPRAR"
FT   gene            662931..663857
FT                   /locus_tag="Namu_0601"
FT   CDS_pept        662931..663857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0601"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mmw:Mmwyl1_2683 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77016"
FT                   /db_xref="GOA:C8X840"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8X840"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACV77016.1"
FT                   /translation="MSLGNLDLRGLNPAPVTPFTVDGDVDYAALAGLGKFLASVEGVKS
FT                   LVVLGHAGEGTFLTQDEQVKVIETLVAEVGDQVAIVAGITGEGTKVAVEEAQRAVAAGA
FT                   KAALTYPSHGWLRFGYQDGAPQDRYRAIWEEAGLPQILFQYPDNTKASYNLDTQLEIAG
FT                   QEGVFWTKNGVRNMRRWDTEIPVLRREYPDLQIFSCHDEYLLHTIMDVDGLLVGYGNIA
FT                   PELLVEFIKAGKAQDWTAAKKIHNQLLPVTKSVYHRGSHMEGTVALKHALVARGILPHA
FT                   TVRSPLLPLADGADVEIADALKAAGII"
FT   gene            664139..665518
FT                   /locus_tag="Namu_0602"
FT   CDS_pept        664139..665518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0602"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: abb:ABBFA_002694 inner
FT                   membrane metabolite transport protein YgcS"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77017"
FT                   /db_xref="GOA:C8X841"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X841"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACV77017.1"
FT                   /translation="MTTSYAGEPTAVANAQLVSRLERIPVTRRLLLIRVIIGSATFFDA
FT                   YTVLVIAFAMPQLVTEWGLSPTQVGLILSAGYVGQIFGALGFGQLAEKIGRLPTLLITI
FT                   ILFVSMDVACLFATGGTMMMIFRFLQGVGTGGEVPVASAYINEFIGAKKRGKFFLLYEL
FT                   IFPIGLMSAGIIGYFLVPAFGWKALFIVGLVPAILMIPLRVLMPESPRWLASRGKIDKA
FT                   DKVVTMLENEAIKQGKPLPEPVVRPVDPKTTAKSDWRELFKGIYLKRTLMIWVLWIAAY
FT                   TINNGMVTWLPTLYKTTFGMNTQDAIFYGWITSAVGVLASVVCALTIDRVGRKRWYTWA
FT                   FLLAVVPLVTLYFLGATTALQVTVFATATYAILQTISFSLYLYSAELYPTRLRAIGTGF
FT                   GSAWLRAGSSIGPVLVGFIVAGVGIQFVFLAFAAIAVIGGLTVSRFGVETKGRVLEELS
FT                   P"
FT   gene            665682..667178
FT                   /locus_tag="Namu_0603"
FT   CDS_pept        665682..667178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0603"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   afw:Anae109_0031 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77018"
FT                   /db_xref="GOA:C8X842"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8X842"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACV77018.1"
FT                   /translation="MAAAPGAAAAPLVYRSARGKWVLAATVLGSGLAQLDGTVVNVALP
FT                   RIGEDLGGGLTALQWTLNAYTLTLSGLLLLGGSLGDRMGRRRIFILGVIWFTVASVGCA
FT                   FAPSTGLLIAMRALQGAGAALLTPGSVAILQASFRPDDRSTAVGAWSGLGGVATAIGPI
FT                   VGGLLVGVAPWGWRLVFLINLPIAAAVIVLSRRYIPESRDEQATGRVDVPGALLASFGL
FT                   GGLVFGLTEGPAGGWTPPVVAITVAGVLLLGLFLLVESRTAEPLLPLGLFADRQFSAAN
FT                   LVTFAVYAALAGALFLLPVQLQLVAGFSPVQAGAATLPITVMMLLLSARMGRLSARIGP
FT                   RLPMTVGPLVAATAMFWLSFVDAGATFLGAVVGPMLLFGLGLSFTVAPLTSTVLAAAPD
FT                   HQAGVASAINNDVARVAGLLAVAVLPALAGLSPAAYADPALMSGGFHRAVLIAGAVCAA
FT                   GGLLALVTIRNPVAGPEHEHADPALECAACPVLAPHIKPR"
FT   gene            667252..667857
FT                   /locus_tag="Namu_0604"
FT   CDS_pept        667252..667857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0604"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   mno:Mnod_5182 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77019"
FT                   /db_xref="GOA:C8X843"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C8X843"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACV77019.1"
FT                   /translation="MAGLTRGFTGRRQRDPRLPPGQYDTGADWPVLTAEVTPRIEPERW
FT                   SISVDGLVQTPTTWTWAQAHALPPSRYEGDIHCVTTWSKLGTNFDGVSVDTLLEQAGPQ
FT                   PEAAFVLATSSTGYTTNLPLADVTGGKAWVVWAHEGRPLPRDHGGPVRLLVPHLYFWKS
FT                   AKWISKLTLLDHDQQGFWERNGYHDRGDPWLEQRYQGD"
FT   gene            667889..668617
FT                   /locus_tag="Namu_0605"
FT   CDS_pept        667889..668617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0605"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   KEGG: afw:Anae109_1054 oxidoreductase FAD/NAD(P)- binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77020"
FT                   /db_xref="GOA:C8X844"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C8X844"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ACV77020.1"
FT                   /translation="MMAPGGAVAAFAPAPTGRWTTATVVSVAHPSPHAVILRLDVRDRI
FT                   DHLPGQHYVVRLRAEDGYTAQRSYSVASPPSDPLVELWVERFPEGEVSPFLADVVAPGD
FT                   ELEVRGPIGGWFVWDAAMPAIGVAGGSGAVPLLAMLRHARALGRPDLLQLAVSARTLAD
FT                   LPFPDELADAGALIALTRQDYRDRPAGRLTAAELRPLASCHETTFVCGSASFAEFASRL
FT                   LVDLGCTSADVRVERFGPTG"
FT   gene            668867..669382
FT                   /locus_tag="Namu_0606"
FT   CDS_pept        668867..669382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77021"
FT                   /db_xref="UniProtKB/TrEMBL:C8X845"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV77021.1"
FT                   /translation="MATQRGTAGAGWLTDLSGPVWPGLLLNPDAFVARAPAHVFGFPSG
FT                   SLRVLTASGQVRRIGEILIVADGGPETGPETGSDSDLGQAPVTAMIRLSEPVADQDSTF
FT                   LNRAAVGRALAAGSTLWAAVTEQVPAPVPWPAVPVTRGADDGQRDPLAVKNVTTTNEDW
FT                   CTIFWWLC"
FT   gene            669355..670659
FT                   /locus_tag="Namu_0607"
FT   CDS_pept        669355..670659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0607"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77022"
FT                   /db_xref="GOA:C8X846"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8X846"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACV77022.1"
FT                   /translation="MHYLLVAVLTTGSTEAVADRLRRLRFHRVDLIILPVVFLADVLVF
FT                   SRMLRIEGATAAERVAIVIYSGAGIGLLLLRWRAPVAVYIAAVVLALPPLLISDYYIPF
FT                   LIPLVALAAVAQLRPPRVSLWCLAASVLPIALLVGKAVLQASPSGRLPSAAGSAVFYSA
FT                   GFVLAWGLGQWIGRNQRRLEQIRVQHELEVREQQKLAENAVSVERLRIARELHDIVAHS
FT                   VTIMVLHAAGARRVVRTDPDRAAESLTTIEESGQQAMTELRRLLALLRESDDGPDRVDA
FT                   MVPGLAHVDQILAQVRNSGVRVTLEISGQPARLDASVDLAAYRLIQEGITNVTKHCGTG
FT                   AQVAVTVEWGAEKVTVAVEDDGLGVRSAAPAGGGGHGLAGLRERIAIAAGEFSAGPTES
FT                   GGFRVAARLPVSTGSPIPPPAKASRPVEEHLGVDR"
FT   gene            670656..671342
FT                   /locus_tag="Namu_0608"
FT   CDS_pept        670656..671342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0608"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   scl:sce5431 two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77023"
FT                   /db_xref="GOA:C8X847"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C8X847"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV77023.1"
FT                   /translation="MIRVVVVDDERIVRSGIALLLSGEDDIEVVADLDGGVKAVEVVRL
FT                   RRPDVVIADVRMPGMDGVELTRRIVEDPHRTGNPPKVLVLTTFHVDEAVYAALRAGATG
FT                   FVLKDAAPTELVAAVRAVAAGEAWLDPAVARQLIDEFASHTPADLPGPSELQALTARER
FT                   EVLVLIAHGLSNAEISDHLVVGEGTTKTHVNRIFNKLGLRDRAQAVAMAYKSGLLRPED
FT                   PLPAKR"
FT   gene            complement(671350..672198)
FT                   /locus_tag="Namu_0609"
FT   CDS_pept        complement(671350..672198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0609"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77024"
FT                   /db_xref="GOA:C8X848"
FT                   /db_xref="UniProtKB/TrEMBL:C8X848"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV77024.1"
FT                   /translation="MLVGLTLAVLASLGSGAGSAVEAIGVRRARHRATGQAEVGALLRE
FT                   PVYFAGLAVDLLGFAFTVLALQVLPLYLVQAIVASSVAVTALILAAMGRPLDRIGWIAL
FT                   GGSLCGLVLLGLSSQPHEVPPLAPGWYWLLLGLALPIAGLAAVATRLKGIVSVVLLAFG
FT                   AGLCFSLVAVAARSLDVPAPLWRAVIDPALWAIVVNGVLGTALFAMALQRGRVTVVAAV
FT                   SYTTSTVVPSVIGLVFLGDQVRSGFALVATARFLVAVSGAVALARFTEPLPASTPQAAT
FT                   A"
FT   sig_peptide     complement(672136..672198)
FT                   /locus_tag="Namu_0609"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.815 at
FT                   residue 21"
FT   gene            672496..674202
FT                   /locus_tag="Namu_0610"
FT   CDS_pept        672496..674202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0610"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin family protein"
FT                   /note="KEGG: abb:ABBFA_002094 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV77025"
FT                   /db_xref="GOA:C8X849"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C8X849"
FT                   /inference="similar to AA sequence:KEGG:ABBFA_002094"
FT                   /protein_id="ACV77025.1"
FT                   /translation="MTDIERKLSPSAPEATTVPDAPP