(data stored in ACNUC8465 zone)

EMBL: CP001738

ID   CP001738; SV 1; circular; genomic DNA; STD; PRO; 5639016 BP.
XX
AC   CP001738; ABUZ01000000-ABUZ01000159;
XX
PR   Project:PRJNA20825;
XX
DT   18-NOV-2009 (Rel. 102, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Thermomonospora curvata DSM 43183, complete genome.
XX
KW   .
XX
OS   Thermomonospora curvata DSM 43183
OC   Bacteria; Actinobacteria; Streptosporangiales; Thermomonosporaceae;
OC   Thermomonospora.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5639016
RX   PUBMED; 21475583.
RA   Chertkov O., Sikorski J., Nolan M., Lapidus A., Lucas S., Del Rio T.G.,
RA   Tice H., Cheng J.F., Goodwin L., Pitluck S., Liolios K., Ivanova N.,
RA   Mavromatis K., Mikhailova N., Ovchinnikova G., Pati A., Chen A.,
RA   Palaniappan K., Djao O.D., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Brettin T., Han C., Detter J.C., Rohde M., Goker M., Woyke T., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Thermomonospora curvata type strain (B9)";
RL   Stand Genomic Sci 4(1):13-22(2011).
XX
RN   [2]
RP   1-5639016
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Thermomonospora curvata DSM 43183";
RL   Unpublished.
XX
RN   [3]
RP   1-5639016
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (08-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b3eff8458398879e724bf838abdfc0a3.
DR   BioSample; SAMN02598435.
DR   CABRI; DSM 43183.
DR   EnsemblGenomes-Gn; EBG00001038787.
DR   EnsemblGenomes-Gn; EBG00001038788.
DR   EnsemblGenomes-Gn; EBG00001038789.
DR   EnsemblGenomes-Gn; EBG00001038790.
DR   EnsemblGenomes-Gn; EBG00001038791.
DR   EnsemblGenomes-Gn; EBG00001038792.
DR   EnsemblGenomes-Gn; EBG00001038793.
DR   EnsemblGenomes-Gn; EBG00001038794.
DR   EnsemblGenomes-Gn; EBG00001038797.
DR   EnsemblGenomes-Gn; EBG00001038800.
DR   EnsemblGenomes-Gn; EBG00001038803.
DR   EnsemblGenomes-Gn; EBG00001038806.
DR   EnsemblGenomes-Gn; EBG00001038812.
DR   EnsemblGenomes-Gn; EBG00001038815.
DR   EnsemblGenomes-Gn; EBG00001038817.
DR   EnsemblGenomes-Gn; EBG00001038819.
DR   EnsemblGenomes-Gn; EBG00001038820.
DR   EnsemblGenomes-Gn; EBG00001038821.
DR   EnsemblGenomes-Gn; EBG00001038822.
DR   EnsemblGenomes-Gn; EBG00001038823.
DR   EnsemblGenomes-Gn; EBG00001038825.
DR   EnsemblGenomes-Gn; EBG00001038827.
DR   EnsemblGenomes-Gn; EBG00001038828.
DR   EnsemblGenomes-Gn; EBG00001038830.
DR   EnsemblGenomes-Gn; EBG00001038831.
DR   EnsemblGenomes-Gn; EBG00001038832.
DR   EnsemblGenomes-Gn; EBG00001038833.
DR   EnsemblGenomes-Gn; EBG00001038836.
DR   EnsemblGenomes-Gn; EBG00001038837.
DR   EnsemblGenomes-Gn; EBG00001038838.
DR   EnsemblGenomes-Gn; EBG00001038839.
DR   EnsemblGenomes-Gn; EBG00001038840.
DR   EnsemblGenomes-Gn; EBG00001038841.
DR   EnsemblGenomes-Gn; EBG00001038842.
DR   EnsemblGenomes-Gn; EBG00001038843.
DR   EnsemblGenomes-Gn; EBG00001038844.
DR   EnsemblGenomes-Gn; EBG00001038845.
DR   EnsemblGenomes-Gn; EBG00001038846.
DR   EnsemblGenomes-Gn; EBG00001038847.
DR   EnsemblGenomes-Gn; EBG00001038848.
DR   EnsemblGenomes-Gn; EBG00001038850.
DR   EnsemblGenomes-Gn; EBG00001038852.
DR   EnsemblGenomes-Gn; EBG00001038853.
DR   EnsemblGenomes-Gn; EBG00001038854.
DR   EnsemblGenomes-Gn; EBG00001038855.
DR   EnsemblGenomes-Gn; EBG00001038856.
DR   EnsemblGenomes-Gn; EBG00001038857.
DR   EnsemblGenomes-Gn; EBG00001038858.
DR   EnsemblGenomes-Gn; EBG00001038859.
DR   EnsemblGenomes-Gn; EBG00001038860.
DR   EnsemblGenomes-Gn; EBG00001038861.
DR   EnsemblGenomes-Gn; EBG00001038862.
DR   EnsemblGenomes-Gn; EBG00001038863.
DR   EnsemblGenomes-Gn; EBG00001038864.
DR   EnsemblGenomes-Gn; EBG00001038865.
DR   EnsemblGenomes-Gn; EBG00001038866.
DR   EnsemblGenomes-Gn; EBG00001038867.
DR   EnsemblGenomes-Gn; EBG00001038868.
DR   EnsemblGenomes-Gn; EBG00001038869.
DR   EnsemblGenomes-Gn; EBG00001038870.
DR   EnsemblGenomes-Gn; EBG00001038871.
DR   EnsemblGenomes-Gn; EBG00001038872.
DR   EnsemblGenomes-Gn; EBG00001038874.
DR   EnsemblGenomes-Gn; EBG00001038876.
DR   EnsemblGenomes-Gn; EBG00001038878.
DR   EnsemblGenomes-Gn; EBG00001038879.
DR   EnsemblGenomes-Gn; EBG00001038880.
DR   EnsemblGenomes-Gn; EBG00001038881.
DR   EnsemblGenomes-Gn; EBG00001038882.
DR   EnsemblGenomes-Gn; EBG00001038883.
DR   EnsemblGenomes-Gn; EBG00001038884.
DR   EnsemblGenomes-Gn; EBG00001038885.
DR   EnsemblGenomes-Gn; EBG00001038887.
DR   EnsemblGenomes-Gn; EBG00001038888.
DR   EnsemblGenomes-Gn; EBG00001038889.
DR   EnsemblGenomes-Gn; EBG00001038890.
DR   EnsemblGenomes-Gn; EBG00001038892.
DR   EnsemblGenomes-Gn; EBG00001038894.
DR   EnsemblGenomes-Gn; EBG00001038896.
DR   EnsemblGenomes-Gn; EBG00001038897.
DR   EnsemblGenomes-Gn; EBG00001038898.
DR   EnsemblGenomes-Gn; EBG00001038899.
DR   EnsemblGenomes-Gn; EBG00001038900.
DR   EnsemblGenomes-Gn; EBG00001038901.
DR   EnsemblGenomes-Gn; EBG00001038902.
DR   EnsemblGenomes-Gn; EBG00001038903.
DR   EnsemblGenomes-Gn; EBG00001038905.
DR   EnsemblGenomes-Gn; EBG00001038907.
DR   EnsemblGenomes-Gn; EBG00001038908.
DR   EnsemblGenomes-Gn; EBG00001038909.
DR   EnsemblGenomes-Gn; EBG00001038910.
DR   EnsemblGenomes-Gn; EBG00001038911.
DR   EnsemblGenomes-Gn; EBG00001038913.
DR   EnsemblGenomes-Gn; EBG00001038915.
DR   EnsemblGenomes-Gn; EBG00001038916.
DR   EnsemblGenomes-Gn; EBG00001038917.
DR   EnsemblGenomes-Gn; EBG00001038918.
DR   EnsemblGenomes-Gn; EBG00001038919.
DR   EnsemblGenomes-Gn; EBG00001038920.
DR   EnsemblGenomes-Gn; EBG00001038921.
DR   EnsemblGenomes-Gn; EBG00001038922.
DR   EnsemblGenomes-Gn; EBG00001038923.
DR   EnsemblGenomes-Gn; EBG00001038924.
DR   EnsemblGenomes-Gn; EBG00001038925.
DR   EnsemblGenomes-Gn; EBG00001038926.
DR   EnsemblGenomes-Gn; Tcur_R0001.
DR   EnsemblGenomes-Gn; Tcur_R0002.
DR   EnsemblGenomes-Gn; Tcur_R0003.
DR   EnsemblGenomes-Gn; Tcur_R0004.
DR   EnsemblGenomes-Gn; Tcur_R0005.
DR   EnsemblGenomes-Gn; Tcur_R0006.
DR   EnsemblGenomes-Gn; Tcur_R0007.
DR   EnsemblGenomes-Gn; Tcur_R0008.
DR   EnsemblGenomes-Gn; Tcur_R0009.
DR   EnsemblGenomes-Gn; Tcur_R0010.
DR   EnsemblGenomes-Gn; Tcur_R0011.
DR   EnsemblGenomes-Gn; Tcur_R0012.
DR   EnsemblGenomes-Gn; Tcur_R0013.
DR   EnsemblGenomes-Gn; Tcur_R0014.
DR   EnsemblGenomes-Gn; Tcur_R0015.
DR   EnsemblGenomes-Gn; Tcur_R0016.
DR   EnsemblGenomes-Gn; Tcur_R0017.
DR   EnsemblGenomes-Gn; Tcur_R0018.
DR   EnsemblGenomes-Gn; Tcur_R0019.
DR   EnsemblGenomes-Gn; Tcur_R0020.
DR   EnsemblGenomes-Gn; Tcur_R0021.
DR   EnsemblGenomes-Gn; Tcur_R0022.
DR   EnsemblGenomes-Gn; Tcur_R0023.
DR   EnsemblGenomes-Gn; Tcur_R0024.
DR   EnsemblGenomes-Gn; Tcur_R0025.
DR   EnsemblGenomes-Gn; Tcur_R0026.
DR   EnsemblGenomes-Gn; Tcur_R0027.
DR   EnsemblGenomes-Gn; Tcur_R0028.
DR   EnsemblGenomes-Gn; Tcur_R0029.
DR   EnsemblGenomes-Gn; Tcur_R0030.
DR   EnsemblGenomes-Gn; Tcur_R0031.
DR   EnsemblGenomes-Gn; Tcur_R0032.
DR   EnsemblGenomes-Gn; Tcur_R0033.
DR   EnsemblGenomes-Gn; Tcur_R0034.
DR   EnsemblGenomes-Gn; Tcur_R0035.
DR   EnsemblGenomes-Gn; Tcur_R0036.
DR   EnsemblGenomes-Gn; Tcur_R0037.
DR   EnsemblGenomes-Gn; Tcur_R0038.
DR   EnsemblGenomes-Gn; Tcur_R0039.
DR   EnsemblGenomes-Gn; Tcur_R0040.
DR   EnsemblGenomes-Gn; Tcur_R0041.
DR   EnsemblGenomes-Gn; Tcur_R0042.
DR   EnsemblGenomes-Gn; Tcur_R0043.
DR   EnsemblGenomes-Gn; Tcur_R0044.
DR   EnsemblGenomes-Gn; Tcur_R0045.
DR   EnsemblGenomes-Gn; Tcur_R0046.
DR   EnsemblGenomes-Gn; Tcur_R0047.
DR   EnsemblGenomes-Gn; Tcur_R0048.
DR   EnsemblGenomes-Gn; Tcur_R0049.
DR   EnsemblGenomes-Gn; Tcur_R0050.
DR   EnsemblGenomes-Gn; Tcur_R0051.
DR   EnsemblGenomes-Gn; Tcur_R0052.
DR   EnsemblGenomes-Gn; Tcur_R0053.
DR   EnsemblGenomes-Gn; Tcur_R0054.
DR   EnsemblGenomes-Gn; Tcur_R0055.
DR   EnsemblGenomes-Gn; Tcur_R0056.
DR   EnsemblGenomes-Gn; Tcur_R0057.
DR   EnsemblGenomes-Gn; Tcur_R0058.
DR   EnsemblGenomes-Gn; Tcur_R0059.
DR   EnsemblGenomes-Gn; Tcur_R0060.
DR   EnsemblGenomes-Gn; Tcur_R0061.
DR   EnsemblGenomes-Gn; Tcur_R0062.
DR   EnsemblGenomes-Gn; Tcur_R0063.
DR   EnsemblGenomes-Gn; Tcur_R0064.
DR   EnsemblGenomes-Gn; Tcur_R0065.
DR   EnsemblGenomes-Gn; Tcur_R0066.
DR   EnsemblGenomes-Gn; Tcur_R0067.
DR   EnsemblGenomes-Gn; Tcur_R0068.
DR   EnsemblGenomes-Gn; Tcur_R0069.
DR   EnsemblGenomes-Gn; Tcur_R0070.
DR   EnsemblGenomes-Gn; Tcur_R0071.
DR   EnsemblGenomes-Gn; Tcur_R0072.
DR   EnsemblGenomes-Gn; Tcur_R0073.
DR   EnsemblGenomes-Gn; Tcur_R0074.
DR   EnsemblGenomes-Gn; Tcur_R0075.
DR   EnsemblGenomes-Gn; Tcur_R0076.
DR   EnsemblGenomes-Tr; EBT00001641958.
DR   EnsemblGenomes-Tr; EBT00001641961.
DR   EnsemblGenomes-Tr; EBT00001641963.
DR   EnsemblGenomes-Tr; EBT00001641964.
DR   EnsemblGenomes-Tr; EBT00001641965.
DR   EnsemblGenomes-Tr; EBT00001641967.
DR   EnsemblGenomes-Tr; EBT00001641969.
DR   EnsemblGenomes-Tr; EBT00001641971.
DR   EnsemblGenomes-Tr; EBT00001641972.
DR   EnsemblGenomes-Tr; EBT00001641973.
DR   EnsemblGenomes-Tr; EBT00001641974.
DR   EnsemblGenomes-Tr; EBT00001641975.
DR   EnsemblGenomes-Tr; EBT00001641977.
DR   EnsemblGenomes-Tr; EBT00001641978.
DR   EnsemblGenomes-Tr; EBT00001641979.
DR   EnsemblGenomes-Tr; EBT00001641980.
DR   EnsemblGenomes-Tr; EBT00001641981.
DR   EnsemblGenomes-Tr; EBT00001641982.
DR   EnsemblGenomes-Tr; EBT00001641983.
DR   EnsemblGenomes-Tr; EBT00001641984.
DR   EnsemblGenomes-Tr; EBT00001641985.
DR   EnsemblGenomes-Tr; EBT00001641986.
DR   EnsemblGenomes-Tr; EBT00001641988.
DR   EnsemblGenomes-Tr; EBT00001641989.
DR   EnsemblGenomes-Tr; EBT00001641990.
DR   EnsemblGenomes-Tr; EBT00001641991.
DR   EnsemblGenomes-Tr; EBT00001641993.
DR   EnsemblGenomes-Tr; EBT00001641994.
DR   EnsemblGenomes-Tr; EBT00001641995.
DR   EnsemblGenomes-Tr; EBT00001641997.
DR   EnsemblGenomes-Tr; EBT00001641999.
DR   EnsemblGenomes-Tr; EBT00001642001.
DR   EnsemblGenomes-Tr; EBT00001642003.
DR   EnsemblGenomes-Tr; EBT00001642005.
DR   EnsemblGenomes-Tr; EBT00001642007.
DR   EnsemblGenomes-Tr; EBT00001642009.
DR   EnsemblGenomes-Tr; EBT00001642011.
DR   EnsemblGenomes-Tr; EBT00001642013.
DR   EnsemblGenomes-Tr; EBT00001642014.
DR   EnsemblGenomes-Tr; EBT00001642016.
DR   EnsemblGenomes-Tr; EBT00001642017.
DR   EnsemblGenomes-Tr; EBT00001642019.
DR   EnsemblGenomes-Tr; EBT00001642020.
DR   EnsemblGenomes-Tr; EBT00001642021.
DR   EnsemblGenomes-Tr; EBT00001642023.
DR   EnsemblGenomes-Tr; EBT00001642024.
DR   EnsemblGenomes-Tr; EBT00001642025.
DR   EnsemblGenomes-Tr; EBT00001642026.
DR   EnsemblGenomes-Tr; EBT00001642028.
DR   EnsemblGenomes-Tr; EBT00001642031.
DR   EnsemblGenomes-Tr; EBT00001642033.
DR   EnsemblGenomes-Tr; EBT00001642035.
DR   EnsemblGenomes-Tr; EBT00001642036.
DR   EnsemblGenomes-Tr; EBT00001642038.
DR   EnsemblGenomes-Tr; EBT00001642040.
DR   EnsemblGenomes-Tr; EBT00001642042.
DR   EnsemblGenomes-Tr; EBT00001642043.
DR   EnsemblGenomes-Tr; EBT00001642045.
DR   EnsemblGenomes-Tr; EBT00001642047.
DR   EnsemblGenomes-Tr; EBT00001642049.
DR   EnsemblGenomes-Tr; EBT00001642051.
DR   EnsemblGenomes-Tr; EBT00001642053.
DR   EnsemblGenomes-Tr; EBT00001642055.
DR   EnsemblGenomes-Tr; EBT00001642057.
DR   EnsemblGenomes-Tr; EBT00001642058.
DR   EnsemblGenomes-Tr; EBT00001642060.
DR   EnsemblGenomes-Tr; EBT00001642063.
DR   EnsemblGenomes-Tr; EBT00001642065.
DR   EnsemblGenomes-Tr; EBT00001642066.
DR   EnsemblGenomes-Tr; EBT00001642068.
DR   EnsemblGenomes-Tr; EBT00001642070.
DR   EnsemblGenomes-Tr; EBT00001642071.
DR   EnsemblGenomes-Tr; EBT00001642073.
DR   EnsemblGenomes-Tr; EBT00001642075.
DR   EnsemblGenomes-Tr; EBT00001642077.
DR   EnsemblGenomes-Tr; EBT00001642079.
DR   EnsemblGenomes-Tr; EBT00001642081.
DR   EnsemblGenomes-Tr; EBT00001642082.
DR   EnsemblGenomes-Tr; EBT00001642083.
DR   EnsemblGenomes-Tr; EBT00001642085.
DR   EnsemblGenomes-Tr; EBT00001642087.
DR   EnsemblGenomes-Tr; EBT00001642089.
DR   EnsemblGenomes-Tr; EBT00001642092.
DR   EnsemblGenomes-Tr; EBT00001642093.
DR   EnsemblGenomes-Tr; EBT00001642094.
DR   EnsemblGenomes-Tr; EBT00001642095.
DR   EnsemblGenomes-Tr; EBT00001642096.
DR   EnsemblGenomes-Tr; EBT00001642098.
DR   EnsemblGenomes-Tr; EBT00001642099.
DR   EnsemblGenomes-Tr; EBT00001642100.
DR   EnsemblGenomes-Tr; EBT00001642101.
DR   EnsemblGenomes-Tr; EBT00001642102.
DR   EnsemblGenomes-Tr; EBT00001642103.
DR   EnsemblGenomes-Tr; EBT00001642104.
DR   EnsemblGenomes-Tr; EBT00001642106.
DR   EnsemblGenomes-Tr; EBT00001642107.
DR   EnsemblGenomes-Tr; EBT00001642109.
DR   EnsemblGenomes-Tr; EBT00001642112.
DR   EnsemblGenomes-Tr; EBT00001642113.
DR   EnsemblGenomes-Tr; EBT00001642114.
DR   EnsemblGenomes-Tr; EBT00001642115.
DR   EnsemblGenomes-Tr; EBT00001642116.
DR   EnsemblGenomes-Tr; EBT00001642117.
DR   EnsemblGenomes-Tr; EBT00001642118.
DR   EnsemblGenomes-Tr; EBT00001642119.
DR   EnsemblGenomes-Tr; Tcur_R0001-1.
DR   EnsemblGenomes-Tr; Tcur_R0002-1.
DR   EnsemblGenomes-Tr; Tcur_R0003-1.
DR   EnsemblGenomes-Tr; Tcur_R0004-1.
DR   EnsemblGenomes-Tr; Tcur_R0005-1.
DR   EnsemblGenomes-Tr; Tcur_R0006-1.
DR   EnsemblGenomes-Tr; Tcur_R0007-1.
DR   EnsemblGenomes-Tr; Tcur_R0008-1.
DR   EnsemblGenomes-Tr; Tcur_R0009-1.
DR   EnsemblGenomes-Tr; Tcur_R0010-1.
DR   EnsemblGenomes-Tr; Tcur_R0011-1.
DR   EnsemblGenomes-Tr; Tcur_R0012-1.
DR   EnsemblGenomes-Tr; Tcur_R0013-1.
DR   EnsemblGenomes-Tr; Tcur_R0014-1.
DR   EnsemblGenomes-Tr; Tcur_R0015-1.
DR   EnsemblGenomes-Tr; Tcur_R0016-1.
DR   EnsemblGenomes-Tr; Tcur_R0017-1.
DR   EnsemblGenomes-Tr; Tcur_R0018-1.
DR   EnsemblGenomes-Tr; Tcur_R0019-1.
DR   EnsemblGenomes-Tr; Tcur_R0020-1.
DR   EnsemblGenomes-Tr; Tcur_R0021-1.
DR   EnsemblGenomes-Tr; Tcur_R0022-1.
DR   EnsemblGenomes-Tr; Tcur_R0023-1.
DR   EnsemblGenomes-Tr; Tcur_R0024-1.
DR   EnsemblGenomes-Tr; Tcur_R0025-1.
DR   EnsemblGenomes-Tr; Tcur_R0026-1.
DR   EnsemblGenomes-Tr; Tcur_R0027-1.
DR   EnsemblGenomes-Tr; Tcur_R0028-1.
DR   EnsemblGenomes-Tr; Tcur_R0029-1.
DR   EnsemblGenomes-Tr; Tcur_R0030-1.
DR   EnsemblGenomes-Tr; Tcur_R0031-1.
DR   EnsemblGenomes-Tr; Tcur_R0032-1.
DR   EnsemblGenomes-Tr; Tcur_R0033-1.
DR   EnsemblGenomes-Tr; Tcur_R0034-1.
DR   EnsemblGenomes-Tr; Tcur_R0035-1.
DR   EnsemblGenomes-Tr; Tcur_R0036-1.
DR   EnsemblGenomes-Tr; Tcur_R0037-1.
DR   EnsemblGenomes-Tr; Tcur_R0038-1.
DR   EnsemblGenomes-Tr; Tcur_R0039-1.
DR   EnsemblGenomes-Tr; Tcur_R0040-1.
DR   EnsemblGenomes-Tr; Tcur_R0041-1.
DR   EnsemblGenomes-Tr; Tcur_R0042-1.
DR   EnsemblGenomes-Tr; Tcur_R0043-1.
DR   EnsemblGenomes-Tr; Tcur_R0044-1.
DR   EnsemblGenomes-Tr; Tcur_R0045-1.
DR   EnsemblGenomes-Tr; Tcur_R0046-1.
DR   EnsemblGenomes-Tr; Tcur_R0047-1.
DR   EnsemblGenomes-Tr; Tcur_R0048-1.
DR   EnsemblGenomes-Tr; Tcur_R0049-1.
DR   EnsemblGenomes-Tr; Tcur_R0050-1.
DR   EnsemblGenomes-Tr; Tcur_R0051-1.
DR   EnsemblGenomes-Tr; Tcur_R0052-1.
DR   EnsemblGenomes-Tr; Tcur_R0053-1.
DR   EnsemblGenomes-Tr; Tcur_R0054-1.
DR   EnsemblGenomes-Tr; Tcur_R0055-1.
DR   EnsemblGenomes-Tr; Tcur_R0056-1.
DR   EnsemblGenomes-Tr; Tcur_R0057-1.
DR   EnsemblGenomes-Tr; Tcur_R0058-1.
DR   EnsemblGenomes-Tr; Tcur_R0059-1.
DR   EnsemblGenomes-Tr; Tcur_R0060-1.
DR   EnsemblGenomes-Tr; Tcur_R0061-1.
DR   EnsemblGenomes-Tr; Tcur_R0062-1.
DR   EnsemblGenomes-Tr; Tcur_R0063-1.
DR   EnsemblGenomes-Tr; Tcur_R0064-1.
DR   EnsemblGenomes-Tr; Tcur_R0065-1.
DR   EnsemblGenomes-Tr; Tcur_R0066-1.
DR   EnsemblGenomes-Tr; Tcur_R0067-1.
DR   EnsemblGenomes-Tr; Tcur_R0068-1.
DR   EnsemblGenomes-Tr; Tcur_R0069-1.
DR   EnsemblGenomes-Tr; Tcur_R0070-1.
DR   EnsemblGenomes-Tr; Tcur_R0071-1.
DR   EnsemblGenomes-Tr; Tcur_R0072-1.
DR   EnsemblGenomes-Tr; Tcur_R0073-1.
DR   EnsemblGenomes-Tr; Tcur_R0074-1.
DR   EnsemblGenomes-Tr; Tcur_R0075-1.
DR   EnsemblGenomes-Tr; Tcur_R0076-1.
DR   EuropePMC; PMC6428131; 30856245.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01325; CRISPR-DR12.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001738.
DR   SILVA-SSU; CP001738.
DR   StrainInfo; 100928; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082717
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thermomonospora curvata DSM 43183
CC   Culture Collection ID :: DSM 43183, ATCC 19995, CBS 141.67, IAM
CC                            14296, IMET 9551, JCM 3096, KCC A-0096,
CC                            NCIMB 10081
CC   GOLD Stamp ID         :: Gi02238
CC   Greengenes ID         :: 11996
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Municipal refuse compost samples
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 65C
CC   pH                    :: 6
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Phenotypes            :: Cellulose degrader
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5639016
FT                   /organism="Thermomonospora curvata DSM 43183"
FT                   /strain="DSM 43183"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:471852"
FT                   /culture_collection="DSM:43183"
FT   gene            61..2226
FT                   /locus_tag="Tcur_0001"
FT   CDS_pept        61..2226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: sat:SYN_02051 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95610"
FT                   /db_xref="GOA:D1ADA0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA0"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACY95610.1"
FT                   /translation="MEGRDLTAVWARTLAALSEGDLPPSYRAWLPLVRPLALVEGTALL
FT                   AAPNEFAKDALETRLRGLITQALSAELGREIRVAVTVQPEPPSDPAPADRAQPAPPAYR
FT                   GQSHPGVIHSPGGAGGYPEGGYGGPVGQGYPPPRDGGHDDSDHDGVHPPGRHRAYQPHP
FT                   GDYEGRHAGGHDRDGEPGHHRGPEAAPHGEESPWRPGVHMPPHLSDRPGGALHYENRYE
FT                   EGAGRAGENSADLGTHHDHQGAAPRPDDPHRPFADRPFGEGAGRPGEGPGLFPIPDARH
FT                   SAEGMLPADPAPPGQGRHRSDEHGHGEAGHLPPPGQGPRPYEGTFTGPFGQPPADGPLN
FT                   QGRPAGGRADRPGDGGEHEQQPWQRRPAAEPRPGSEHARLNPKYTFETFVIGSSNRFAH
FT                   AAAVAVAEQPAKAYNPLFIYGDSGLGKTHLLHAIGHYAQSLFSGVRVRYVSSEEFTNDF
FT                   INAIRDGKADHFRRRYRDIDILLVDDIQFLEGKEQTQEEFFHTFNTLHNASKQIVISSD
FT                   RPPKDLVTLEDRLRNRFEWGLTTDVQPPELETRIAILQKKARQEGLAVPQDVVEFIASQ
FT                   IATNIRELEGALIRVTAYASLNRQSVDMRVAETVLKDLIPDDSGPEITAAMIMAQTVEY
FT                   FGTTIEDLCGPSRSRMLVTARQIAMYLCRELTDLSLPKIGAQFGGRDHTTVMHAERKIR
FT                   ALMAERRAIYNQVTELTGRIKNQARKR"
FT   gene            2867..3994
FT                   /locus_tag="Tcur_0002"
FT   CDS_pept        2867..3994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: afr:AFE_0001 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95611"
FT                   /db_xref="GOA:D1ADA1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACY95611.1"
FT                   /translation="MKFRIDRDALADAVAWTARSLPQRPPVPVLGGMHLEAGDRLKLSA
FT                   FDYEVSAQVTTDIDAEEPGTVLVPGRLLADISRALPPHPVEVTADGSKVMLRCGSAKFT
FT                   LPTMPVEDYPSLPEMPPAAGSVGSDEFAVAVNQVAIAAGKDDTIPMLTGVRVEIDGETV
FT                   TLASTDRYRLAVRELQWKPERPDFSAAALVPARTLADTAKSLTSGAEVEVALGGAGSTG
FT                   EGMIGFSGGGRRTTTRLLDGDFVKYRSLLPTEYAGMAEVQTGPFIEAVKRVSLVAERNT
FT                   PVRLAFSQGEVVLEAGTGDEAQAVEALEATLEGEDINIAFNHGFLLDGLSQIGSDVARL
FT                   SFTTPTKPAVLTGKPPEEGATPSYRYLIMPVRLSG"
FT   gene            4275..5195
FT                   /locus_tag="Tcur_0003"
FT   CDS_pept        4275..5195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: dde:Dde_3470 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95612"
FT                   /db_xref="GOA:D1ADA2"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA2"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACY95612.1"
FT                   /translation="MHIGMVGLGRMGGNMAERLRRGGHTVVGYDRDPSLSDVSGLQELV
FT                   ERLPAPRAVWVMLPAGEPTRQTVHSLGELLEPGDVVIDGGNSNYRDDQEHGARLAAKGI
FT                   GFIDCGVSGGVWGLENGYALMVGGEEEHVRRLMPIFETLKPAGEYGFVHAGKVGAGHFV
FT                   KMVHNGIEYGMMQAFAEGYELIAASGLVKDVPETFRSWKEGTVIRSWLLDLLVRALEDD
FT                   PGLEGIRGYAQDSGEGRWTVQAAVDHAVPLPVITAALYARFASRQDDSPAMRVVAALRN
FT                   QFGGHAVESAKGADSPGADVAPPAV"
FT   gene            5315..6454
FT                   /locus_tag="Tcur_0004"
FT   CDS_pept        5315..6454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: afw:Anae109_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95613"
FT                   /db_xref="GOA:D1ADA3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACY95613.1"
FT                   /translation="MHVAHLSLQDFRSYATAEIALEPGVSVFVGPNGQGKTNLMEAIGY
FT                   VAAHSSHRVATDAPLIRQGAPRAIVRAGVVRDDRKALIELEINPGRSNRARLNRAPVPR
FT                   PREILGMLRTVLFAPEDLALVKGDPGERRRFLDELLTARAPRLAGVRADYDRVLRQRNA
FT                   LLKSAAAHRRPPGPEMLATLEVWDSHLARVGAELLAARLKLVADLSPLAAKAYAALAPG
FT                   GGIASLAYRSSLGERLPEDRMPVPRQTLAPLIEEALREVRRQELERGVSLVGPHRDELV
FT                   LQLGGMPARGFASHGESWSLALALRLAAFELLRADGDDPVLILDDVFAELDTGRRRRLA
FT                   ELVAPAEQVLITAAVPADVPAELRGASFTVENGAVTRDL"
FT   gene            6444..6983
FT                   /locus_tag="Tcur_0005"
FT   CDS_pept        6444..6983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   ppd:Ppro_1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95614"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA4"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACY95614.1"
FT                   /translation="MTSEPNKDPHPADDPAEPAPPAPASGKSGIELAREALAQARADAL
FT                   KRGTTPGRGRRKNVPRPRPVREVGRGGDPKPFGAAIRELLAARGWEQRAAVGGVFGNWP
FT                   RIVGPELARHTKPERFDDGELTIVADSNAWAQQVRLLSAQLVRRLNEELGHGTVRRVKV
FT                   LGPASGPRRPGAWRVR"
FT   gene            7346..9295
FT                   /locus_tag="Tcur_0006"
FT   CDS_pept        7346..9295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gsu:GSU0003 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95615"
FT                   /db_xref="GOA:D1ADA5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA5"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACY95615.1"
FT                   /translation="MAYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEIVDNSV
FT                   DEALAGYADTIEVTLLADGGVRVADNGRGIPVDEHPVEKRPAIEVVLTTLHAGGKFDGK
FT                   SYAVSGGLHGVGSSVVNALSTRLDAEVRQKGYVWRQSYTWRGPIAPLAKGEPTDETGTT
FT                   ITFWPDPEIFETVEWNFETLSRRLQEMAFLNRGLSITLTDERPGHLGGEDGTEPRRVVY
FT                   CYEGGISDFVRYLNAKKDAVHPDVISFEEHTEGMSVEVAMQWSGSYTESVHTFANTINT
FT                   AEGGTHEEGFRSALTSVVNRYARDKGLLREKDDNLTGEDVREGLTAIISIKLTNPQFEG
FT                   QTKTKLGNTEARSFVQKTVHEHLKDWFDREPGQAKEIINKASQAARARIAARQARDLTR
FT                   RKSLLESTSLPGKLADCQSTDPAKCELYIVEGDSAGGSAKGGRNPHFQAILPIRGKILN
FT                   VEKARIDKILKNAEVQAIITALGTGVHDEFDISKLRYHKIILMSDADIDGHHINTLLLT
FT                   LLFRFMRPLIEAGHVYLSQPPLYKIKWDQRGQDAEYAYSDAERDAIIEAGIAAGKRDPR
FT                   PRDGVQRFKGLGEMNAQELWDTTMDPSRRVLLQVTLDDAAQADELFSVLMGEDVEPRRE
FT                   FIQRNAKDVRFLDI"
FT   gene            9371..11890
FT                   /locus_tag="Tcur_0007"
FT   CDS_pept        9371..11890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gsu:GSU0004 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95616"
FT                   /db_xref="GOA:D1ADA6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA6"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACY95616.1"
FT                   /translation="MTEVTTGGSGPGERIEPVDIQVELQRSYLDYAMSVIVARALPEVR
FT                   DGLKPVHRRVLYAMYDGGYRPDRGYFKCARVVGDVMGNYHPHGDSAIYDTLVRLAQPWA
FT                   MRYPLVDGNGNFGSRGNDPAAAMRYTECRLAPLAMEMLRDIDKETVDFSPNYDGRSTEP
FT                   DVLPARFPNLLVNGSAGIAVGMATNIPPHNLREVTEGVFWYLDNYHVSDEELLDALIER
FT                   IKGPDFPTAALIVGRKGIEDAYRTGRGSITMRAVVEIEEIQGRTCLVVTELPYQVNPDN
FT                   LALKIAELVKEGKLEGIADVRDETSGRTGQRLVIVLKKDAIAKVVLNNLYKHTQLQETF
FT                   GANMLALVDGVPRTLRLDQFIRYWVDHQIDVIVRRTRFLLRKAEERAHILRALLRALDR
FT                   IEEVIALIRGSESAQAAQEGLMALLQIDEVQAQAILDMQLRKLAALERQAITDEYERLM
FT                   AEIADFNEILASPERQRRIVREELEPIVERYGDERRTQIVPFDGDVSYEDLIPEEDIVV
FT                   TITRGGYAKRTRVDAYREQKRGGKGVRGAQLKQDDIVEHFFVTTTHHWLLFFTNKGRVY
FT                   RAKAYELPEGGRDSRGQHVANMLAFQPEEHIAEVLDLRDYDVAPYLVLATRQGKVKKTA
FT                   LKDFDSPRTGGIIAINLAEGDEVIAARLVFPTDDLLLVGTNAQAIRFHADDEQLRPMGR
FT                   ATSGVIGMRFDTGHLLDMHVIRDGDEDVLVATEGGYAKRTPVEQYPVQGRGGKGVLTAK
FT                   IVQARGKLVGALMVRPEDGVFAMTSNGGVIRTNAGEIKRSGRQTMGVRLMNLAEGDSVV
FT                   AIARNVESSMEEEPEAGDPQTAEGKPQ"
FT   gene            11961..12698
FT                   /locus_tag="Tcur_0008"
FT   CDS_pept        11961..12698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CEL; carboxyl ester lipase (bile salt-
FT                   stimulated lipase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95617"
FT                   /db_xref="GOA:D1ADA7"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95617.1"
FT                   /translation="MSTQPNQSTNRPSETDPGANGSAPDLNKPDRPGDGGVHDLTRPEG
FT                   IAPVSDPIPSKDPSWSPSASQSGSSSLPALPAAGASGGQQRPPGGPQGAPTMAPPAPPG
FT                   SAQSKRAVARLGGSGGRTPRRAQLQLARLEPWSVMKFSFVMSLVAFIVLLVAVTVLYVI
FT                   LSGLGVFDAISETVNDLTRDQSSSGGVDAANWFGFGRIFGYTVLVGALNVLLITALSTV
FT                   GSVIYNLAADLVGGIEVTLKEAE"
FT   gene            12806..12879
FT                   /locus_tag="Tcur_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            12806..12879
FT                   /locus_tag="Tcur_R0001"
FT                   /product="tRNA-Ile"
FT   gene            13548..13967
FT                   /locus_tag="Tcur_0009"
FT   CDS_pept        13548..13967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0009"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: cti:RALTA_B0884 putative
FT                   transcriptional regulator, AraC family, isolated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95618"
FT                   /db_xref="GOA:D1ADA8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACY95618.1"
FT                   /translation="MKDLARLRRVRDRIDREYAQPLNVEALARDVHMSAGHLSREFRRA
FT                   YGESPYSYLMTRRIERAMALLRRGDMSVTEVCFAVGCSSLGTFSTRFTELVGVPPSVYR
FT                   RMAADATKGMPSCVAKQVTRPVRNREARVLVPHLA"
FT   gene            13973..14383
FT                   /locus_tag="Tcur_0010"
FT   CDS_pept        13973..14383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0010"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cti:RALTA_B0885 putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95619"
FT                   /db_xref="GOA:D1ADA9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA9"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACY95619.1"
FT                   /translation="MDITIQQTFLPHSDPDASLAFYRDVLGFEVRNDVGYGGMRWITVG
FT                   PPSQPDVSIVLYPPNADPGITEDERRTIAEMMAKGTYGHIILSTKDLDGTFERVQARGA
FT                   EVVQEPTEQPYGVRDCAFRDPAGNLIRINERR"
FT   gene            15415..15654
FT                   /locus_tag="Tcur_0011"
FT   CDS_pept        15415..15654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95620"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95620.1"
FT                   /translation="MLSDLVYDGKGGLWMRAGQKLLHYKSGKWKTVSLPRKDGLRPEIN
FT                   ALAHIPKTTSVWAVGALADEREVYQSSVILKYGK"
FT   gene            complement(16357..17127)
FT                   /locus_tag="Tcur_0012"
FT   CDS_pept        complement(16357..17127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95621"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95621.1"
FT                   /translation="MLRTHLASPEAEQQDAADLTRPTTDTDPRWLRTARAQLVHYPLRH
FT                   LEGRVRRQDAVARGAAARPERDLRQARWAAPLRTDPSLLDLAIIAVFRARRGLTDLLHV
FT                   PEDVRQRLNLTPTQATEKMRKALQTLHTVNPAFFTANLGTSAFSLLHPAPTTPPERVQA
FT                   QSTLRALLTSHPHRPIIAALCALAAGENTAPTEIARRSLGLSPEAAHHLVRRLTTLIAT
FT                   AGIDWTEQLLTPAENHPGDGSTTPFRRRNDHQAA"
FT   gene            complement(17587..18336)
FT                   /locus_tag="Tcur_0013"
FT   CDS_pept        complement(17587..18336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95622"
FT                   /db_xref="GOA:D1ADB2"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95622.1"
FT                   /translation="MNTALIFTFSNNVDIYINSILHLGDKYAVSKFSFIFVTGATIEGP
FT                   STDFADKIVSGLEDLSAGIYKNSSIEIDDRIKSRCAATVDNLKASQSNQELAQPVPLEE
FT                   LEKFLERQSKQARPGRLFIDVTGLPKVLMSHVMLIGIAGGHETYAFELHKQPDRAHPEK
FT                   SLYFFIPPGGFSYYPLRQSPAVQSVFRKLIHVRRILRTTTATLIVGIICFSILTFIDSQ
FT                   NPILATIGLVSNLIGIASGIYQMRSPR"
FT   gene            complement(18333..18656)
FT                   /locus_tag="Tcur_0014"
FT   CDS_pept        complement(18333..18656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95623"
FT                   /db_xref="InterPro:IPR040942"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95623.1"
FT                   /translation="MYVITENKNKLRELSQEFENLINELFNQINKNPSIKVLLHGGDSI
FT                   LLEMPRSEIETTVNLIRTTSRGTSFTFSGGYGKTMRDAYLALKLAKATGKNKIIPFTPE
FT                   TLR"
FT   gene            19877..20604
FT                   /pseudo
FT                   /locus_tag="Tcur_0015"
FT   gene            complement(20821..21687)
FT                   /locus_tag="Tcur_0016"
FT   CDS_pept        complement(20821..21687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0016"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rec:RHECIAT_PB0000111 putative carboxylesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95624"
FT                   /db_xref="GOA:D1ADB4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY95624.1"
FT                   /translation="MSRISPVTGHYVTVEVDGLEYKVFYLENGTGQPLVCQHTAGCHNH
FT                   QWRGLLEDEQIASDYRIIAYDLPRHGKSDPPENTEWWKEEYKLTAEHYTNFIIAFCDAL
FT                   DLKDPIFMGCSFGGNVALQLALRRPDRFAGIIAVEGADYSPGFYLDWWQHPHANAAQVC
FT                   ASGVWDLMAPQSPEADRRKTWFYYTQGSEAFKGDLYFYSVDHDLRDRLGEIDGDRCPLV
FT                   MMTGEYDYLTTPEDSARTAKAIKNCTFLKMEKIGHFPMSENYPVFRLYLLEALRILKQR
FT                   RKTPVPA"
FT   gene            complement(21702..22115)
FT                   /locus_tag="Tcur_0017"
FT   CDS_pept        complement(21702..22115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95625"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95625.1"
FT                   /translation="MTMTAPTLTRTAQQWADAFAKASNEDPEIQAHGKDFTCSYLLDAT
FT                   DQAFVIRVESGRVVQVAVDPGPLDVRYQFAIRASAETWRNFSKPEPPPMFHGIWAASFQ
FT                   RDMRLEGDLLVLMQNLRCITRQLELLRTVGSPV"
FT   gene            complement(22332..22931)
FT                   /locus_tag="Tcur_0018"
FT   CDS_pept        complement(22332..22931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0018"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="KEGG: ade:Adeh_2880 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95626"
FT                   /db_xref="GOA:D1ADB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB6"
FT                   /inference="similar to AA sequence:KEGG:Adeh_2880"
FT                   /protein_id="ACY95626.1"
FT                   /translation="MKSPRAELVAETALTLLAERGMRGLTHRAVDEAAALPPGSASNVA
FT                   RTRAALLALALERLNELEERQFAAAGPLPERPGRHVLIEAVARLLHAQLTEDRRRTLAR
FT                   YELALEATRRPELRTLYDESGRRFRNLAIALMTAAGSSAPDRHGRQLVMFCEGVMFYVL
FT                   AGAGTEPTLEELRLAVADFFTGVLGPSRDTPGTARH"
FT   gene            23007..24161
FT                   /locus_tag="Tcur_0019"
FT   CDS_pept        23007..24161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0019"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: mxa:MXAN_3398 FAD-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95627"
FT                   /db_xref="GOA:D1ADB7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB7"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACY95627.1"
FT                   /translation="MRKAIVIGGGIGGLTAAAALKGKGWTVRVYERAPGLEPVGSGLAI
FT                   GPNALRALDTLGIGDRVRDLAALAGDGGLQRPGGGWLSRTSAEDAAVRYGDLTVIMLRS
FT                   RLVSLLSGLLETDDLHLGVTVESVSPDDGTVITDRRADRADLIVAADGIGSRTRAALFP
FT                   GHPGPRYFGLTAWRLLTADPGTIEAFSETWGRGLLFGVTPLADGMLYCYAAAPAPAGRR
FT                   APDEKRELLRLFGTWHDPIPGLLAQADPARILRNDIYFMEPPLPAFHRGRVVLLGDAAH
FT                   PMTPHLGQGACQAIEDAIVLAHEVTDGGGPAAYTAARLPRTTEIMRRSRRIGRLAALQN
FT                   PLLVALRDAAMWTANRLGPSLVLRQGDPVFAWRPPAAAAGLIRR"
FT   sig_peptide     23007..23063
FT                   /locus_tag="Tcur_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.710 at
FT                   residue 19"
FT   gene            complement(24210..24608)
FT                   /locus_tag="Tcur_0020"
FT   CDS_pept        complement(24210..24608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0020"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   mxa:MXAN_5221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95628"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB8"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACY95628.1"
FT                   /translation="MSGHAGKRGAEIHAGGGDRLGGMEKFSLNEIEHRLLERAASSSSG
FT                   RGAETVYGGQGNVLRQTVLSLRAGSALAEHESPGEATLLVLRGRVRLRSGDASIEGTAG
FT                   ELLVIPPARHALEAVEDSAVLLTTAKSG"
FT   gene            24736..25242
FT                   /locus_tag="Tcur_0021"
FT   CDS_pept        24736..25242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0021"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pzu:PHZ_c3244 uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95629"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB9"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACY95629.1"
FT                   /translation="MSDAPELTDETIRVAELPEEQREYVQSMFQSAQLSALLDLRLVEM
FT                   SPRHALVSMPIAPQAFNSAGRLHGGAIATLIDQAAGTVAARAGDLDLATHNLVTVDMHV
FT                   RYLARAKGERVYARAEIIKAGSRLITVECKVTDDEEQLVASADFAMMIIPRTDRPRANG
FT                   QAPES"
FT   gene            25433..26596
FT                   /locus_tag="Tcur_0022"
FT   CDS_pept        25433..26596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0022"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95630"
FT                   /db_xref="GOA:D1ADC0"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR004236"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC0"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACY95630.1"
FT                   /translation="MRRPGAGDESRLRTVVLAAGVVVGTAGLAAGSLYAVQAGEPAERP
FT                   AGTADAALTGAGGTPGEAVRAEPATADRAGADVLAARLARRLGDRTAGAYLDDAGRPVV
FT                   TVTNAADAAMVRRAGAVPKPVPRSPATLNRITGTLRRSVGSIPGTGWAIDPAAGQVVMW
FT                   TDDTVTGARMASVRRAARQMGPAVRMVRIPGRLRTFALGGDAIFGQGARCSLGFNVRRG
FT                   RQNFFLTAGHCGNVVRTWTADRRGAQVLGTTVRSSFPGNDFALVRSAPGAAGQGAVNLY
FT                   NGRAQDIVRAADPVVGQRVVRSGSTTGVSTGRVTAVNATVNFPEGTVTGMIQTTVCAEP
FT                   GDSGGPLFSGTTALGLTSGGAGDCRIGGVTFFQPVTEALRAFGVEVF"
FT   sig_peptide     25433..25540
FT                   /locus_tag="Tcur_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.736 at
FT                   residue 36"
FT   gene            26615..26746
FT                   /locus_tag="Tcur_0023"
FT   CDS_pept        26615..26746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95631"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95631.1"
FT                   /translation="MEMSGDREAAREAINLARQRCLYGRAARPADAADGSQRPWRAG"
FT   gene            26944..27504
FT                   /locus_tag="Tcur_0024"
FT   CDS_pept        26944..27504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0024"
FT                   /product="response regulator receiver"
FT                   /note="KEGG: ade:Adeh_2705 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95632"
FT                   /db_xref="GOA:D1ADC2"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC2"
FT                   /inference="similar to AA sequence:KEGG:Adeh_2705"
FT                   /protein_id="ACY95632.1"
FT                   /translation="MTTSESKPVTRRQAEADRTGAHRAGDGGGVRTAEPAERRRGAPSP
FT                   EELRADIERTRAEIGDIVEALAAKADVKARVKDKIGRVRGNLAGKAQRVSAPQARSTAA
FT                   VVIGAGAVTAGTWMWRRRRAARRARARARAAAVALALTRPVLTSAAARNPWVRGVAAAS
FT                   VGVMAIRRMRRRRRAHRMVVAPK"
FT   gene            complement(27595..29142)
FT                   /locus_tag="Tcur_0025"
FT   CDS_pept        complement(27595..29142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0025"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   afw:Anae109_3412 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95633"
FT                   /db_xref="GOA:D1ADC3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC3"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACY95633.1"
FT                   /translation="MSSENLSAGEDTKSTDGRQTAQPANALDRFFKISERGSTVGQEVR
FT                   GGLATFFTMAYIVVLNPLIIGTALDADGQYLGDLTEPGSAIPLVAAATALIAGLLTIAM
FT                   GVFGRYPFAMAAGLGLNAVLAYSVASGMSWEDAMGIVVLEGIIIAVLVLTGFRVAVFHA
FT                   IPAGLKTAIAVGIGLFIALIGFVDAGFIRRIPGAEGESSVPVQLGAGGSLSGWPTLVFV
FT                   IGLLTAVVLVALRVKGAILISIISTTIIAIIVEAVAKVGPFNSGVGPDGKPQINSDGWQ
FT                   LNVPKLPDEIIGMPDLSLIGDFSLFGSFERAGVVAALLFIFTIMLADFFDTMGTVVGVG
FT                   AEGKLLDKDGNLPGVKSVLLVDSVGAAAGGVGSVSSNTTYVESAAGVAEGARTGLASVV
FT                   TGLLFLVAMFFSPLVSMVPFEAATPALVVVGFLMMTQIRNIDFSDYDMAIPAFLTIVLM
FT                   PFTYSITAGIGAGFIAYVVIKAARRKFAEIHPLMWVISLMFVIYFTLDPIKELLGVS"
FT   gene            complement(29268..30584)
FT                   /locus_tag="Tcur_0026"
FT   CDS_pept        complement(29268..30584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0026"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein; KEGG: scl:sce2495 hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95634"
FT                   /db_xref="GOA:D1ADC4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC4"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACY95634.1"
FT                   /translation="MDGYWSVLALVGALILVNAAFSGSEIALLSLREGQLRQLERRGPG
FT                   GRRLVRLARDPNRFLATIQVGITLAGFLASATAAVSLARPLVEVLGFLGQAAEPAAIAL
FT                   VTALLTFVTLVIGELAPKRLAMQFAERWALLAARPLDLLSMISRPVVWLLGASTNVVVR
FT                   LLGGDPQAVKEQLTPEELRDLVLGNRGLTAEQRLIISGALEIHERTLREILVPRREVFT
FT                   LTADTPVGRARTELANSGHSRAPVVRAGHVDDVVGVVNLRELITYDETAPVAEVARPAV
FT                   ALPDSLRVSQALRQFKAGRQQFALVIDEHGAVDGIVTMEDLLEEIVGEIYDETDRDVMA
FT                   VRREPDGALLLPGGFPIHDLPDIGVVLGTVPPGGYTTVAGLVLASLGRIPERPGDRVRA
FT                   GGWIIEVTAVDRHAITGVRIRPAGGSAAGKQDADRQQTS"
FT   sig_peptide     complement(30516..30584)
FT                   /locus_tag="Tcur_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.785 at
FT                   residue 23"
FT   gene            complement(30924..31778)
FT                   /locus_tag="Tcur_0027"
FT   CDS_pept        complement(30924..31778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0027"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: Ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95635"
FT                   /db_xref="GOA:D1ADC5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC5"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ACY95635.1"
FT                   /translation="MSTLSPAGFDKSLDLLAEHLRARAVALRPHVFGAGRPGQIAEAVS
FT                   LAFDAAYLGDQHSAELMIERAEALVRALPARPRKPAAIVRRGLRGQQRRWADAAVLIAA
FT                   TDASFKHPHVGWGYVSSAGHWGCAGGTYRGVLNPNGRSGAMISELRAVHMLLTDLDTDR
FT                   PMTLLIDSRGALRFLRAWQSGRVGLMPNGYSLRPRFGAAAQSTKPTLVRLAEQVASRPG
FT                   LRFEHVAGHSGHPLNEAADGLAGLARRCIAGDQDGDVDTLTARAQDLAAAFLHAWHSRP
FT                   GAG"
FT   gene            complement(32190..32471)
FT                   /locus_tag="Tcur_0028"
FT   CDS_pept        complement(32190..32471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95636"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95636.1"
FT                   /translation="MSTEAHSAVRCPHCRTPLTLSTADGKSVAQPVREEWSPPPVKEVL
FT                   AVYGDRVKDASVAARGAARVRESMARARRAAAQRRAAQSMRSRPSRSA"
FT   gene            32605..33135
FT                   /locus_tag="Tcur_0029"
FT   CDS_pept        32605..33135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0029"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: pzu:PHZ_c3078 putative pyridoxamine 5'-
FT                   phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95637"
FT                   /db_xref="GOA:D1ADC7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC7"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACY95637.1"
FT                   /translation="MTIKEPVTELNPAFSSATATATEWSQGEATLAEAELYWLATVRPD
FT                   GRPHVTPLLGVWLDQALHFVTGPQERKARNLAANPHCVLLTGRNSLREGLDVVVEGDAE
FT                   RVDDEAYLRRLAGAFAGKYGPQWRLQVQEGALRRSEGGRVWAFKVTPVKAFGFGKGETY
FT                   SQTRWRFQPRPAG"
FT   gene            complement(33169..34077)
FT                   /locus_tag="Tcur_0030"
FT   CDS_pept        complement(33169..34077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0030"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95638"
FT                   /db_xref="GOA:D1ADC8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC8"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACY95638.1"
FT                   /translation="MSMADPVDEPPISRMFNSSRGGPTVLRMLLGAQLRRIREERGITR
FT                   EDAAYVIRGSASKMSRLELGRVGIKERDVADLLTFYGMPDGPERAGLMALCHRAAMPHW
FT                   SDEFGDILPGWLELYVALEEAATRLRIYEVQFVPSLLRTEEYTRAVARLRHPRSQAAEH
FT                   ERMVALEQTRQRLLTRPAPPKLWAVLDEAVLRRRLGGRRVMREQLAHLLELCSLPHVTL
FT                   QVAPLGQGLGAPGGPFTLLRFQEPDLPDVVYLEHLDSAQYLDRGQDIDLYSRTLDALCA
FT                   QIPPPDRTPDLLHGLLRELDE"
FT   gene            35045..36103
FT                   /locus_tag="Tcur_0031"
FT   CDS_pept        35045..36103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0031"
FT                   /product="protein of unknown function DUF405"
FT                   /note="PFAM: protein of unknown function DUF405; protein of
FT                   unknown function DUF418; KEGG: mxa:MXAN_5096 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95639"
FT                   /db_xref="GOA:D1ADC9"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC9"
FT                   /inference="protein motif:PFAM:PF04171"
FT                   /protein_id="ACY95639.1"
FT                   /translation="MRLEEERRERYGPAASRDDGRPGWARSGRIGELDAVRGLALCGIL
FT                   PANIVAMTGMAGDEIKAEPGVLRHLYECLVHQRFFPVFSVLFGIGAAIFLRTARTGAES
FT                   PRAVLLARLGFLLMFGLAHQLLQPGEVLVYYAVTGIGVLLPATFLPRWAVLACGTAAVL
FT                   ASLLLAGGGVTLIPGLFLLGLAAVDYGVLDLIARRSRRITAAFAVTAPTAAGLGLWQVL
FT                   MGASAFGTPLPAAAGVVTGAAYAMGLLVVLRHERVAAFLSPVLQPLGRLALTNYITASA
FT                   LVLMADRLLDLGGDPRVAALAGTVAGILAAQTVFSRAWLRHYRYGPLEWLWRCLTWWRI
FT                   VPNRLPARPAAG"
FT   gene            complement(36218..38578)
FT                   /locus_tag="Tcur_0032"
FT   CDS_pept        complement(36218..38578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0032"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /note="KEGG: aeh:Mlg_1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95640"
FT                   /db_xref="GOA:D1ADD0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD0"
FT                   /inference="protein motif:COG:COG3973"
FT                   /protein_id="ACY95640.1"
FT                   /translation="MSKAEMAREQEYVSRLYRRLDGLREQTAARLADVLRHSDGTAQGR
FT                   WDREAAASRYTQRLARLTAAERGLCFGRLDFRDGPSRYIGRIGLPAEDAADDPDAEPLL
FT                   LDWRAPAARPFYLATAVAPQGVHRRRHIRTQGRRVIDLNDELLDARREDADAPQIGEAA
FT                   LLAALEADRSGRMRDIVATIQAEQDAVIRSGHRGVLVVEGGPGTGKTVVALHRAAYLLY
FT                   THRDLLARRGVLIVGPNRTFLRYIEEVLPALGETGVLATTIGELFPGVRADGTEPPQVA
FT                   EIKGRAMMAEVVAAAVKDRQWVPREALRIETEQGLVLHLDRATCERAREAARRSRLPHN
FT                   RARPIVVRHILDALARQAADRLNAGILVPEVLADLEPGERVDDLFDAEDVAAIRRELAG
FT                   DPAVHAALERLWPVLTPQRLLADLYSCPDRLASAAPGLSRAERESLLRDPSAPWTPADV
FT                   PLLDEAAELLGADDRAARARAEAERRRRIAYAQGVLDVTFGSRSTDLDDDAEAALTAGD
FT                   LVDAAALADRHEEPDPRTAAERAAADRTWAFGHIVVDEAQELSPMAWRLLLRRCPARWM
FT                   TVVGDPAQTGGAGGVWSWAQVLDACVPGRWRLERLTVNYRTPAEFMDLAAAVRAELTGE
FT                   DLRPPAAVRHAGSPPWLAQVPAGELPARLSALVAAELAALGGGHLAVVTPAALREELAG
FT                   ALGASTGPGEEADLRERLVVLTAGGVKGLEFDSVLVVEPARILAEGAQGPNDLFVALTR
FT                   ATKRMGIVHTGEHPLPAALTRLPSPPQILSAAR"
FT   gene            complement(38914..39783)
FT                   /locus_tag="Tcur_0033"
FT   CDS_pept        complement(38914..39783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0033"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: msl:Msil_0764
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95641"
FT                   /db_xref="GOA:D1ADD1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD1"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACY95641.1"
FT                   /translation="MTRLTERPAAASGTFRIGGDLPVHRLGFGAMRITGPGVWGEPADR
FT                   DEAIRVLRRAVELGVTLIDTADSYGPFVSEDLIAEALHPYPDDLVIATKGGFTRHGPNI
FT                   WEPLGRPEYLRQCVEMSLRRLRLERIDLYQLHRIDPKVPLEEQLGVLRDMQSEGKIRHI
FT                   GLSEVSVAELEEARKIVEIATVQNLYNLTSRQHEPVLEHCERHGIGFIPWFPLATGRLA
FT                   EAGGTLAQVASRHEATPAQIALAWLLHRSPVTLPIPGTSKVAHLDENLAAATISLTDDE
FT                   VAQLGKAA"
FT   gene            complement(39975..40445)
FT                   /locus_tag="Tcur_0034"
FT   CDS_pept        complement(39975..40445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K11675 Ino eighty
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95642"
FT                   /db_xref="GOA:D1ADD2"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95642.1"
FT                   /translation="MGVQDDFDLWERELQESAGISWPATGPGGMDDRWPEEEDTGPRPG
FT                   NGTLGELGGNLDGRGDDSVPESPDKPNPGIDDRFAGLGGRKTDPADPHRPDGEFDDEED
FT                   LDARRPGGRAMLAVTGVILLGYLLTLLLGRVPLAVAGLILAGLILLLWRVGL"
FT   gene            40655..40774
FT                   /locus_tag="Tcur_0035"
FT   CDS_pept        40655..40774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95643"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95643.1"
FT                   /translation="MKKLIVLAVIALGGLVVWRRLQQDRAELDLWTEATSSES"
FT   gene            40920..41012
FT                   /locus_tag="Tcur_0036"
FT   CDS_pept        40920..41012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95644"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95644.1"
FT                   /translation="MPPWAASLPVIAPKQPGCTGRGPFAAARLP"
FT   gene            complement(41207..42205)
FT                   /locus_tag="Tcur_0037"
FT   CDS_pept        complement(41207..42205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0037"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; CHAP
FT                   domain containing protein; KEGG: mxa:MXAN_0560
FT                   penicillin-resistant dd- carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95645"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD5"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACY95645.1"
FT                   /translation="MGDASGMLAAARAALGMSGVPNAITLDYAGRHGEEFRKAAWCDMA
FT                   VTYWARKSGNEAAVLPGGDRAYTVWHAQDFQKIGRWYPGTVANVNRAEPGDIVFFDWGR
FT                   SDSIGAIDHVGVVEKVLGGGRVQTIEGNTGNAVKRRVRSADVIAGYGRPAYKPYKWNGK
FT                   APSGEPELKRGDTGDRVRDLQSALLKAGERLPEYGVDGDFGAETEAAVRSFQSKHPDEV
FT                   DRVTGRYGPQTAAALARALGHAAPDKPKPPAAKAPPWPGRYLKQPPIMRGDDVRRWQSQ
FT                   MRKRGWRLTVDGAYGPRSEQVCRAFQEEKGLAVDGVVGLVTWRQAWEAPIT"
FT   sig_peptide     complement(42134..42205)
FT                   /locus_tag="Tcur_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.736 at
FT                   residue 24"
FT   gene            complement(42205..42372)
FT                   /locus_tag="Tcur_0038"
FT   CDS_pept        complement(42205..42372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95646"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95646.1"
FT                   /translation="MPDVREPEGPAEAARMSEVDVHPGVHRATEPDEEQVLRELYGEPD
FT                   EDGIFRGKGA"
FT   gene            42720..42795
FT                   /locus_tag="Tcur_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            42720..42795
FT                   /locus_tag="Tcur_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(42852..44207)
FT                   /locus_tag="Tcur_0039"
FT   CDS_pept        complement(42852..44207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0039"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mch:Mchl_3323
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95647"
FT                   /db_xref="GOA:D1ADD7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD7"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACY95647.1"
FT                   /translation="MANRAGHRRFGNIRKLPSGRYQARYPGPDGKMRTAPSTFATKGDA
FT                   DRYLTLVEAQILNGEWTDPDRAKVKLGDYAAKWIEQRPGLRPRTVELYERLLRRHIAPY
FT                   LGGVALGKLSTPVIREWRMTLLSEGVSASVTAKAYRLLRAVLTTATEDDRIIPRNPCRI
FT                   RGAGDEKPDERPVLTVPQVFELADRIGRRPVGNVRKLPSGAYRLRYQLPDGSTMRAFPT
FT                   TFTSKAAAEQMLSELADKGEANVRRDDRFRALVLLATFASLRWGEAVALQRQDIDLAAR
FT                   TVTVRRQYLEMDSGDLVLGPTKSRAGARTVVFPAGIVPAIRDHLDRYTADDPAALVFTG
FT                   ANGGVLRRGNFRRASRWGEAVAALGVPGLHFHDLRHTGNTIAARSGASLRDLMRRMGHD
FT                   SVRAALIYQHATSEADKAIAASLDAQIEAAAVADGDGDGDEDGAAGVLAPVG"
FT   gene            complement(44316..44465)
FT                   /locus_tag="Tcur_0040"
FT   CDS_pept        complement(44316..44465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95648"
FT                   /db_xref="GOA:D1ADD8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95648.1"
FT                   /translation="MTSNPPKTNPLPPGDRLLTVAEAAELLNTSERFPRRLIAERRIRF
FT                   VSAR"
FT   gene            complement(44462..46120)
FT                   /locus_tag="Tcur_0041"
FT   CDS_pept        complement(44462..46120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95649"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95649.1"
FT                   /translation="MTGRPEQTTAPVKTLAPLAREVVKAVAVEHGVCIRPVPMRRVNLT
FT                   TGESERFDVPCGHTLASVCPSCAERKRKLRAVQCGQGWHLDSEPVIERADPDAQQRHLM
FT                   QLRAHAQARRDAVEATGRPDEHGDLAWWDGLLLELDREIERTGVAGRLRTGDQRSRRTR
FT                   STRRRQDVPDLPRRPVENRTVGRTFLGKGGKTFRPSIFLTLTLDSYGKVRADGTPVDPA
FT                   TYDYRRAARDALHFSKLIDRFVQNLRRFVGYDVQYFATVEPQRRLAPHLHMAIRGTISR
FT                   ADLRRVAAATYHQVWWPPTDRIVYPNGRLPIWDAAAGDDGVGGYVDPDTGEVLPTWDDA
FT                   LDALGADPDAEPLHVVRFGPQVHAEGVLADTPDARRCIGYLTKYLVKNVAECHTPQTEA
FT                   QRAHVDRLADALRYEPCSPTCANWLRYGIQPKNPRPGLVPGFCKGKAHRREHLGYGGRR
FT                   ILVSRKWSGKTLADHKADRKVWVLARLAEAGIPAARPDDPDGVYAWERAGPGDPDVRPL
FT                   DERLLHLIDERIQRRRQLDQATQMATQLSATPEAA"
FT   gene            complement(46117..47484)
FT                   /locus_tag="Tcur_0042"
FT   CDS_pept        complement(46117..47484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0042"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: pha:PSHAb0091
FT                   cell divisionFtsK/SpoIIIE domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95650"
FT                   /db_xref="GOA:D1ADE0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE0"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACY95650.1"
FT                   /translation="MPEGLVLLVNLLRLLARAVVFCLRHPIVSGAVVGAGWLAWRYGWH
FT                   VPALVGLVVVVGLGVWAAVDRASFVRRVYRPAWSWWRGWWVYRRHWQPVLVTAGLTKTH
FT                   RGREYLPTLRRVECGAASDRLLVQMLRGQAPDAWEKVAANLAHGFGATLVRVREGDRPG
FT                   RVWLEFVRIDALASPIPALPIPDASAVDLRAVEVGRLEDGSPWRLRLLGTHVLVAGATG
FT                   SGKGSVLWSVIRGVLPLMVAGLVEVWAIDPKRMELSYGRVLFERFGRYSSDPGGGMVAL
FT                   LEEAAGDMNARADQFAGHTRTFVPSVEHPFRLIVVDELAFLTAYSPERDLRKRAESALA
FT                   ILTSQGRSVGYCVLGAQQDARKEVNNLRNLFPDRIALRLDEDEQVDMVLGDGARDRGAL
FT                   ADQISTVPEVGAGVGFVRLETCPDPVRVRAAYVSDEDIRQMVAYALSGGTYRPEAA"
FT   gene            complement(47675..47965)
FT                   /locus_tag="Tcur_0043"
FT   CDS_pept        complement(47675..47965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95651"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95651.1"
FT                   /translation="MTRSSFMSLSVLLGADAYIACSTYPDRPESGPILSISAGDLSLMI
FT                   SPATRGLATDDDLATAHRLAEAITAYVAEIERQHSENACRCDTSIPDTSAA"
FT   gene            complement(47962..48228)
FT                   /locus_tag="Tcur_0044"
FT   CDS_pept        complement(47962..48228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95652"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95652.1"
FT                   /translation="MAGRVSALSLPVGSGASSEFKAFRSRTPLFTVSAGRLLVTLTLPE
FT                   RLGAGEVEFARRLAEQAAAYAVEVERLYRSGRSSARTGKGAAA"
FT   gene            complement(48228..48665)
FT                   /locus_tag="Tcur_0045"
FT   CDS_pept        complement(48228..48665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95653"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95653.1"
FT                   /translation="MGIQGRIPVEFGQVFPHGVYATGQAEPLTNFDTKRQEIDKDTGLP
FT                   VWVVDVYDADPAAKHKASAIRVRVIARECPVLPEPVMGPFRPVEFTGMTVTPYVEVSGK
FT                   NPQGEPITRIAYSYRATGVQAPNTPAAGRGGARPAAGKDAA"
FT   gene            complement(48783..49517)
FT                   /locus_tag="Tcur_0046"
FT   CDS_pept        complement(48783..49517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0046"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; SMART:
FT                   regulatory protein GntR HTH; KEGG: rpi:Rpic_4094
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95654"
FT                   /db_xref="GOA:D1ADE4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE4"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACY95654.1"
FT                   /translation="MPSLDFEPPKYARVVLELRRRIEEGQYPPGSMLPSESQLVREFAV
FT                   GRTTVVRALQMLQQDGWIVREHGRGSFVKGRPASEREVTRPGLAVLDQPETRDGVSLVQ
FT                   VGTVPAPSPVVAVLGLGEGASLVMRRWVSTRDGVPSELVTCWFPPELAYGTDLGSDSPL
FT                   PVGVRAHLRSVRQLRIDHIAERLTARLPDADEPTLLQVGSSDPVLSILATAHDATDAAL
FT                   FAVEVVMPGTLHELEDVYSVPD"
FT   gene            complement(49651..50022)
FT                   /locus_tag="Tcur_0047"
FT   CDS_pept        complement(49651..50022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95655"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95655.1"
FT                   /translation="MRLPYGDSEGGRVSEQAFLEVERLAVKLSRRHGQLRFLGMLAATV
FT                   QGGVWELARLTGRSPDDIAAEHTGFCSDRGFREWMAEVMRTPPGAAWSPPPADAPLAPA
FT                   MALVHLHVTVCLALCRETD"
FT   gene            complement(50078..50383)
FT                   /locus_tag="Tcur_0048"
FT   CDS_pept        complement(50078..50383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95656"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95656.1"
FT                   /translation="MSGAAAATDEAGRWVPAVRADQLEAVWRLTRREFGDEFPNITIWY
FT                   GLASGLWRAMVPGPGGWRMLESPEPDDLRMQIRGALGFWPVYGSQHHRGHGSMGTG"
FT   gene            complement(50380..50742)
FT                   /locus_tag="Tcur_0049"
FT   CDS_pept        complement(50380..50742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95657"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95657.1"
FT                   /translation="MPGRSGRHARRAALHGVDLHVVAGAEGSASDPRVTHLEALRLCLE
FT                   KDGDGFGASLVRAWHGPVVLRVIYPHSVRPPEDIACDFTDGEWWFVWSDGRTIGPADDP
FT                   EGVARAIVTDPWREPA"
FT   gene            complement(50729..51040)
FT                   /locus_tag="Tcur_0050"
FT   CDS_pept        complement(50729..51040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95658"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95658.1"
FT                   /translation="MRGAGRAMDAPRERDLQRVRLWALAQALRAHGFAVELAESDPLLV
FT                   VSGGPGVLVQVRCQVRDDCGGELWFRSANGVMIAPADDARLHEAVVAVKGLAVPDAGA"
FT   gene            51468..52247
FT                   /locus_tag="Tcur_0051"
FT   CDS_pept        51468..52247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0051"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: smd:Smed_4101
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95659"
FT                   /db_xref="GOA:D1ADE9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE9"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACY95659.1"
FT                   /translation="MAELDGAPVAPEALQALGLINYGHFTSMRVDDQHVRGLSHHLDRL
FT                   VRDCREVFDADLNRDKVREYIRRAIRDKPGSFVVRVTVFDPDLELGRPGATAEPRILVT
FT                   TRPAGAWPPPPMRVQSASYRRDLPHVKHIGLFGQLWCRRNAQLNGFDDALFIDSSSFVT
FT                   EGATWNIGFYDGDRVIWPSADVLPGVTMRLITQVHEQTITAPVNLRDVPSMEAAFATNT
FT                   TVGVRPITAIDNVQLPAEHPIFETLRKEYEEIPPERI"
FT   gene            52347..53258
FT                   /locus_tag="Tcur_0052"
FT   CDS_pept        52347..53258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0052"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   scl:sce5487 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95660"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF0"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACY95660.1"
FT                   /translation="MSIRDFAAHLGVSERMVSKWEKEAENIHPRPVNQQALDSSLAAST
FT                   PEEQERFAALVGETVQHTPAAVPDTQASAPPGEPLPLNEPHQVRHPIDGKLMTLVDAGV
FT                   FLAGEKDEPVYLPAFYIDVFPTTNADYARFVAATGHPAPQHWKDNSPPDNLLDHPVVFV
FT                   TWHDATAYAQWTAKALPTSQQWEKAARGTRGDTYPWGSQLTPAKCNVRESGIRTTTPVN
FT                   RYHSGVSPYGVYDMCGNVWEWCSTQSEPGRYELKGSAFTSPFKRCTPANFNDASADMLD
FT                   DDTGFRCVTPAETMRALLKMNS"
FT   gene            55118..55831
FT                   /locus_tag="Tcur_0053"
FT   CDS_pept        55118..55831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0053"
FT                   /product="nucleotidyltransferase-like protein"
FT                   /note="KEGG: scl:sce7146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95661"
FT                   /db_xref="GOA:D1ADF1"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF1"
FT                   /inference="protein motif:COG:COG3541"
FT                   /protein_id="ACY95661.1"
FT                   /translation="MTDTLLLTGVVGSTAYGLAGADSDVDVLGVYAAPTTVFHGLHPPT
FT                   ERTATKVSTDPDRTLHEAGKFARLCLSGNPTVTELLWLPEELYQVRTPLGEELIGIRTA
FT                   FLSAPRVRDAYLGYATRQFRRLEARGDGSFSADTRKRVAKHARHLARLVHQGLELYRSG
FT                   RLTVRLADPEWYLDFGARVAAGDLDVARALMARGEADYAAARTVLPERPDEDAVERWLL
FT                   RVRAAHYTHPCCKGD"
FT   sig_peptide     55118..55183
FT                   /locus_tag="Tcur_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.473 at
FT                   residue 22"
FT   gene            55918..57303
FT                   /locus_tag="Tcur_0054"
FT   CDS_pept        55918..57303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0054"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: cps:CPS_2368 putative
FT                   N-acetylglucosamine-6- sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95662"
FT                   /db_xref="GOA:D1ADF2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF2"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACY95662.1"
FT                   /translation="MSGTFPLTRRRVLLSGAVAATVAGICGGTSRPVSGRGRPNVLLLV
FT                   TDDQPLHTEWAMPVLRDMIKRSGVRFTRAYATTPLCGPSRASILSGRYAHNHGVLQNGR
FT                   PERLDQSTVLPRYLREAGYRTAMFGKYLNGWDVHQAPPHFDEYALMHPPKYGETWWNVN
FT                   GKVSRKRAYSTSLIRDHAVRFLRRHRASGRPWFLYLTPYAPHAPFTPEARYANLSVPSW
FT                   RGNPAVAESDKRDKPFYIRRSDPDLHRARRIRAGQLRTLRSVDDLLGAVRDELRAQRRL
FT                   DDTLIIVISDNGYCWGDHGWHAKSVPYSPAVRIPLYLSWPAGGLGRGATDDRLVANIDI
FT                   MPTILDAAGIDPGAARLDGRSLLRPGERDRLLLEWWKRGPGQAGHSWAATVTRDYQYIE
FT                   HYDTILRRGRPVGSGAVVHREYYDLRKDPHQLTNLLHRTGSGVARRLDVAGLSARLAAD
FT                   RRA"
FT   sig_peptide     55918..56025
FT                   /locus_tag="Tcur_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.711 at
FT                   residue 36"
FT   gene            complement(57409..58215)
FT                   /locus_tag="Tcur_0055"
FT   CDS_pept        complement(57409..58215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0055"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: ade:Adeh_4281 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95663"
FT                   /db_xref="GOA:D1ADF3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF3"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACY95663.1"
FT                   /translation="MGVLSCEGLPAGSVCRMSLKHVLASGVRRCLHAAVHRGWEWIQRQ
FT                   GEITPSTPGRYRFAYFGEGACIGFPTGAIYGERWISIGDHTLIGTHVTISAGFVPGLDL
FT                   GPDIIVKIGNSCSLGRGTYIVGHQSIEIGNDVFTGPNVYITDQNHSYSDLDTPIGRQWP
FT                   ENKPVVIGDGCWIGTGAIILPGTKLGRNVAVAGGAVVRGEFPDHCVIGGVPAKILRRHD
FT                   PDKGWVPPLRQRSSVVSLQELSQLATGAAEEDMQILQDKLREEAAG"
FT   gene            complement(58692..59114)
FT                   /locus_tag="Tcur_0056"
FT   CDS_pept        complement(58692..59114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95664"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95664.1"
FT                   /translation="MSPLISVRRRPQVEVDASPLRRMQEAARQGAVTAAVRLGPAMRHS
FT                   REFAAERLLEARGWSAPRLERAAGYVERDLAPRLSAMLADTAHRLEPPKPANRARNAAL
FT                   VMLGMIAAAGAAGALASRRSAAHTLGERMPEPTTTP"
FT   gene            59360..59890
FT                   /locus_tag="Tcur_0057"
FT   CDS_pept        59360..59890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0057"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mxa:MXAN_3763 peptidylprolyl
FT                   cis-trans isomerase, cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95665"
FT                   /db_xref="GOA:D1ADF5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF5"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACY95665.1"
FT                   /translation="MAEELIATLNTTFGPISLRLFPEHAPKTVANFVGLAEGTRQWTDP
FT                   RTGRPSNAPLYNGTIFHRVIDGFMIQGGDPLGTGTGGPGYRFEDEVDSGLKFDRPYLLA
FT                   MANAGPNTNGSQFFITLTVEQTAHLTGAHTIFGEVISGHDVVDRIGKAPTGPRNRPLQD
FT                   ITIESVTIERRQS"
FT   gene            59939..60847
FT                   /locus_tag="Tcur_0058"
FT   CDS_pept        59939..60847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0058"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: nmu:Nmul_A2462
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95666"
FT                   /db_xref="GOA:D1ADF6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF6"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY95666.1"
FT                   /translation="MDAQAPGAPAEAPTCYRHPGRETYVRCTRCDRYICPDCMRDAAVG
FT                   HQCVECVQEGSRTVRRPRTVFGGQIPATPVVTYTLIALNVLVYLAQLSSSRIVYDFAMV
FT                   GVRFDPYGEMHGVADGEWYRLITAAFLHSQPGGGSFGVTHILFNMWALWVIGPQLEQVL
FT                   GRWRFTSLYLLSALGGSVLLYLVDPTGAAVGASGAIFGLFGAFFVIAKRLNAPAGGIVF
FT                   LLVLNLVITFTVPGISWEGHIGGLLTGGLLTAVYAYLPRVQGSDHQRRTVIHAVAVAAL
FT                   LALFIALVAVKTSELTGLLSF"
FT   gene            complement(60995..61252)
FT                   /locus_tag="Tcur_0059"
FT   CDS_pept        complement(60995..61252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0059"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95667"
FT                   /db_xref="GOA:D1ADF7"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF7"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACY95667.1"
FT                   /translation="MPKSKVRKKAVYTPPQRSQKAAVSPRWLVPTMLFLWLAGLVWIAT
FT                   FYVTASTATDVPLMSDLGNWNLGIGFGSIILGVILSTRWR"
FT   sig_peptide     complement(61100..61252)
FT                   /locus_tag="Tcur_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.786 at
FT                   residue 51"
FT   gene            61640..62218
FT                   /locus_tag="Tcur_0060"
FT   CDS_pept        61640..62218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0060"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: hch:HCH_00090 sortase (surface
FT                   protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95668"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF8"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACY95668.1"
FT                   /translation="MTYQLWGTDRYTRQQQDRLNKELLRSWNAPDEKITTEKVKLGGGL
FT                   ALLRIPRLGSKYRYVIVEGVEPEDLRKGPGHYPGSAMPGQIGNFVVSGHRTTYSAPFNR
FT                   IDQLRRGDRILIDTRRKQYVYKVTGHRIVKPTAVEVTAPVPFHPGRKPTKSLITLTTCH
FT                   PKYSDAKRLIVFGELAEQRSRRVAAPAGR"
FT   gene            62243..62452
FT                   /locus_tag="Tcur_0061"
FT   CDS_pept        62243..62452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95669"
FT                   /db_xref="GOA:D1ADF9"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95669.1"
FT                   /translation="MYGWIWRHLPGRGPVRALIAAGLVAVAVLLLWYVVFPWAESKVRF
FT                   DENTVEGGSVGTPGPAPARTADER"
FT   gene            62442..63035
FT                   /locus_tag="Tcur_0062"
FT   CDS_pept        62442..63035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0062"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   cak:Caul_2776 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95670"
FT                   /db_xref="GOA:D1ADG0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG0"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACY95670.1"
FT                   /translation="MSADGPRVLVVDNHDSFVFNIVQYLLELGADCVVKDRSDVTVDDA
FT                   AGVHGVLLSPGPGHPADTGVCLELVKDAERRRLPLLGVCLGHQIIGHVYGAAVHRAPEL
FT                   VHGYTSPIEHDGEGVLAGLPSPFQATRYHSLAVDPASVPRALKVTARTPDGVVMGLRHR
FT                   DRPIEGVQFHPESVLSECGHRLLANWLATCAFVP"
FT   gene            complement(63269..65053)
FT                   /locus_tag="Tcur_0063"
FT   CDS_pept        complement(63269..65053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0063"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG:
FT                   dar:Daro_0438 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95671"
FT                   /db_xref="GOA:D1ADG1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95671.1"
FT                   /translation="MAEVYRAKDLRLDRVVAVKTLRSDLARDPVFQARFSREAQSAASL
FT                   NHPSVIAVYDTGEDQVGDTSIPYIVMEYVEGNTLRDLLREGGRLVPERALEITDGILRA
FT                   LDYSHRGGIIHRDIKPANVMLTRNHEVKVMDFGIARAMADSAATMTQTAQVIGTAQYLS
FT                   PEQARGERVDARSDLYSTGCVLYELLTGRPPFTGDSPVAIAYQHVREEPVPPSQLDPAI
FT                   PQWCDNIVMKAMAKDPNLRYQSAAEFRADIQRALQGMPVSAPAASTMVMGGAAPQGTRV
FT                   MSPVPGGPAGPGGVPPHTRMQHPVNTGYELPPVNYEDPEPSGRNGKKIAIWALVVALFI
FT                   GGAALIGYALSSGGGKGGATASPSASVQMVEVPDVRNERRQDAEEELEEAGLKVGSVEE
FT                   EYSDTVRRGRVISTDPAPGESVERGSEVSLVVSKGPEPPEQVAVPDVTGQPADAARQVL
FT                   EASGFKVTQRSSPSSEVQEGMVIQTSPAAGTQAPKGSTITMIVSSGPENVRVPNVVGQT
FT                   EADAVNTLRAAGLRVQVQVVPQRSPDQQVGTVVQQSLEPGREVLPGTTVIILVVQNPDG
FT                   GDPGDDHGPPGGGGGGGG"
FT   gene            complement(65148..66764)
FT                   /locus_tag="Tcur_0064"
FT   CDS_pept        complement(65148..66764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0064"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce7721 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95672"
FT                   /db_xref="GOA:D1ADG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95672.1"
FT                   /translation="MTTADLVLDSRYRLLRRLATGGMGEVWEASDELLSRPVAVKLLRQ
FT                   EHVGNEQARARFRAEARYAAALQHSGIAQVYDYGEHDDLAYLVMELVSGESLSRILARQ
FT                   GALGVETTLDVVAQAARALQVAHSAGIIHRDVKPGNLMMTPSGVVKITDFGIARGLNVA
FT                   TLTQTGMVMGTAHYVSPEQASGQPITFATDLYSLGVVAYECLTGRPPFDAEQPVAIALK
FT                   HVREAPPELPEEIPEAVRTLVRVLLAKNPEDRPPSAQAVADEAFRIHDALQAGEPVESS
FT                   FRDLLAGSGASLPAHRFGDPFDDAFDDGYGDVRDGTSEVARTRLLDEAAGMEPATVRGS
FT                   AVDALRPSGGLATWSELEDGETADTLTGVHPAGFSAAAGSRVAFAGTKVRVQRRTVVAI
FT                   ASVTAGVLALGAVAAGSLSRGPSAGIEETRDRVPSVVPEPSSLVPSRVPSPTGTPSLPA
FT                   WPGPRPPGNNFTASTTPTPSASSTGRPRPSPTTGSPTPQGPSPTPSESGNSPDPSPPVE
FT                   PPPEPEPEPEEPTTGDGLGSE"
FT   gene            complement(66761..68230)
FT                   /locus_tag="Tcur_0065"
FT   CDS_pept        complement(66761..68230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0065"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: mfa:Mfla_2494 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95673"
FT                   /db_xref="GOA:D1ADG3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG3"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ACY95673.1"
FT                   /translation="MDKPLRQVTVFALLLIGALMVQVNYIQGSQAEKLQTHPLNNRQYL
FT                   DVFKRPRGKILAGGEVLVSSSKREDSENYARTYKDGEVFAPITGYFNGGAKGIERAYHS
FT                   LLDGRDKRITNQRWFDQFIGRPAIGADVETTIIPDAQREAYRQLSRANPNLRGAIVVMD
FT                   VKTGAIVVMASYPSYDPNEVAPQTGLKGAERLNELDGKPNKDGQVNERNRRLKPLINNA
FT                   MEDTFSPGSSFKTLIAAGALEQGLNKSSTVPAPSTYTLPGTRTQMPNSHEGGACGGSGQ
FT                   APLILTFAESCNTTYAILGVERLRTEGVLKLAEEFGFSKKIPVEPDMPTVESSFPDAGD
FT                   DKTALASIGQGDNRATPLHMAMIAAAAANGGKIMKPYLVQRVRAADQSVIEEAEPEVYA
FT                   RPISKDTADQLADMMREVTRTGTAQGLGDVAGKTGTADIDGVEYNNRWFVGFAPAQEPR
FT                   YAFAVFTQGLGSGGQAAGPIAVSVMREVLRK"
FT   gene            complement(68274..69827)
FT                   /locus_tag="Tcur_0066"
FT   CDS_pept        complement(68274..69827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0066"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: glo:Glov_0671 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95674"
FT                   /db_xref="GOA:D1ADG4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG4"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACY95674.1"
FT                   /translation="MSSAPEQLPDQVPVQHQPRKAACLALLIFAMVMTLAAFAEVGLAR
FT                   DGRIPAGLVGYGGGLAVLAGAAYYIQARFAPYADPLLLPLAVALNGLGLAMIYRLDLST
FT                   SKDVQDAIRDGKKVVTSGLASAGTQLQWTFVAILLFALTVLFLKDSKILQRYMYTLGAC
FT                   AIVLLLLPIVPGLGAEINGARVWIFIGPFSVQPGEFAKLLLVVFFAGYLVNKRQALSLV
FT                   GKKIGPLSLPRARDLGPIMVIWLFGLGVLFIQKDLGTALLYFGLFVSMLYIATQRLSWV
FT                   LIGVGMLALGVLVATQLPFLGHVNQRLSIWQNPDPYFDGGCLVGDKVVSVAPGTEPYIQ
FT                   AGNTIGSGLTACIRMGGEYADSAQLMKGLFALGEGGVLGKGLGQGEPWRTPLAFSDFIF
FT                   DSMGEELGLTGLMVILLLYALIVQRGMKTAIAARDPFLKLFAGGVSFVLALQVFVIVGG
FT                   VTRLIPLTGLTTPFLAQGGSSLMANWILIGILVRMSHQARQPAPQAIQDEGLTQVVSIR
FT                   "
FT   sig_peptide     complement(69708..69827)
FT                   /locus_tag="Tcur_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.984 at
FT                   residue 40"
FT   gene            complement(69828..71450)
FT                   /locus_tag="Tcur_0067"
FT   CDS_pept        complement(69828..71450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0067"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: scl:sce6484 phosphoprotein phosphatase; PFAM:
FT                   Protein phosphatase 2C-like; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95675"
FT                   /db_xref="GOA:D1ADG5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG5"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ACY95675.1"
FT                   /translation="MTIGIRYAARSDVGMLREGNEDSAYAGAHLLAVADGMGGHVGGEI
FT                   ASAAAIGELRKLDTDLPASELLGALEHTVKAANDKLHRIVESDPALQGMGTTLTAMLWS
FT                   GTQVALVHIGDSRAYLLRDGSLFQITHDHTLVQSLVDEGRISPDEAASHPQRSLLLRAL
FT                   DGRGEVDPDLSLREAKVGDRYLLCSDGLSGVVTAETIFQVLSEYQDPEQAVHQLIDLAN
FT                   RGGGPDNITCVVADVIELPPGAPPPNQSPQAVGAAANVQHSELAELAGGSPPPPAPPSS
FT                   DTPAGRAAQLRDTRPQPPVAVEEMPPPQAAPAPRREPQPMGRPPEPMPMAPPRAPRRRW
FT                   TWLIVMVSVFVVLVGGGAAFAVYSMRNDGFYAQAENGMVVVYKGSPNSLLGLKLNSKAP
FT                   AHQQPNPPIRVEDLPEALQSNLKSPGYVDLSGADGWKKLASQVCKYSLESVGDRIAVMR
FT                   GSRQDGCKPTRIKESQVRLAELPASDRKAVQDGTLEFGDRQAALAKLEELDGRGRACSD
FT                   DAAGSGIDDCPGGNNASDGVRRP"
FT   gene            complement(71447..71947)
FT                   /locus_tag="Tcur_0068"
FT   CDS_pept        complement(71447..71947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0068"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_4648 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95676"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG6"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY95676.1"
FT                   /translation="MSEFTLTLIKLAFLAVLWLFVIAAVGVIRADMFGSSKAAARAAGR
FT                   ARAPRRTARPRQRPEGSRRPPQPAGPRRLVVTQGDRAGLTMELSPGVPITIGRANDATI
FT                   VVADDYASSRHARLYAQNGQWIVEDLGSTNGTYLGRNRVNQPTPVPPGVPIRIGQTVIE
FT                   LRP"
FT   sig_peptide     complement(71855..71947)
FT                   /locus_tag="Tcur_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.319 at
FT                   residue 31"
FT   gene            complement(71959..72711)
FT                   /locus_tag="Tcur_0069"
FT   CDS_pept        complement(71959..72711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0069"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_1361 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95677"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG7"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY95677.1"
FT                   /translation="MGVLQRFERRLEGMVEGAFARAFKSELQPVEVASAVQREMDERAA
FT                   IVAAGRTLVPNDFVVEISQADSQRLAVYADSLSQELANLAREYAKEQGYSFVGPVQVRF
FT                   ESAGDLATGLFRIRSGVVRGAIVEGGEIRKPASDIPQGRTGGFPGRPRLLVTTAQDVGP
FT                   STQQTYEITTPVTLLGRGTDCDLRLVDPGVSRHHAEIRVEGPEVVLVDLGSTNGSFVNG
FT                   NPIRRVTLVDGARVTMGRTTLVFRRDRE"
FT   gene            72822..72904
FT                   /locus_tag="Tcur_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            72822..72904
FT                   /locus_tag="Tcur_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(74107..75333)
FT                   /locus_tag="Tcur_0070"
FT   CDS_pept        complement(74107..75333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to rCG47301"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95678"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95678.1"
FT                   /translation="MKSLLRRARRAGALAAVALLALPAAPAHAEPAIRLDRTTVKVGQT
FT                   LTVRLVGWPAGNVLVELCGNEGLRGTVDCAVASSASTYVQEGRTATVMLSVGKPPIGCP
FT                   CVVSVRPVSGGTARTVPIKVSGVPTLSEAERRTATAAGSSRKLTATKVTVTGGGPGEAW
FT                   FGGTAHRTLRVTLRNEGTATLTDPPLSLTVGRGPEPTEPITAPALGTLAPGQERTYAIP
FT                   FSVGAPAFGRYTVRGEITGLDEPISFTAHTSSYPWALPVLAALVLPLTGLTARRGKHAL
FT                   RRPPAALTATGLPPRTMNQAVAANVAWWSQTRNLSPEQVASSLGSLTGRPRTPADLDPA
FT                   NPSCSLDADDLLALSRILDVPLPALLFTTSAPGLPGDASAPAAASEQTQRLPKVQKDQP
FT                   VQQPEKTSP"
FT   sig_peptide     complement(75244..75333)
FT                   /locus_tag="Tcur_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(75330..76355)
FT                   /locus_tag="Tcur_0071"
FT   CDS_pept        complement(75330..76355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0071"
FT                   /product="protein of unknown function DUF916 cell surface
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF916 cell
FT                   surface putative; KEGG: mxa:MXAN_7458 FG-GAP
FT                   repeat-fibronectin type III domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95679"
FT                   /db_xref="GOA:D1ADG9"
FT                   /db_xref="InterPro:IPR010317"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG9"
FT                   /inference="protein motif:PFAM:PF06030"
FT                   /protein_id="ACY95679.1"
FT                   /translation="MTKTAALTAGLALTAFLAAASPAASAAAPAEVSAAVPTAGRPGTA
FT                   PDPRAGGMTWAVRPVGPKGPSGRDYFVYNASPGQTIKDEVAISNLSDRTLTFRVYATDA
FT                   FNTADGSFALLTADRQPTDVGTWVKFDRGVQRVKAGRTVRVPFTLTVPHQATPGDHGGG
FT                   VIASITQQETDAKGRLVNVDRRVAARIYLRVKGPITPSLQISDLRAEYSAPPVGSGRMK
FT                   VTYTVRNTGNIRVTALARIRAQGPFGLPLGEQAARKVPELLPGNSYTFSEELDGILPAG
FT                   RLTSSIRLSPTDAQSGAPLAARPIIRKSSIWNIPWLPLTAVLLLLAAVLYARRRRSGYA
FT                   R"
FT   sig_peptide     complement(76275..76355)
FT                   /locus_tag="Tcur_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 27"
FT   gene            complement(76426..77424)
FT                   /locus_tag="Tcur_0072"
FT   CDS_pept        complement(76426..77424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_pESA3p05539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95680"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027273"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95680.1"
FT                   /translation="MKFNLRRLTRATAVVAGAGLLGLSLAATPAAAAGPSITVTPTSEL
FT                   NPDGQDIRVVGSGFDPNANNGFGIYVSFGPKNGDQWYLNANAFQATKWVHKNASGSPSQ
FT                   AKMNADGTFDITLTGIKARYTDGDGNQVDCLVTQCYILTFAAHGLPDRSQDTAIPVTFV
FT                   GGDNPGGGDDNGGGQPPAGDSKDQVIIANVTRTGALTLSVAGTEVTLSDAAPGGNATGR
FT                   LNKATVTDARGTDAGWSLVGQMSDLASAEGDIIPAANMGWTPTASVVNDGSNATVTPGP
FT                   AVRGLDVARTLASSEGGSSGGVFEAGAALDLLIPAGVATGTYTGTLTLTLS"
FT   sig_peptide     complement(77326..77424)
FT                   /locus_tag="Tcur_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 33"
FT   gene            complement(77596..78408)
FT                   /locus_tag="Tcur_0073"
FT   CDS_pept        complement(77596..78408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95681"
FT                   /db_xref="GOA:D1ADH1"
FT                   /db_xref="InterPro:IPR027273"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95681.1"
FT                   /translation="MGRLQRALAAATMVAVTGTGLLALAEPAAAASLRVSPSTGLDPNG
FT                   QTISVSGSGFDPNRNNKFGVYVVFGPRRADYYTNSGNYGAALWVHPGGAGSGQARMSPS
FT                   GTFSVSLTVKARYTDSSGRAVDCTRTRCYVMTFAAHGVPDRSQDTLIPVSFKGSDSPNP
FT                   GGSDPDNPGSGGSGSGGSTGPGGGSSASPSTGALTGSSASPLPSPGMAAPAAGAAGAAT
FT                   PLAVQPFRQTASGPPAQSPWPFWLTTAVLVAAGLTARRLIIRRRLRRT"
FT   sig_peptide     complement(78331..78408)
FT                   /locus_tag="Tcur_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.747 at
FT                   residue 26"
FT   gene            78528..79172
FT                   /locus_tag="Tcur_0074"
FT   CDS_pept        78528..79172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95682"
FT                   /db_xref="GOA:D1ADH2"
FT                   /db_xref="InterPro:IPR027273"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95682.1"
FT                   /translation="MKTFATSITVGVLGLSVWTAPLANADGSSVTGPQGQTLTVSKAAG
FT                   LSPDGEKITVTGRGYDPNKGIYVAFCKDNGPDKAPSPCGGGADTSGSTGGSVWVSSNPP
FT                   PYGKSLVVPYGPGGSFEVTINVSPKISDEVDCTKTKCVVATRADHTRSGDRTQDVRIPI
FT                   AFDEGGLPVPLIAGGAAAVAVIAVAGGALLIRRRSRAAAAAPADGGAGGDR"
FT   sig_peptide     78528..78605
FT                   /locus_tag="Tcur_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.953 at
FT                   residue 26"
FT   gene            79223..80230
FT                   /locus_tag="Tcur_0075"
FT   CDS_pept        79223..80230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0075"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   spe:Spro_2167 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95683"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH3"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACY95683.1"
FT                   /translation="MALALLAGLGLSGCAAGTAPAAGGGQDPAAGCGPSSMKVSYEPDP
FT                   IEPAPTPKLPVTVKSADGRKVTVRSADRILAVNMYGSIAEIVFSLGLGDRLVGRDASTT
FT                   FAAARDLPLVTVNGHDLSAEAILRLNPTVVLTDAGIGPAEVLDQLRASGIPVVLIGDEQ
FT                   TLPAVGEHITEVAAALGVPEAGQKLKKRVDEEIESARKQAPSGGEPLRVAFLYLRGTAG
FT                   VYLIGGRGAGSDALIEAIGAVDAGSAAGLTEFRPLTSEGMINAAPDVILVLTAGLKSVG
FT                   GVDGLVKLPGIAQTPAGRNRRIVDADDGTLLTFGTRTGKTIKALADAVYRPCES"
FT   sig_peptide     79223..79294
FT                   /locus_tag="Tcur_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.795 at
FT                   residue 24"
FT   gene            80230..81588
FT                   /locus_tag="Tcur_0076"
FT   CDS_pept        80230..81588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0076"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   smt:Smal_1942 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95684"
FT                   /db_xref="GOA:D1ADH4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY95684.1"
FT                   /translation="MSRPSTMPGPAEGADATGEPAAKPSVRAVDGAGPAGALQNSGPRT
FT                   PERAMSGVSGGPVADASGRAVGGEVVNGVEPGRLSKGTVAPAAGPATEKGGRAQQAQVA
FT                   AAKGGVLRGGLLIAVLAVALGAMIVVAASLGQVNIPPAEVLGSIAHRLGLDIGPLPSGP
FT                   QAENALWVVRFPRVALAAVTGAALACSGAVMQGVFGNPLAEPGVIGVSWGAAVGAATVI
FT                   VFGLNALGNWTVVLAAFAAGMLTTLLVYAMSRQGGRTEVVTLLLTGIAVNAIATAALGL
FT                   LMFISSSDALRSITSWQLGSLASATWPAVATVAPCALAGIAVSCACARSLDVLALGERV
FT                   ARQLGVDVERLRFTGIVIIALTTSAAVAFSGIIAFVGLVVPHLIRMAIGPGHRTLIPAS
FT                   ALGGAVLVVTADLVARTSIPYQELPLGVLTSLVGGPFFFWLLRRTRSKSGGWG"
FT   gene            81585..82403
FT                   /locus_tag="Tcur_0077"
FT   CDS_pept        81585..82403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0077"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sml:Smlt2357 putative ABC transport protein,
FT                   ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95685"
FT                   /db_xref="GOA:D1ADH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY95685.1"
FT                   /translation="MIALRRRPRLPEPAAPGTVALSARGLAVRREGRTVLSGIDLEVRH
FT                   GEMLLLVGPNGAGKSTLLGALCGDIRPAEGRVTIAGRPLESWTARELAMRRAMLPQHHA
FT                   VAFSFTVADIVRMGRSPWVGTPLEEEDEEAVQQAMREADIDAFADRPFTALSGGEQARA
FT                   ALARVLAQRTATLLLDEPTAALDIRHQELVFTVLTAQAAAGRAVVAVVHDLDLAATYAD
FT                   RVAVLSGGAVVACGPPAQVLTAPLLSEVYRHRIEVLPHPRTARPVILPER"
FT   gene            82445..82762
FT                   /locus_tag="Tcur_0078"
FT   CDS_pept        82445..82762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95686"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95686.1"
FT                   /translation="MEQEPFTPDVVEAIARHMNDDHAEDSVLIVRALGGQPEATAAVLT
FT                   GLDADGVDFSVEVEGRTVPVRIPWSRRLTERSQVRVEVVRMYDEARKALGLPPREQNRS
FT                   H"
FT   gene            83153..83824
FT                   /locus_tag="Tcur_0079"
FT   CDS_pept        83153..83824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0079"
FT                   /product="Heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="PFAM: Haem oxygenase-like; KEGG: heme oxygenase
FT                   2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95687"
FT                   /db_xref="GOA:D1ADH7"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH7"
FT                   /inference="protein motif:PRIAM:1.14.99.3"
FT                   /protein_id="ACY95687.1"
FT                   /translation="MGEARPESTLERFSIRLRAATRTDHSDNEHSAYMSALLDGRLARE
FT                   QYAALVGQLYFVYDLLEQAADRMRRDAVAASFDLPGLRRREALKADLEFYYGPDWAERV
FT                   QANDATRRYCDRLREVCFDWPGGFVAHHYTRYLGDLSGGQAIATLVTRTYGLSDDDGVR
FT                   FYRFAEKPKHLKDRYRQLLDEAPWDEPERARIIEEVKVAYRLNAELTARLAHDLRIDPA
FT                   A"
FT   gene            83961..85175
FT                   /locus_tag="Tcur_0080"
FT   CDS_pept        83961..85175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0080"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   afw:Anae109_1425 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95688"
FT                   /db_xref="GOA:D1ADH8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY95688.1"
FT                   /translation="MHVLRLCPVFEPPATALLGRGARFAPIGGMHSHTAQLTRALDELG
FT                   VRQTVVTTRPPTAPAVARLGRHCRVVRLGASGPLSRHCYGPAAWRRAPTLVRGVDLVHA
FT                   HLGEDPVVMPLALRTAACAGAPLVVTVHHSLQHTLRVSGPRSLLLKTVGGALERRLLEH
FT                   ADAVITLTERLHDLLPGDAVHVIPSGLGPEFTARSPARTWRMPDGDAVRPRLGYVGRLQ
FT                   AHKSVDVLLRAFALLGGDGGRLLIVGDGPQRPRLRRLAGRLGIAERVTFLGALSHDQIP
FT                   AVLRTLDAVVLPSRCEEFGSILPEAMHCGVPVVATQVGGIPELIEHGRSGLLVPPGSPA
FT                   RLADALRRLLGDPGLAAAMAGRARRRVRGHTWDRLARRVLKVYQSVLTTPAPQPLPASK
FT                   VVPIK"
FT   gene            complement(85204..85515)
FT                   /locus_tag="Tcur_0081"
FT   CDS_pept        complement(85204..85515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0081"
FT                   /product="transcriptional regulator, MarR/EmrR family
FT                   protein"
FT                   /note="KEGG: ccs:CCNA_03498 transcriptional regulator,
FT                   MarR/EmrR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95689"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH9"
FT                   /inference="similar to AA sequence:KEGG:CCNA_03498"
FT                   /protein_id="ACY95689.1"
FT                   /translation="MNHPRHRLDEVIHAPVRFAVMATLAAADRAEFAFVRDTVEITDSA
FT                   LSKQVSTLEKAGYVKVTKGYVGKRPRTWLSLTPAGRSAFASHCAALREIVDSALSPPA"
FT   gene            complement(85512..85931)
FT                   /locus_tag="Tcur_0082"
FT   CDS_pept        complement(85512..85931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_0789 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95690"
FT                   /db_xref="GOA:D1ADI0"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95690.1"
FT                   /translation="MVMPNIDAEAAGAALTRAETLQRRVRRRSRWYVRYLQIYGAGAFV
FT                   ATLLLGLGPRGVAASVAVWGAVVAALSAYAVRQPVSRHGFARRHAMIIASWAVLYAAVL
FT                   MPGVLWFEGELLWWLPGAVVVSLPAFLGARLEGRR"
FT   gene            86262..86744
FT                   /locus_tag="Tcur_0083"
FT   CDS_pept        86262..86744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0083"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; KEGG: dps:DP1776
FT                   potassium efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95691"
FT                   /db_xref="GOA:D1ADI1"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI1"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ACY95691.1"
FT                   /translation="MDVERTALPGIGLQHVFTTRRGRQIGVVSHRNGQRDLAVYDKEDP
FT                   DTCVVMVKLTPEEANVLAELLGTERVVERLAELHRQVEGLVTEQIPITAGSPYDGRTLG
FT                   STQARSRTGASIVAVVRDAQVIVSPRPDFVFAAGDKVVVVGTGEGTAAVARIFSDG"
FT   gene            86748..88058
FT                   /locus_tag="Tcur_0084"
FT   CDS_pept        86748..88058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0084"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: bba:Bd2084
FT                   cation:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95692"
FT                   /db_xref="GOA:D1ADI2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI2"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACY95692.1"
FT                   /translation="MHSVAVQLIELGAIILALGLLGSIAVRFSISAIPLYLIAGLAFGS
FT                   GGILPLTDSEEFVSLGAEVGVILLLFTLGLEYSADELVGTLRTSAPVGLADLVLNAAPG
FT                   VIVALLMGWGPVAALALGGVTYVTSSGITAKVMGDLGWLGNRETPAVLSVLVFEDLTMA
FT                   VYLPILTTVLVGAGLAAGAQSLAIAAVTVAVILFIALRYGTAVERFVASPNDEVLLLKV
FT                   LGLTVLVAGLAQQLQVSAAVGAFLVGIALSGPLAHTAREIITPLKDLFAAVFFVFFGLH
FT                   TDPATLPPVLGVAALLAVLGIATKLGTGWLAARRAGVGLKGRLRAGVSLAPRGEFNIVI
FT                   AGLAVSGGVDPRLGALAAAYVLILAIASPLLARLAEPLARKIEGRGKPQAQIDEDLPPE
FT                   IPVPAPALDDAAGKAASGTESGDEEPRDDVKEAKEVT"
FT   gene            complement(88301..88573)
FT                   /locus_tag="Tcur_0085"
FT   CDS_pept        complement(88301..88573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0085"
FT                   /product="Putative regulatory ligand-binding protein
FT                   related to C-terminal domains of K+ channels-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95693"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI3"
FT                   /inference="protein motif:COG:COG0490"
FT                   /protein_id="ACY95693.1"
FT                   /translation="MHTIPGTGTVHHYETRRGHRLGVLIDHEGHRTLMIYNGEDPDSPR
FT                   HTIELDRDEADQLAQLLQDPPIVDRVTELERRLAALEKRLTSQRR"
FT   gene            complement(88588..90105)
FT                   /locus_tag="Tcur_0086"
FT   CDS_pept        complement(88588..90105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0086"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-C domain
FT                   protein; KEGG: afw:Anae109_0927 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95694"
FT                   /db_xref="GOA:D1ADI4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI4"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACY95694.1"
FT                   /translation="MTLQQLYQVLLAGGVVLLVSLAAARAAARIGLPSLLLFLALGVLL
FT                   GEDVLGVQFDDVQLAQTLCTLALAVILVEGGLTTRWSDLRGLLTPSGVLATVGVAVSVL
FT                   VTAAGAHLLLGMEWRLALLLGAVVSSTDAAAVFAVLRSLPLPRRLSGIVEAESGFNDAP
FT                   TVILVTVFSTTGALPSPPGVLAQVTYQLVAGMVIGLLAGWAGTTALRQVALPASGLYPL
FT                   ATAGVGIVAFAAAGVAGASGFMAAYLCGIVLGNAVLPHRAAIRSFAEGAAWLAQIGLFI
FT                   LLGLLVDPSELPGALLPALVVGSVLLLVARPISVAVCLIPLKVPWREQAFISWAGLRGA
FT                   VPIVLTIFPIVADVPGSRELLNIVFVLVVVFTLVQGPTLPAMARHLGVTRADQARELQV
FT                   EAAPLDLLGAELLTVTVPKGSRLHGVEIAELRLPAPSAITLIVRDGGTLVPTDTTPLLE
FT                   GDELLIVTTSATREATERRLRAVGRKGRLAHWYGEYGDPDPAPTSPT"
FT   sig_peptide     complement(90025..90105)
FT                   /locus_tag="Tcur_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.680 at
FT                   residue 27"
FT   gene            complement(90503..90913)
FT                   /locus_tag="Tcur_0087"
FT   CDS_pept        complement(90503..90913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0087"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95695"
FT                   /db_xref="GOA:D1ADI5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI5"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACY95695.1"
FT                   /translation="MAAEAFLADTSAFHRLDGIPAIARNWEDQLRAGLVSVCPVTEIEI
FT                   FYSARSSRDYERVSARLREVFGWVPVPERAFQRALEVQEAMLAQGTHRSAGLADLLLAA
FT                   TAEEYRLTVLHDDKDFDCIAAVTGQPVRRVLD"
FT   gene            complement(90847..91113)
FT                   /locus_tag="Tcur_0088"
FT   CDS_pept        complement(90847..91113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95696"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95696.1"
FT                   /translation="MTRMNIDIDEEALAELMELLETDDRDKAVNLAVQATAVRVRLAKP
FT                   AQRELAELFASGALDLEALEQPWRQRHSSRTPAHSTDSTESLP"
FT   gene            91255..91866
FT                   /locus_tag="Tcur_0089"
FT   CDS_pept        91255..91866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0089"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG:
FT                   ret:RHE_CH00249 TenA family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95697"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI7"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ACY95697.1"
FT                   /translation="MSLAAHLEEIGRPLVEEQLKHPTVQGIAKGDLDERVFRSWLEQDY
FT                   LFLLDYVRVFARLAWQAPDGHLGDLVDLAHATFHEELSLHRTLAAEFGADLEGARKGPA
FT                   CAAYTSFLLESAASYGEGLAALYPCMWGYATLGGILAADPPAEPRYKRWVDTYADPGFA
FT                   ALGRRIAEMIDEAAPDPERAERKFLEGMRHELAFWDVPLP"
FT   gene            complement(91874..94168)
FT                   /locus_tag="Tcur_0090"
FT   CDS_pept        complement(91874..94168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0090"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: acp:A2cp1_3653 heavy metal
FT                   translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95698"
FT                   /db_xref="GOA:D1ADI8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI8"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACY95698.1"
FT                   /translation="MTTGAASERIELEIGGMTCASCANRIERKLNKLPGVSATVNYATE
FT                   KATISAPGDITVEELIAVVEKAGYTAALPEPPAEPERPAEPDELRPLRQRLITAIALSV
FT                   PVIAMAMIPALQFRYWQWLSLTLAAPVVVYAGWPFHRAALINLRHGTATMDTLISMGTL
FT                   AAFGWSLWALFFGEAGMPGLRHDFTLALTRGDGAMAIYLETAAGVTMFILAGRYFEARA
FT                   KRRAGAALRALLELGAKDVTVLRGERTERIPVERLKVGDAFLVRPGEKIATDGEVIEGS
FT                   SAVDVSMLTGESVPVEVGPGDAVTGATVNVGGRLVVRATRVGADTRLAQIARLVQQAQS
FT                   GKARVQRLADRISGVFVPVVIALALATLIYWLAAGAGATAAFTAAVAVLIIACPCALGL
FT                   ATPTALMVGTGRGAQLGILIKGPEVLESTRAIDTVVLDKTGTVTTGKMALVEVIPADGV
FT                   DAGQALRLAGALESASEHPIARAIAAGAAERTGALPKVTEFGNVAGLGVQGVVDGHAVV
FT                   VGRPRLLAEWSLALPAELEQAMAEAQARGRTAVAVGWDGAARAVLTVADQIKPTSAEAV
FT                   ARLRELGLRPVLLTGDNEPAARAVAEAVGIDEVIAEVLPAGKVEVVKRLQAQGRTVAMV
FT                   GDGVNDAAALAQADLGLAMGTGTDAAIEAGDLTLVRGDLRAAADAIRLSRRTLATIKGN
FT                   LFWAFAYNVAALPLAAAGLLSPMIAGAAMAFSSVFVVGNSLRLRRFRPLSGTAGHAAAP
FT                   APAARKTPVAP"
FT   gene            complement(94251..94457)
FT                   /locus_tag="Tcur_0091"
FT   CDS_pept        complement(94251..94457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0091"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: sfu:Sfum_3224 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95699"
FT                   /db_xref="GOA:D1ADI9"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI9"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACY95699.1"
FT                   /translation="MITSTYTVTGMTCGHCVASVKEEVGQVPGVTGVEVDLDSGRMTVT
FT                   SDGPLEAARIREAVAEAGYQLKD"
FT   gene            complement(95108..95434)
FT                   /locus_tag="Tcur_0092"
FT   CDS_pept        complement(95108..95434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95700"
FT                   /db_xref="GOA:D1ADJ0"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95700.1"
FT                   /translation="MSPSSAAQTRLTIEVRSTPQGSATTWTLTCDPAGGTHPKADAACQ
FT                   ALEKATDPFKPVPKDALCTQIHGGDQVATVTGTWRGASVNARFNRLNGCEIQRWEEVAA
FT                   LFAG"
FT   gene            95844..96182
FT                   /locus_tag="Tcur_0093"
FT   CDS_pept        95844..96182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0093"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: bmj:BMULJ_05212
FT                   hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95701"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ1"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACY95701.1"
FT                   /translation="MMFFGEDVPAVAVTDVPQDAYLLDVREQDEWEAGHIPTAVHIPMG
FT                   ELSDRAAEIPRDRDVYVICRSGVRSAQVTVALNNAGWRARNIDGGMKEWAGAGLAMVAE
FT                   SGAAPRVI"
FT   gene            96461..98326
FT                   /locus_tag="Tcur_0094"
FT   CDS_pept        96461..98326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0094"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: gur:Gura_1221 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; GAF domain
FT                   protein; PAS fold-3 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95702"
FT                   /db_xref="GOA:D1ADJ2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACY95702.1"
FT                   /translation="MTDVGQAPGGQDAIVRAVIECAADAIVAIDPRFRVTLWNPAAERL
FT                   FGWSAAEVLGQLPPIIPDELRAEQNAVLERVREGGQLSVATRRLRRDGQLIDVRIDTSP
FT                   LHDADGRLLGWMGVYHPVAETDAAQHQLAERARLVRRLNDVVADLNAERDLPAVLDRIT
FT                   TALVELTGADAGGFVQIKGRSLELVSVQGLPERLRGTVTELDSSLVDELLRSGKPVLLA
FT                   GARRVDEAIRAHLPGLHTVALGLSYLQNRPYGALYALFSGRKAGDTELELLELLAGHAG
FT                   VAVGNAVAYADAVRQQAHERAVIDSSADGIVVLDAAGIVRQWNPAAARLTGLPAEQVIG
FT                   RPPPLQIPEPGCTLTVRLESGTWVNMLCSQVEETGELVVDLRDVTEAKALEEAKDLFLA
FT                   TAGHELRTPITVVQGFASTLVSRWDKLGDAERRAAVETIAERARALARLVEHLLLGSRA
FT                   GTGELKVTIEHFDLGRLLEASVAGFRSLSDLHRVELEVAPDLPKVAGDWMATDIILGQL
FT                   LENAFKYSPDGGTVTVRAWAEGDELVVTVADRGVGIAPGDHERIFERFFQGDSGDRRRF
FT                   GGIGLGLYIVKRLAQAQRGDVAAHSRPGGGTVMRLTLPAAHASGD"
FT   gene            98619..99143
FT                   /locus_tag="Tcur_0095"
FT   CDS_pept        98619..99143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0095"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: mch:Mchl_3604 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95703"
FT                   /db_xref="GOA:D1ADJ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY95703.1"
FT                   /translation="MRASSVVLLPHAPSSVAIARRRLSSELRALGVRPGAVDDAVVILS
FT                   ELLSNALRHARPLESGQIRVRWECNGDDIEVSVSDGGAMTEPRRGRPTLSSLGGRGLGI
FT                   VEALAECWGVHHDGDCTTVWAVVHVPQKTEDGDSAPGMAHAAAFAEEFAEDIAELQRTS
FT                   SGVDGSRHGLH"
FT   gene            complement(99417..100610)
FT                   /locus_tag="Tcur_0096"
FT   CDS_pept        complement(99417..100610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0096"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: oan:Oant_4646
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95704"
FT                   /db_xref="GOA:D1ADJ4"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ4"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ACY95704.1"
FT                   /translation="MTPSYRVDSEVGRLRTVLLHRPGAELKRLTPRNNDKLLFDGIPWV
FT                   GRAQEEHDAFAEALRERGVEVLYLTELLQDVLEYADAREQAITAAVADPRLGDRLRENV
FT                   REYLSDLDPEQLAHTLIAGLAHEELKSAHGLVYRLMDPQDFIIDPLPNLLFTRDSSTWI
FT                   GPRVAVTSLAMPARRRETSLTGLIYDFHPRFRGIETIYDPRLEPLEGGDVLLPAPGVIA
FT                   VGTGERTTPAGVERLARRVLSTGAAHTVLAVPIAQERATMHLDTVCTMVDVDTVVMYPP
FT                   VAHSLTAYTITWDDGELLISEERPFLEAAAAAMGVERLRVIDTGLDPVTAEREQWDDGN
FT                   NTLAVAPRVAVAYERNVETNARLEAAGIEVIRISGSELGSGRGGPRCMSCPLLRDPL"
FT   gene            100772..102361
FT                   /locus_tag="Tcur_0097"
FT   CDS_pept        100772..102361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0097"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   GK10816 gene product from transcript GK10816- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95705"
FT                   /db_xref="GOA:D1ADJ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95705.1"
FT                   /translation="MLRVVRRPSAHTVHLGAATLLRISAEGLGTALVLVVQARTGQAAT
FT                   AGFLQAAIMLPYVLAGPITGHTLDRTARPRAFALTMTACYLLAAAFLLLTAGRVPLLLA
FT                   LAFAVAIGCTEPVVVAFTGLLPRFVPAHRLTWAYGLEAATYNIAAIAGPGLAAGLTAAL
FT                   GAGYAGAAVVGCATLGMTLLPLLSVPPPGHRPAPARRPEETGERPAAELAPAVGPDTAG
FT                   TRSQDAGRRAAGEHSEQPAAAIGRGGATARPEPAEAREEGRPAGSAGPGGAACHAVTAE
FT                   AQGSGGPSAGNAGPGEAETPRDERVGAALSKEPAPEMKKDVPALKGRAPALDVIAGGIV
FT                   VLLGNPVLRAVTVATTLAFLGMGAVAVTAVLFAEHIGRSAGVGGQLIAAFAAGSLIGSL
FT                   GSARWLSARRAEWVLMAGMAAFGTALAVTVWAPSLPWALAGFLLAGICDGPVFAATLTV
FT                   RQREAPADRLGQVNTTGGSLKIGSAAVGAALAGALAGSLGGPGLLLGMAAFQFTGAACG
FT                   VLLLLLARRRGE"
FT   gene            102454..103356
FT                   /locus_tag="Tcur_0098"
FT   CDS_pept        102454..103356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0098"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B2739 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95706"
FT                   /db_xref="GOA:D1ADJ6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95706.1"
FT                   /translation="MSALLDGKVAIVTGAGRGIGRGEALELARQGAAVVVNEFDAEAGK
FT                   AVVDEITAMGGQAALHVGDVSEIDDAKALIDTAVETFGGLDALVNNAGILRDRTLVKMT
FT                   PEEWDAVIKVHLRGHYAPTHFACEYWKNNGRPGRIVCTASSSGLLGNFGQSNYGAAKAG
FT                   IAAFSTIVALEMARYGVTCNAIAPAARTRMTEGAYGKIEGGDGGGFDFWHPDNVAPFVA
FT                   FLCSDQAGSISGKVFGVQGDAVELYRPYESAAVIENGGARWDPADFADRVGELFETSGI
FT                   KPEIENPMRRLRYSMTKRA"
FT   gene            complement(103411..104265)
FT                   /locus_tag="Tcur_0099"
FT   CDS_pept        complement(103411..104265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0099"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95707"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ7"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACY95707.1"
FT                   /translation="MAADESIPQIRTDVPASARMYGWALGGKDNYEIDRQFVLEGAKLF
FT                   PEGINMARENRLFLYRVVRYLAAEAGIRQFIDLGCGLPTDNNTHQVAQKHAPDARVVYV
FT                   DIDPIVLAHARALLAGDGSTVVITADMRDPEAILEHPDTKRLIDFSEPLAVLYLSVGHH
FT                   LLDADNPRTVLHGVIDRAVPGSHLAFTQVVSDDPDARAKSNEQMKKSGVPWQTRSPEEV
FT                   DALLLGGGLEPVEPGLLDINDWRPDPNQPPLPPVPKELEPFVKTATLRRTVYEYGGLLI
FT                   KTG"
FT   gene            complement(104512..104706)
FT                   /locus_tag="Tcur_0100"
FT   CDS_pept        complement(104512..104706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95708"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95708.1"
FT                   /translation="MTFNQAARKYAPDARDVRLDTHAPAVLRSVIHRAASKELKPFEGA
FT                   SKRRQDPFERGPPKKVAAA"
FT   gene            complement(105736..106593)
FT                   /locus_tag="Tcur_0101"
FT   CDS_pept        complement(105736..106593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0101"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95709"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADJ9"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACY95709.1"
FT                   /translation="MDADGPVPTDIPTDVPTSARIYNWALGGKDNFEIDRQFALQNIHY
FT                   SPEIVDAARENRLFLYRVVRYLAAEAGIRQFIDLGCGLPTENNVHQVAQQFVSDARVLY
FT                   VDIDPIVLAHARALLAGDGSTVVITADMRDPEAILEHPDAKRLIDFSEPLAVLYLSVGH
FT                   HIKDEDDPHRVLYTIIDRAVPGSYLAFTQVVSTDPPERRAELDAIANAGGVPWQTRSPE
FT                   EVDALLLGHGLEPVEPGLVDINNWRPDPDQPPLAPVPPELKPYEGASKLRKERFEYGGL
FT                   LKKP"
FT   gene            complement(106846..108408)
FT                   /locus_tag="Tcur_0102"
FT   CDS_pept        complement(106846..108408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0102"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ccs:CCNA_01017 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95710"
FT                   /db_xref="GOA:D1ADK0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY95710.1"
FT                   /translation="MQPLTDVLRERAQATPDKIAFYYGDREITYREFDERVDRAATALH
FT                   AAGVGPGDRVAILDKNSIEYVEQLFAAARLGAVQVPVNYRLAPPEVAYIVNDARAKVFI
FT                   VGPEFTELLDAVAGDLEHTTHLVVIGGEHTAAPRLDYAEWVASHEPAPPAHQAATSDVF
FT                   VQLYSSGTTGRPKGVMLTHDNFLSILPSTAELWELDEHTRMMIAMPMYHIAGNALSVAV
FT                   VFDGITGVICREPDPVGIAREIERRQVTHLFLVPVLLLFWQSIPEVAECDLSSLRVLLY
FT                   GASPISQEVLRGAMKLLPGTKFFQVYGLTETTGAVTALPPEDHDPDGPNAHRLASAGVP
FT                   NEGTEIKIVDPSTLEELPTGQVGEIWVRSPQNMLGYWNMPEATASALPGDGWFRTGDAG
FT                   YLDADGYLYIHDRVKDMIISGGENIYPAEVENVLMSHPKVADCAVIGVPSDKWGETPKA
FT                   IVVKAGEVTEQEIIDYCRERLAHFKCPTSVDFIDVIPRNPTGKVLKRELRKPYWEGHER
FT                   AVH"
FT   gene            complement(108502..108696)
FT                   /locus_tag="Tcur_0103"
FT   CDS_pept        complement(108502..108696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95711"
FT                   /db_xref="GOA:D1ADK1"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95711.1"
FT                   /translation="MPPAGPGHSVEDMSKTVLKIAGILLAAWLIFSVLGAILSTVKFFL
FT                   LVGLIAAVVMLVVTLITKR"
FT   gene            complement(109118..109822)
FT                   /locus_tag="Tcur_0104"
FT   CDS_pept        complement(109118..109822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0104"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: hch:HCH_02036 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95712"
FT                   /db_xref="GOA:D1ADK2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK2"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACY95712.1"
FT                   /translation="MRKPLSIAVAQPPCVSYDVAANAATHADVVRSAGARVVVFPEMSL
FT                   TGYELDAPAITAGDPRLAPLVRACARTGTVALAGAPVRGESGAAHIAILAFEGTGARVA
FT                   YRKMWLGAAEAERFAPGGEPAVLEVDGRRLGLAICKDTGIVRHSADTAALGMDVYVAGV
FT                   LEHAKDAAVRDERARRIAADHRVWVAVASFAGSTGGGFTRAAGGSGIWAPGGAVLAQAG
FT                   TEAGAVVRAVLE"
FT   gene            complement(109964..111220)
FT                   /locus_tag="Tcur_0105"
FT   CDS_pept        complement(109964..111220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95713"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="InterPro:IPR037473"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95713.1"
FT                   /translation="MKTPSRRNVLAAGGALGAAGALGIATPAQARPVWTWSPEGSVLGT
FT                   GTGADPRGVWDEEADQLVADIIQRGDVQKVNKELRKWLKNGQPLPSGLPKDLKDFIEKA
FT                   KQLPPWADKNKLATAFHFNEKRGLYLGVTYGFVSGMMSTVIPREARAVYYSWGGANLRD
FT                   RITKTAKLGYDIGTANAYEPDGELIVTCIKTRLAHAGVRHLLPKSPYWNKVAEEEIPIS
FT                   QADMMVTWHSLPTSVMRQLKTWKVPIPDNEAEAFLHSWQLCAYMLGIKEEYIPNSWDQA
FT                   ESQARQVLDPILGPTPEGIKLADMLLNIGTLVPGGPLKYVTRPILGSLTRYTLGDQIAD
FT                   WLKIRRDPFWDNVFNTLWEPFIAVREGLLSLEKAPGALSKFYWTFDEILRLGVLTVLSG
FT                   AQFPISIEIPYSNNPNYPS"
FT   sig_peptide     complement(111128..111220)
FT                   /locus_tag="Tcur_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            111433..112116
FT                   /locus_tag="Tcur_0106"
FT   CDS_pept        111433..112116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0106"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_2686
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95714"
FT                   /db_xref="GOA:D1ADK4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95714.1"
FT                   /translation="MEPTLSFLMTTSGDESLIERAYTDAVEQNDDMDETSARILDAAYE
FT                   QFCRMGIQRSTMEDVARRAGVSRITVYRRFATKDALVEQVVRREFRRYFDQFLIDIQQA
FT                   ETAADRVVLGFVSSLRAIRRNPLIGGLIETEPDLVVPSMISDGGRTLAVVRQFVAGQLR
FT                   REQQAGNVSPDLDTDLVAEMMVRISASFLGIPSFIVDLDDEEQLADIARRFLVPMLQPP
FT                   APRES"
FT   gene            complement(112133..113692)
FT                   /locus_tag="Tcur_0107"
FT   CDS_pept        complement(112133..113692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0107"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: dia:Dtpsy_2811 thiamine pyrophosphate
FT                   protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95715"
FT                   /db_xref="GOA:D1ADK5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK5"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACY95715.1"
FT                   /translation="MNGAQALLHTLVNADVQVCFSNPGTSEMHLVAALDTVPRMRGVLC
FT                   LFEGVATGAADGYGRMASAPAAVLLHLGPGLANGLANLHNARRAGTPILNIVGDHATYH
FT                   QRYDAPLESDIHALAGSVSGWIRRSARSRDVPADAAEAVAAALTPPGQVATLILPADVC
FT                   WSEGAQPATPVRSRPASPVHDSVVESAAAVLKSGEPCALLLGGGATRRHGLEAAGRIAA
FT                   ATGAKLLCETFPARLERGAGLPAVERLAYLGEMAAAQMTGLRHLILAGAKRPVSFFAYP
FT                   NQPSDLVPEGCQVHVLAGDGDDAAGALAHLADLVAGGVAPPVQQPSRPEPPSGPLTAEK
FT                   AAAVIGALLPEDAIVSDESNTSGLWLAGATAGAPPHDWLTLTGGAIGQGMPLATGAAIA
FT                   CPSRPVVCLEADGSAMYTLSALWTQAREGLDVTTVIFNNGSYAVLNMELARVGADPNSA
FT                   GEAARSMFDLSRPDLDFVSLAQGMGVPAGRARTAEELAAQFGKALSEPGPHLIEAVVPS
FT                   VF"
FT   gene            complement(113710..115083)
FT                   /locus_tag="Tcur_0108"
FT   CDS_pept        complement(113710..115083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0108"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dol:Dole_0002 FAD linked oxidase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95716"
FT                   /db_xref="GOA:D1ADK6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADK6"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACY95716.1"
FT                   /translation="MADVGSALADVVGAEHVLSGEEISADYGGDEALGVAPQPPAFVVR
FT                   PETTEQVAGVLRVAGEHGLAVTPRGSGTGLSGGAVPVPGGLVLSLERMNRVLEIDTANH
FT                   VAVVQAGVTLGELDRLTAEAGLIYPVFPGESSASIGGTVSTNAGGMHAVKYGVTRHQVL
FT                   GLEAVLAGGEVIRTGGRYVKTSTGYDLTQLIVGSEGTLAVVTEATLRLRPRAAHQASVL
FT                   APFSSLREVTAAVPKLVGSGLDPLILEYVDMLAMAAITANADVDLGVPEQVRQTTQAYL
FT                   IVTLENRSAERLEADIEALGGLLTELGAADVYVLESNAARELITAREKAFWAAKSAGAD
FT                   AIVDAVIPRADLADFFEAVGGIGERRGTLIVGCGHAGDGNVHLSVFQPDPEKLTAVLRE
FT                   IFTEAMGRGGAISGEHGIGREKRPYFLDLEDPVKLRLMRQIKQVFDPQGILNPGVLFD"
FT   gene            complement(115710..115976)
FT                   /locus_tag="Tcur_0109"
FT   CDS_pept        complement(115710..115976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95717"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95717.1"
FT                   /translation="MRKSLAAAALAAFALGGALSAASAAAAAEHGAAAVEQAGQQACRG
FT                   ECGRNYGPWDDFGYWYGPQYNDSYHDNWYGHEDAHSPQYGFQR"
FT   sig_peptide     complement(115896..115976)
FT                   /locus_tag="Tcur_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.501 at
FT                   residue 27"
FT   gene            complement(116211..116879)
FT                   /locus_tag="Tcur_0110"
FT   CDS_pept        complement(116211..116879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0110"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   scl:sce5431 two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95718"
FT                   /db_xref="GOA:D1AEA2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY95718.1"
FT                   /translation="MIRVLLADDQRLVRAGFRSILADEDDIAVVGEAGDGEQTVEACRR
FT                   LRPDVVLMDIRMPGMDGLEATRRITADPRLENVRVVILTTFDLDDYVYAALRGGACGFL
FT                   VKDTEPQELIRAVRVAARGDALISPSVTRRLIAEFTGRVKAPAPDPRLNALTEREREVM
FT                   RLVAAGLSNDEIAGRLVLSPATAKTHVSRIMSKLGVRDRSQLVVLAYESGMVSPGWLSS
FT                   "
FT   gene            complement(116918..118036)
FT                   /locus_tag="Tcur_0111"
FT   CDS_pept        complement(116918..118036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0111"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: scl:sce5432 putative two-component system
FT                   sensor kinase; PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95719"
FT                   /db_xref="GOA:D1AEA3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA3"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACY95719.1"
FT                   /translation="MRLPQGRAADAAIAGGMFALMAVAGLRAFIGERLEPWPVTVAGWA
FT                   LTAAACGALYLRRRRPVAVAVFVLAVTIAYYLGSAYDGPLLVVFIVALYTVAAEGRLQA
FT                   AVALAALALICVGAGTLAGNDEVNGIALFMLAGWLVAVVALGQVRHGRLAYLQEVQRRA
FT                   AGEERLRIARELHDVVGHHLSLINVQSAAALHRIGKDPAQAKAALGAIKESSRTALRDL
FT                   RATLGVLRESGEQAPTAPAPGLARLEELIESARLAGLQVHAETGGEQRPLPTEVDLAAY
FT                   RIVQEALTNVTRHARAGAVTVRLDHGPGELTVEVTDDGRGPVPPAGPPGSGISGMRERA
FT                   RALGGELVAGPRPGGGFTVRARLPYRNGASAR"
FT   gene            118220..118474
FT                   /locus_tag="Tcur_0112"
FT   CDS_pept        118220..118474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95720"
FT                   /db_xref="GOA:D1AEA4"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95720.1"
FT                   /translation="MNTPFTSGRAASALVGLLVGGAAGFLLIETVGAVVTFVLGRTPGA
FT                   GGGGAPPAAFIAVPVLCALAGALIGARRAGRGSRPRDQR"
FT   sig_peptide     118220..118294
FT                   /locus_tag="Tcur_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.565 at
FT                   residue 25"
FT   gene            118481..120655
FT                   /locus_tag="Tcur_0113"
FT   CDS_pept        118481..120655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0113"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: MmpL efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95721"
FT                   /db_xref="GOA:D1AEA5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA5"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACY95721.1"
FT                   /translation="MSSTPQPTVASGPAAVRAAPGRFGELAAWSQRHRWSALLLWVLLV
FT                   AAITVAAQAAGGGYRNDFSLPGTDSQAAADLLNEHGSAQAGGALQIVFKGAGGLAADRA
FT                   GIERTLERVRALPGVAEVRSPFQDRAALSADGTIGYATVTLAGRPESVPKEHVAKIVDT
FT                   ARSAARDGLQVEVGGDAVRELAEEEGGGGAEGAGMMAALVVLVLLFGSLLAAALPLLTA
FT                   ALAVGGAVGLIALASHVFTVADFTPPIMMLVGLGVGVDYALLIFHRYRHELIGGADRDE
FT                   ATRIALEAAGRTVFFAGCTVIVALLGLVALGLGSLQGVALAVALTVLVTMAASLTLLPA
FT                   LLAVFGGRIQRLVLKRAAKAHAKGRVEGRGWRAIATAVQRRPLAALLVAVVALLALAAP
FT                   ALDMRLGFADAGTDSPESTSRRAYDLLAEGFGPGFNGPLIVVSAGEPAAAQELRAALAG
FT                   TPGVAATTPPLPARDGALSTVIVFPKTAPQDEGTAELVRTLRQDVLPPLAERTGARYLV
FT                   GGSTAAAQDFAESVAARMPLFVAIVVGLSALLLMAVFRSLLIPLKAALLNLLSIAASLG
FT                   VITFVFQDGRLGAQPGPIEAFIPVMIFAIVFGLSMDYEVFLLSRIHEEWRRTQDHSHAV
FT                   REGLTATGRVITAAAAIMIVVFAAFILSPSRMLQQFGLGLAVAILLDAVVIRCLIVPAA
FT                   MQLLGRRAWWLPSPLARRLPHLALERPDGA"
FT   gene            complement(120924..121310)
FT                   /locus_tag="Tcur_0114"
FT   CDS_pept        complement(120924..121310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95722"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95722.1"
FT                   /translation="MHVHQRLGHTGGDPHLVRLRERLEAIRTRSEKSTSWHSAGRYLSR
FT                   LVNREGYVPVNTHISREDLEFLTGARDEVIALTDLALRLLELHQPRDAGGISSDPTHLS
FT                   RRCRACMWRWPCPTFRIIDESAPR"
FT   gene            121500..121832
FT                   /locus_tag="Tcur_0115"
FT   CDS_pept        121500..121832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0115"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   sat:SYN_02356 anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95723"
FT                   /db_xref="GOA:D1AEA7"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA7"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ACY95723.1"
FT                   /translation="MELNVTTSSQGDYAVVTATGELDLYTAPRLQTALASLIRDRADRV
FT                   VVDLSGVEFCDSTGVNVLLAAMKRLQEQGGTLELAGLRPPVRRILQVTGLDSVFTIAEA
FT                   VPTRGV"
FT   gene            121852..122649
FT                   /locus_tag="Tcur_0116"
FT   CDS_pept        121852..122649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0116"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rsp:RSP_2150 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95724"
FT                   /db_xref="GOA:D1AEA8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACY95724.1"
FT                   /translation="MTGDARQARTTIGCMEPQQGSDGPPQAGDVAVIIPAKDESERIAA
FT                   TVKAALDLPGVDLVVVVDDGSCDATGRLAAEAGARVVRHSRNRGKAAAMESGAEAVKLL
FT                   DEGRAAPRHLLFLDADLAETAREAAPLIEPVRRGEADMTIATFTTTVKLGGHGFVVRLS
FT                   REGIRRATGWQATQPLNGQRCLTRAAFAAALPLAPGFGVETALTIDLLRAGFRVQEVKV
FT                   PLAHRATGTDWRSQLHRARQFRDVARALVARQPVLTRLAHRRR"
FT   gene            122811..124130
FT                   /pseudo
FT                   /locus_tag="Tcur_0117"
FT   gene            complement(124141..126387)
FT                   /locus_tag="Tcur_0118"
FT   CDS_pept        complement(124141..126387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95725"
FT                   /db_xref="GOA:D1AEA9"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95725.1"
FT                   /translation="MEVPGLAQRGRRLSGGRGGAVSLCALLTLVMAVALAFPAAAHAQV
FT                   NGRVAVIGIPGLRWSDVSEHGTPTLWRLTREGAAGALSVRTTRGNTCPADGWLTVSAGQ
FT                   RARFPHSECALAPTPLVSGSSASVRDWSRLVADNAATSYKAQLGLLGDAVHRAGGCTMA
FT                   VGPGAVLGAADASGRVDRYAPSPARVPAADWSGCALTMVEIDAVHRAHIRAGVDADGVP
FT                   IPVSRRSRAAAATAADRQLAAVLKALPDDATVLVAGLSDSGTTPHLHVALATGPGFGPA
FT                   LLTSAATRQDGLVTLTDLTATALGALGLPQPKQAIGSRWRAEPTDAPAAAKVHDLDDED
FT                   VAAQAIRRVQPAFFIVLFGGQLLLYGLATVALRRRWAGAPASAPALTRRRILAGTRVVA
FT                   LAGAAAPVASFLANLLPWWRSEHPLPLLICSVTAWMAALTALALAGPWRRSPVGGGLVI
FT                   AAVTALVLGVDVLTGSHLQLNALMGYTALVAGRFYGFGNQAFALFAVAALLSAAWLAER
FT                   PLRKGRRTAALAVVAALAVVAVAIDGWPGWGSDFGGVIAMVPAFAVLGLLVAGRRVSPL
FT                   WLAVYCLAGAALVLAISFLDARRAAPSHLGRFWDDLVSGQAGEVIARKAEAMLRSLGYW
FT                   PFTVAALGALCFLYFVLARPLRWRAALLQRAYRRGPALRPALMAALTLAIVGMLVNDSG
FT                   VVVPAVAFSLAVPLTLAASVRALELDEPDGGAPSPPPTAAAPSAAREPRPNAAP"
FT   sig_peptide     complement(126256..126387)
FT                   /locus_tag="Tcur_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.922 at
FT                   residue 44"
FT   gene            126522..127811
FT                   /locus_tag="Tcur_0119"
FT   CDS_pept        126522..127811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_5591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95726"
FT                   /db_xref="GOA:D1AEB0"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95726.1"
FT                   /translation="MGGRSGRTGGSAADLAILLAGVALAAAAIAPIAVHWLTNPPDQRL
FT                   VDLEVYRAGGEAVLRGASVYDMLTPPPQLLPFTYPPFAALLAAPLALLPWPVAQVVWVT
FT                   AIYLALGVAVWYSFRPLLVRAGRYAPLAAGALVGALAHLQPVHDQTRFGQVGVFLLVMC
FT                   VADCLSPAPRWPRGMLVGLATAIKLVPGVFLIYLLLTGRREAAWNAVLTAAAATLAAFA
FT                   LLPADSIDFWFDAVLNNDRVGANNATTNQSINGMLLRLYWPDAVTKALWLVCLALMAWI
FT                   GFRLARRASQAAARLDGASAYGLELAGIAITGLLSVLLSPVGWVHHLVWIVPVLGALVG
FT                   DGRDLRRCLVAAGVAVFFAFRIPWWGTRLIGEGHSALERFTGRVVQDAFGLAAIALVVL
FT                   LGHWLVNRVQGQSDRRVPSPDQPEVGTLTP"
FT   sig_peptide     126522..126599
FT                   /locus_tag="Tcur_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.785 at
FT                   residue 26"
FT   gene            127808..128263
FT                   /locus_tag="Tcur_0120"
FT   CDS_pept        127808..128263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95727"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95727.1"
FT                   /translation="MILVALAIAGMVSGVAGLTIAVVAHNRANQVVQECADMLRRHLQS
FT                   VNGPVDGQALRDLAVVHYDALKEMSGRRSFSLALINSLGDGVVLSSINGRTETRTYAKV
FT                   VRGGRSLEVLSPEEDQALRGARLGKGPVVSMDDPLPDFGGNTTSART"
FT   sig_peptide     127808..127882
FT                   /locus_tag="Tcur_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.534 at
FT                   residue 25"
FT   gene            128644..129561
FT                   /locus_tag="Tcur_0121"
FT   CDS_pept        128644..129561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0121"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95728"
FT                   /db_xref="GOA:D1AEB2"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB2"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACY95728.1"
FT                   /translation="MRYAYLGPQGTFTEAALHAVPEAKDAEHVPYSTVPAALDALRRGE
FT                   VDAAVVALENSVEGSVPTTLDELATGQPLQIVGEVQLPVSFALLVRPGTDFADIKTVAS
FT                   HPHAQPQCRRWLAAHIPDAEWRAATSNAEAAQMVADGHYDAALAGAFAAARYGLSVLAE
FT                   DIHDVPDAVTRFVVLRRPCPPPEPTGMDRTSVVAFIGEDHPGALLEILTEFAVRGINLT
FT                   LIQSRPTGTGLGSYRFWMDFEGHVAEKRVGEALMGLRRICADVRFLGSYMRADRIRPEI
FT                   RRGTHDADFIEAAAWLAGIRSGRL"
FT   gene            129751..131109
FT                   /locus_tag="Tcur_0122"
FT   CDS_pept        129751..131109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95729"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95729.1"
FT                   /translation="MRRLLIAPVAAAALVAGSPSVPGPLPGIAMAAADEVKPAVTKFTE
FT                   FQVTPTEVDAADGLVRFSGRLVHLDADGAERPVAGVPLLLSYGVPEEELVTDSDGRFAG
FT                   SVYVHHSSVSLHVRYQRTADSPYRNAVSPSVPVTVTGSAETRLSIRVTPGDKIFAQDTA
FT                   QVSGKAEWRRVTGQWLPLKGHTVRVMCGTDGQSVRTALDGTYAIPFTVRRRCNFYVHYP
FT                   SHEPQTLLSSTASARPTPEVHVRTRFADVEWPRAVERGKRILVTGYLYGNEDAGFSPVR
FT                   GARVRLEFSPDGRRWKHAGDSPVSEESHFELSALAPGKGYWRIRTLQVPSYCTSPGVLR
FT                   SALIPVKDRTRFTGFNASPEPVRKGAAITVKGTLQRRTPAGVWKAFGKRAVTIEFRPKG
FT                   SGTWRRLRTVKTNAKGRVLTRFKAVRDGYWRLSFAEAPLFFGSRSAADYVDVR"
FT   sig_peptide     129751..129846
FT                   /locus_tag="Tcur_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 32"
FT   gene            131385..132641
FT                   /locus_tag="Tcur_0123"
FT   CDS_pept        131385..132641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0123"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: afr:AFE_0380 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95730"
FT                   /db_xref="GOA:D1AEB4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB4"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACY95730.1"
FT                   /translation="MIDLRALREDPERLRASQRARGEDEAVVDRLIDLDERRRAALSQF
FT                   EKLRAEQKSFGKSVSKAKGEERQALLERAKELARQVKEAEAEADRLQEELNEVLRGVPN
FT                   IIEEGAPPGGEQDFVVLEHVGEPPTFDFEPRDHLELGELLGAIDTERGAKVSGARFYYL
FT                   TGVGARLQLALLNLAMEQAIEAGFFPMYPPVLVKPEAMEGTGFLGAHASEVYRLEADDL
FT                   YLVGTSEVPLAAYHMNEIIDDLPRRYVAWSSCFRREAGSYGKDTRGIIRVHQFDKVEMF
FT                   SYCTLEDSHAEHLRLLEWEKQMLAKVELPYRVIDVAAGDLGASAARKYDCEAWLPSQNT
FT                   YREVTSTSNCTDFQARRLAVRHRGEDGKPRPVATLNGTLATTRWIVAILENHQQADGSV
FT                   RVPKALQRHLGLEVLEPVR"
FT   gene            132794..133255
FT                   /locus_tag="Tcur_0124"
FT   CDS_pept        132794..133255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2888 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95731"
FT                   /db_xref="GOA:D1AEB5"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95731.1"
FT                   /translation="MERQEFTQGALPSPQEARAALEAVEQARESVKTTQWPMWYFVALG
FT                   VWVAPLGLLSRMPTDFPRVLVALVALMAWMGLFSAIVALGARKTGVVPSFSREQVVHIA
FT                   AILVPVAVIAALIGWKAGTDWALPSFSALEGAMIVLYALWVRHRSARSA"
FT   gene            133252..133566
FT                   /locus_tag="Tcur_0125"
FT   CDS_pept        133252..133566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0125"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: ccs:CCNA_03498
FT                   transcriptional regulator, MarR/EmrR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95732"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACY95732.1"
FT                   /translation="MTTAEKSIEGFNPVIHAPNRLRICALLSAADQAEFAFVQDKLGVS
FT                   ASVLSKHVSVLMDAGYVKQTRAVRDTRQRVWLSLTKEGRAAYKAHVAALQAIVSGELDA
FT                   "
FT   gene            134013..134870
FT                   /locus_tag="Tcur_0126"
FT   CDS_pept        134013..134870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0126"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: scl:sce2325 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95733"
FT                   /db_xref="GOA:D1AEB7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB7"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACY95733.1"
FT                   /translation="MYAGAGEDGLAERKAPPRLVATDLDGTLVRSDGTISARTVQALAR
FT                   VERAGSTLVMVTGRPPRWMRDAAAAVDHRGIAICANGAVLYDLHTETVLRTRLIEAEVV
FT                   DEVVRRLREAAPEFRFAVEYTDGFVYEASYDLGRWDLEALGGRPVGERELVSRGGIKLL
FT                   AFHPGADPDRLAEETRKAVGDLVTVTHSSGRGLMEMSAHGVTKASALAELCAERGVAAA
FT                   DVVAFGDMPNDLPMLTWAGTSYGVANGHPDVLSAVTHTIGRNDDDGVAKVLEQLFPATG
FT                   ADVR"
FT   gene            complement(135043..135606)
FT                   /locus_tag="Tcur_0127"
FT   CDS_pept        complement(135043..135606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95734"
FT                   /db_xref="GOA:D1AEB8"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95734.1"
FT                   /translation="MNEPRSNASEQNPQVLVVGPNGIAVEGGSNDSGEEERPVTEMVEQ
FT                   PAKVMRIGGMIRQLLEEVKSAPLDEASRARLKEIHASSIKEIKEGLAPELVEELERLSL
FT                   PFAEEEVPSEAELRIAQAQLVGWLEGLFHGIQTTLFAQQMAARAQLEQMRRALPAGALS
FT                   SGAAQSRGDEEHKHRSGHASGPYL"
FT   gene            136138..138135
FT                   /locus_tag="Tcur_0128"
FT   CDS_pept        136138..138135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0128"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: TP23; basic proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95735"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEB9"
FT                   /inference="protein motif:COG:COG0455"
FT                   /protein_id="ACY95735.1"
FT                   /translation="MAKNDPDRRSLEEQLASLDAMSREQGGSPSSEQGAPSAAPAEQAS
FT                   EFPANPWPASPPPLPAQPGPMGYAPPLPPDNGPPSFAPPPPPPPLTAFAPYGGEPAAQQ
FT                   PGDMPPEYGSGPHSAGDGQHQGAPPYAAPPAYADPSPQGEQAPADSPQAEAAPAHPQGY
FT                   PGQPIQDGQLPPHAYQSPPSPDGPPAPPFYPGLPLPDAASPGAPSQNQPFPGDPSAYQG
FT                   QAYQDAAASSGAPAAQDQSFSGDPSAYQGQPQQDAVSPMGTPAAQDQSFSGDPSAYQGQ
FT                   PQQDAASPAGAPQGQAFPDGSAAPGAPPAYQGRPYPGPPQPYPPAHYGSSAPQQGPPLA
FT                   PLPPLQEVPQRPPTAPPTSESLSAETLLRERKTAPSGGWRRMIFKATGGAIRPGESAAE
FT                   RRRRELIARARTPVVGGHHRVAVMSLKGGVGKTTTTVGLGATLASLRGDRVIAVDANPD
FT                   RGTLSDKVRLETDATVRDLLNERDQIQRYADVRAFTSQAPSRLEVLASDRDPAVSEAFS
FT                   AEDYRAVAEVLEQFYSICITDCGTGLLHSAMAGVLSLADQLVLVSSPSVDGARSASATL
FT                   DWLDAHGHGDLVRSGVVVLSMVRARSKSSVDLDKLQEHFESRCRAVVRVPYDDHLEEGA
FT                   EVDLDQLSPACQDAYLQLAAIVADGFAWPR"
FT   gene            138215..138303
FT                   /locus_tag="Tcur_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            138215..138303
FT                   /locus_tag="Tcur_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(138414..139451)
FT                   /locus_tag="Tcur_0129"
FT   CDS_pept        complement(138414..139451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0129"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce6257 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95736"
FT                   /db_xref="GOA:D1AEC0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95736.1"
FT                   /translation="MTELPGALIAGRYRLIAEIGRGGCGVVWRAHDERLRRDVAAKEPL
FT                   PPVRADPARLAERRRRTLREARSAARVAHPAAITVYDVAEHDGRPWLIMELINGRALSS
FT                   LVKRDGPLPPHRAARIGLQILGALQAAHAAGILHRDVKPANVLIGTLGGRDRAVLTDFG
FT                   IAARADEPVPAGSVPVLGAPSYTAPERARGEPAVPASDLWSLGATLFYAVEGHRPYPAA
FT                   GAGAARHAVLTCEPPYPVHAGPLAPVITGLMRRDAADRLTAAQTAALLHQAIAPARHAR
FT                   RPGPARAGRGAPAHTGRQALAKAAALIAGRSDAGREHPRAASGPVPRQALQPPARRRRR
FT                   TDGTT"
FT   gene            139734..141089
FT                   /locus_tag="Tcur_0130"
FT   CDS_pept        139734..141089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0130"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; KEGG: bba:Bd1322 putative sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95737"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC1"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACY95737.1"
FT                   /translation="MSAPTLTESDIRSGVLGLQELFFSTTDRRGVIRQGNSVFARVSGY
FT                   SLEELVGAPHNIVRHPDMPGGAFRLIWDRLQAGRAVGAYVRNQTKTGGSYWVYATISPL
FT                   HDGYISVRMVPDGPMFALAKQIYAQAVEVEREAMRTHGAGRREAALVGMRTIETLLQQH
FT                   GFGSYDEFMLDTLPAELSSKSHLLSLAHARPGAHGPVAEVLEGSRALDRLLGDLIGRLA
FT                   QYQNLSEEFARTSAHALEIAHRLDRSVQDAQHASDVVADSAPVLANVARVMALPMHDAV
FT                   NALERLQASLGRLRSDVAELRFKISLAGLYNHMAAAFAAEVVDGAAPADALSAVPLLCD
FT                   ASRTGVLEMSAQVQQVNDALHDIAALVREAAGLLGDFRRFLGQWRILVMRHRVGEAVRD
FT                   KLQRIDAEIAASWEWMQTLNSLGQEYESAVVPFDAELLQGHLARIQATLVAA"
FT   gene            141308..141958
FT                   /locus_tag="Tcur_0131"
FT   CDS_pept        141308..141958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0131"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bpt:Bpet2422 RhtB family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95738"
FT                   /db_xref="GOA:D1AEC2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC2"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACY95738.1"
FT                   /translation="MPSMSTMAVYVIAATLVLIAPGPAVLYVVSQGLRHGSRAAVTAVL
FT                   GVHIGTLVQVAAAVAGLSWLLVNSATAFMVVKYAGAAYLIYLGVRTLLSRRSPEAGQDL
FT                   PAPAPKGRRRLLGEGFLINLLNPKLALFFLAFLPQFVDPAKGAPALQITVFGLLFVLLG
FT                   LCTDGAYALLAGVIGPWLRRNVRLLRGERYAVGGTFIGLGLFAALAPSAQRHA"
FT   sig_peptide     141308..141388
FT                   /locus_tag="Tcur_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.625 at
FT                   residue 27"
FT   gene            complement(142210..143388)
FT                   /locus_tag="Tcur_0132"
FT   CDS_pept        complement(142210..143388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0132"
FT                   /product="protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   mch:Mchl_4629 protein-L-isoaspartate O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95739"
FT                   /db_xref="GOA:D1AEC3"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC3"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ACY95739.1"
FT                   /translation="MTPATTTTPEWLAEAVASGRLDAGWVQVFAALPRSLFLPDVIWPK
FT                   DPDSGQNVRVDRRRDPSGWAAWAEQDVPIVTQWDDQPDPAAAGQTATSSSSQPSLVAGM
FT                   LADLDVRPGHRVLDLGVGTGWTTALLAARVAAGTVVGIEYDPAVAEAARARITAVGLVA
FT                   DVIVGDGAAGWPDGAPYDRVQCTYAVRRIPTAWVEQTRPGGVILAPWETTLTHQGALVR
FT                   LTVQEDGIASGPFLWPVRFMGSRPERTPQIDRNDYLPPGGGWPPGTVESATRLRPADLW
FT                   ATPYGPAWWMIGLLVPDMVYATSSRKDGTVLGWLFSLRCRSWAIAFFDDAPEAEVYQGG
FT                   PRRLWDEVEAAHRWWTEQGRPGHEDFGLTVGPDGERVWLRSPDRPLPATLAG"
FT   gene            143755..144972
FT                   /locus_tag="Tcur_0133"
FT   CDS_pept        143755..144972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0133"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95740"
FT                   /db_xref="GOA:D1AEC4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC4"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACY95740.1"
FT                   /translation="MPEIISVLDPGAPFSKRLAYHRKRSGKTRAVLGGLVGRSAEWVKG
FT                   LETGRLDMPRLPMLLRLADILEVDLFDLTGEARLSQAAYTKHSHPSLDTIKRALTAYPA
FT                   KTTNPVAADVLAGRVQQAWQRWHGQRRERDAIAPLLPGLLADAGAAVRSLQGDERRRAA
FT                   RQLAQIHHLTQLYCAFQPAPELVYMVSDRAMITAQDADDPIAMAGAAWYLNHVWRDVGE
FT                   AAEARVELALDIARMLRPERSTEEQALYALMHLAVALSHAKLGREGEAWQHHDTAYEAV
FT                   RRLPGYIHPWLMIGTGMVEHYAVTIHLDLQKPGRALQAAGRIDPAAVPSRTRQSRYLVE
FT                   VARAHHRQRDPVAAVHLMLKAREASYDTFAFSLFARSMVASMLPDPPATVADEVRDLAG
FT                   TLGLAA"
FT   gene            complement(145645..146388)
FT                   /locus_tag="Tcur_0134"
FT   CDS_pept        complement(145645..146388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95741"
FT                   /db_xref="GOA:D1AEC5"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95741.1"
FT                   /translation="MAKKRLISVVLAAMALGGAPAGCGGGEDPDRTGAGESVSPPTASG
FT                   PAVPPSPDQDDRQEARFTADIKKVTAADLRHSWREGCPVPPSRLRAIDMTHWGMDGKVH
FT                   HGRLIVNASAAEDLVGVFRKLFDQKYPIERMEPVDKYRGSDFDSIEANNTSAFNCRQAT
FT                   GSGNWSQHAYGLAIDINPCQNPYVSASGHVAHKDCVKFKDRSRKDPGVIHKGDAVVKAF
FT                   AAIGWGWGGDWTGTKDYQHFSSTGR"
FT   sig_peptide     complement(146311..146388)
FT                   /locus_tag="Tcur_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.485 at
FT                   residue 26"
FT   gene            146530..146937
FT                   /locus_tag="Tcur_0135"
FT   CDS_pept        146530..146937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95742"
FT                   /db_xref="GOA:D1AEC6"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95742.1"
FT                   /translation="MTDRQDDKDVPTLEDELFALGSEGADRGRAEPIIRTPAVPPWERL
FT                   AKVDRGDLVRFAAGFATFAFIDLVMMYGPLMGRGDSGMPQFVALLVLAFGLGGMFAWHV
FT                   RGAWRPYGLGMMGGWVALTLLSAGFLTGLMG"
FT   gene            complement(146954..147415)
FT                   /locus_tag="Tcur_0136"
FT   CDS_pept        complement(146954..147415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0136"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bpt:Bpet2994 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95743"
FT                   /db_xref="GOA:D1AEC7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC7"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACY95743.1"
FT                   /translation="MSEPRWLDAGQQRDWRAYIDGSTRLHELLDRDLKAKHGLSTSEYE
FT                   ILVRLSEAPGRALRMAELAEHASQSRSRLSHTCTRLESKGLVRREACPNDKRGVYAILT
FT                   DEGFAALERAARDHVETVRRFFVDVISPEDLKAIGRAFGAVDEHIRGVR"
FT   gene            147595..148608
FT                   /locus_tag="Tcur_0137"
FT   CDS_pept        147595..148608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0137"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: bac:BamMC406_2120
FT                   pirin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95744"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC8"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ACY95744.1"
FT                   /translation="MPAITADPLTLPRLPRMPEAERAGRRVAKVVRARRQLEGEGFVVR
FT                   RPFPGMDLALADPFLLLDHMGAVEYAPGEAKGTPWHPHRGFETVTYIIDGAFQHQDTTG
FT                   GGGLISDGDTQWMTAGAGIQHIEQPPPELVAKGGLFHGVQLWVNLPRAQKWAPPRYQDI
FT                   RATDIKLLSSADGASLVRVIAGSLAGHEGPGITYTPITYLHATVAPGARLTLPWPADFN
FT                   ALLYVLSGRGVAGPEDRPVEEGQLAVFGGSPRTEHGDALTLRAADTQPQASKDGWEVLL
FT                   LGGLPIREPIARYGPFVMNTREEIIQAFEDYQAGRMGQIPAQRVSHRSTADEQGIG"
FT   gene            complement(148659..149525)
FT                   /locus_tag="Tcur_0138"
FT   CDS_pept        complement(148659..149525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0138"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: scl:sce2214
FT                   alpha/beta family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95745"
FT                   /db_xref="GOA:D1AEC9"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY95745.1"
FT                   /translation="MSVRIDDPARLGRTLLPGRRVLGWAEWGPPDGIPVLLSPGAATGR
FT                   WLGVGGGVPDALGVRLISVERPGTGVSTPLPGRTFADHAADIGAFAALRGLGRPLMVAN
FT                   SQGAPFALACAAAGVVAGLAVVSGADEIAAPAFAAALPQELRGLVELVARDPARAERTF
FT                   AGFGPEAMWDLVMKGSPACDLEVYQDAAFASAYRRALAEGFAQGPAGYARDTVLAMGRW
FT                   PFDLASITVPVDLWYGEEDTSHSPDNGAALAGRIPGAERHLVPGIGGAVLWTHTEPILR
FT                   TLLDRAG"
FT   gene            complement(149584..150150)
FT                   /locus_tag="Tcur_0139"
FT   CDS_pept        complement(149584..150150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95746"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95746.1"
FT                   /translation="MLLWHLLVDDQPQVRELAGRFRERLAGLSGLDPVPDEWLHITTQI
FT                   VGFADEIPRHEVTAMLTAVTQSLGKLPPITVRIGRVYVYLEGVAMGITPERALDPVREA
FT                   IREGIAQTITTHHMDDLDDRPVWTPHVSVAYSNADGPTAPILKALADPPEPCEFTVRRA
FT                   HLVEQVRDGHLYRWEPVAAVPLAGA"
FT   gene            150711..151451
FT                   /locus_tag="Tcur_0140"
FT   CDS_pept        150711..151451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95747"
FT                   /db_xref="GOA:D1AED1"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95747.1"
FT                   /translation="MDSTRLALAALAVPLALAAAAPPGHAEQARVFQADLGPLSGSGAR
FT                   GSATMALDGDLLTVEITTGGMTADQPHLQHLRFGGRDTCPPPQAAGDGALSTAELVPYT
FT                   GDIQVSLTTEGDTGPQSALAVTRMPAADAGGTLSYRRAFRVPDRVAVALEAGRVTIVQY
FT                   GVDVNGNGRYDSDAGLSDLDPSLYAEATFPATCGQVKPVPQGGTSAGEGGAAGADPRLL
FT                   GLGALLIAAAGGALAWGRRLRRGR"
FT   sig_peptide     150711..150791
FT                   /locus_tag="Tcur_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.913 at
FT                   residue 27"
FT   gene            151458..152108
FT                   /locus_tag="Tcur_0141"
FT   CDS_pept        151458..152108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0141"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95748"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED2"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACY95748.1"
FT                   /translation="MGKHSAKKSPWPGLGLAALAAVALGTAGAALIVTGLDGEPPAPAK
FT                   GRPLARPVEAAAPLHARSEPVRVTIPAIGVDAGRLEPLQVDADRRLPAPRRHDAIGWHA
FT                   AGPWPGQAGAAVLVGHVDSGTGPAIFHRLGALRPGDVITIGRAAGPDAVFTVHRVERYR
FT                   KEEFPTRRVYGPTGNRAELRLITCGGAFDKSKGAYRDNTVVYATLTGLRRPGS"
FT   sig_peptide     151458..151547
FT                   /locus_tag="Tcur_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.841 at
FT                   residue 30"
FT   gene            152411..153040
FT                   /locus_tag="Tcur_0142"
FT   CDS_pept        152411..153040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0142"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric
FT                   oxide synthase; KEGG: net:Neut_0876 flavodoxin/nitric oxide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95749"
FT                   /db_xref="GOA:D1AED3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED3"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ACY95749.1"
FT                   /translation="MSYDLSGPVRLAVIYYSATGTVYELAKAAGLAAEKAGAEVRLRKV
FT                   REMAPPDVIAANRMWSEHVQATRHIAEATLDDLDWADAIMLGAPTRYGMPAAQLKQFID
FT                   STGPLWGGGRLINKIASSFTAAATEHGGQEATILALNNTFYHWGAIIVPPGYADPVQFR
FT                   SGNPYGTSHTSQNGEIPPGETQLAAIEFQARRVVEVAQAFKRGRTV"
FT   gene            153275..154468
FT                   /locus_tag="Tcur_0143"
FT   CDS_pept        153275..154468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0143"
FT                   /product="ATPase"
FT                   /note="KEGG: geo:Geob_1221 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95750"
FT                   /db_xref="GOA:D1AED4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED4"
FT                   /inference="similar to AA sequence:KEGG:Geob_1221"
FT                   /protein_id="ACY95750.1"
FT                   /translation="MDPVRNPYAPGAGQRPPELAGRDRELQQFEVVLERVARGRPERSM
FT                   IITGLRGVGKTVLLNTFRSMAIQRLWGTGKIEARPEQSIRRPVASALHMAVRELAPRHR
FT                   APERIEYFLGVLKAFAQAGEEPAGKGRARAHRWQPGIDVPAVRGRADSGDLEIDLTELF
FT                   VDAASVATDLGVGIGLFVDEMQDVPAEDISALCAACHELSQVGGPLIVVGAGLPHLPAV
FT                   LSAGKSYSERLFRYARIDRLDRASADRALLAPAERENVTYTPEALEALYEAADGYPYFV
FT                   QAYAKVTWDLAPASPITAEDVKVAAPEAESELAVGFFGSRYERATPAERDYMRTMAMLG
FT                   DDPVPTAAVAEALGRKPSSLSPARDGLIKKGLIYSAERGLVAFTVPHFGKFLRSQPN"
FT   gene            complement(154709..155983)
FT                   /locus_tag="Tcur_0144"
FT   CDS_pept        complement(154709..155983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG32656 gene product from transcript CG32656-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95751"
FT                   /db_xref="GOA:D1AED5"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95751.1"
FT                   /translation="MMTMVSDAQVLLLAAVLTGAGLAKLLIGEPAPQRPEQIHGIQVPS
FT                   AEPGWAVLLRRSRPVAVVHGLVEVALGVALMLSAHPAVRVATVLLLGAATWVVGELRQR
FT                   TPDAGCGCFGALSDERIGRREIARAALLTVAALATLGGTADGMQVLTGGPWQTWALCAL
FT                   ELAALTALSREPAALLRRRRRPAVPCERRRSPLRESQKILRRSRPWRRYRALLDSDEPL
FT                   DVWREGCWRFLAYPAHRDGRPVEVVFAVSTAHRDRTVRAAVLDPAPREDAPSAPAPATP
FT                   TSQATGPSTAAPGAAVLPVPPSREHRSTEPPSPGNGAETALSAAGSPAAASHEHHDGEP
FT                   APPGTDVAQAAPPSSGSSAAASQGHHGGELTASAAGSAAVKASGGCRCAASAVGAGGSK
FT                   AGDAAAGAPAGGECRECARQYVMSR"
FT   gene            complement(155980..156966)
FT                   /locus_tag="Tcur_0145"
FT   CDS_pept        complement(155980..156966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_00132 AceF"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95752"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95752.1"
FT                   /translation="MPQPDGALRRLRSRAVFDLPAPPAGAVPDAPPRAVRGTIVDASPH
FT                   LLVLDTAAGEPVRLPMAPTTSVWHGGRSGPQALTPGREAIVRLDADGSVAERVWVDITR
FT                   VTGTILSCDRDGRQVEVDGGPHRGRTLLTIPEDALRRVLVRHPMLEPGYLMDVICVRSP
FT                   DGPRAVRPGTSQPGHPADRIVPASADAPSPQTVQGSATWFDGPAAGRAAGAAYPAVDPE
FT                   GDAGGCADAPQGCAPLPCLSRGSVLIVRNECSGRALKVPIVECGCVAARYCDRCVECGT
FT                   SPRGRIVELTPVGFAALGGDLDAGCFNVTLDFTATAAAFHPAPEGSP"
FT   gene            157351..157944
FT                   /locus_tag="Tcur_0146"
FT   CDS_pept        157351..157944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0146"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   regulatory protein LuxR; sigma-70 region 4 domain protein;
FT                   KEGG: bac:BamMC406_4381 ECF subfamily RNA polymerase
FT                   sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95753"
FT                   /db_xref="GOA:D1AED7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED7"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACY95753.1"
FT                   /translation="MNRAQQEEFHRYVADRGPVLLRAARQLTGDRTEAEDLLQVALAKT
FT                   YLAWDRINDRAAVDGYVRRAMVNTHISWWRRRKLEIYPTDVLPDRPVDDHTRRSEMHDA
FT                   LSRALARLPERQRLAVILRYYEDLPEPEIAKVLGVSVGTVKSTVSRAMAKLREDVDLEH
FT                   DFTAPKAAKEPDPPSERGALPDARHAPDTSERDR"
FT   gene            158131..158277
FT                   /locus_tag="Tcur_0147"
FT   CDS_pept        158131..158277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95754"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95754.1"
FT                   /translation="MLKKSAAGSAQAGGQGRGRRISPEGYMVLTDRAKTMIKRTVNGSS
FT                   RWN"
FT   gene            158693..160450
FT                   /locus_tag="Tcur_0148"
FT   CDS_pept        158693..160450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0148"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; KEGG: GOX4; glyoxal
FT                   or galactose oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95755"
FT                   /db_xref="GOA:D1AED9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY95755.1"
FT                   /translation="MPRWSSGTPDADRRLVQGLHQGDEETLGVLYDTYAEQLFDYCVAM
FT                   VAEERRAADIVHDAFIDAQRRAPRMRNRMQLRAWLYAAVRRRCLRGGRAAGMSWRWAAA
FT                   SAWAQEPGAAEAEVTPEEARRLVEAMLGRLDFLHRETLVLTLRHGMSPADISAVLGVSA
FT                   RRVAALVAQAEARAEAAITAELRAMVRHCHARRDSRERSQSDPAAEPQEAPEEQPVPAG
FT                   AAGGGSPVTALRHRSAVRLLASGGTFRRRRLRRSGTGRADLEPQLARHLADCTECWRRG
FT                   RVAAGSLLKAAPAPVPPAALRRRVLHTATDPELAPHRTDIAARGGPLTPAGLPRQPDMP
FT                   SPYARRWLFLGGGAAGALLAAMVAILMMGPVTANLRFPFDPRPQPSTEEAREKGAESGD
FT                   HPALAAPGAGGMPGPGGGYGRTPSPGPPFGEVPPDEPPEDRTPQPPGPDPSGPPGPSPS
FT                   PNPTQPPDPSQPPQPPYPSQPPLPSPSPPPAEGRLVVGPASVVVGRQGATITLTAQDGP
FT                   VVWTAVTTSDKLSLSLGSGTLQAGASVELQVVLARRSLINLPGNAAITVTDAAGNRHEV
FT                   QVKWRLSLF"
FT   gene            complement(160455..161201)
FT                   /locus_tag="Tcur_0149"
FT   CDS_pept        complement(160455..161201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0149"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: pap:PSPA7_1798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95756"
FT                   /db_xref="GOA:D1AEE0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE0"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACY95756.1"
FT                   /translation="MADYRIDDLARAAGTTVRNVRAYQDRGLLPPPRLRGRVGYYDDSH
FT                   LARLRLIGQLLARGYTLAVIKELLLAWEHGRDVSEVLGLEKVLTDPWSEELPGQVTVEE
FT                   LVASFGKGLAEEEIGPLLERATALGLIEPEGDRYRVPSPRLLHVGAELVAAGIPVAAVL
FT                   DVAERIRDDCEVIADRFVSLVGEHVFARMDGPGGDLAPAELAALVRRMRPLVKTVVEPF
FT                   IARAMEARVQQALGERMEVIREHLGP"
FT   gene            161287..162291
FT                   /locus_tag="Tcur_0150"
FT   CDS_pept        161287..162291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0150"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="KEGG: mno:Mnod_1307 adenylate/guanylate cyclase;
FT                   PFAM: adenylyl cyclase class-3/4/guanylyl cyclase; SMART:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95757"
FT                   /db_xref="GOA:D1AEE1"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE1"
FT                   /inference="protein motif:PRIAM:4.6.1.1"
FT                   /protein_id="ACY95757.1"
FT                   /translation="MTEAPSSDQLIEETLLGGPARYTRAQVEKLSGVPADYGLRIWRAL
FT                   GFPTPPEDEAAFTDEDVAALQEIRELLDTELVDEEMVLHLARAVGQTMGRLAGWLGGVW
FT                   LRRLGQEIPDDQPVTEELVFTALAATEELRPRFERLLLHGWRRQLAASALHSLTTTAAA
FT                   TADPASGVALMAAGFADVVSFTRLSRRMDERELAEFVERFEATAAGIIADLGGRLVKTL
FT                   GDEVFFVAADAAVAAEIALSLAGRHGVDPGFPRVRAGLAYGEVILRLGDFFGTPVNLAA
FT                   RLTSIAYPGAVLVDGELAAALADDDRYDFSSLRPRPLQGLGRVRPRLLRRRTS"
FT   gene            complement(162338..163189)
FT                   /locus_tag="Tcur_0151"
FT   CDS_pept        complement(162338..163189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95758"
FT                   /db_xref="GOA:D1AEE2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95758.1"
FT                   /translation="MELGRIGIWTPALRTRRPKAPEPIAEAVAELEELGYGAIWLGGSP
FT                   GVQSARVLIEASSRIVVATGILSVWDHPASEVAAQHRALAHDHPGRFLLGLGISHGPAV
FT                   GDRYRRPYATMMSYLDELDAAGVPAAERVLAALGPKMLAAARDRAAGAHPYLVTPEHTH
FT                   RARQVLGDGPLLAPEVKVVLDTDLERGRRSARDHLSFYLQLPNYTNNLLRLGFTEEDFA
FT                   GGGSDRLIDAVFAIGDVEAAERRIAEHFQAGADHAAVQVITADYRTLPLEQWRALAPLA
FT                   KQ"
FT   gene            complement(163543..163887)
FT                   /locus_tag="Tcur_0152"
FT   CDS_pept        complement(163543..163887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0152"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="PFAM: zinc finger DksA/TraR C4-type; KEGG:
FT                   gme:Gmet_1007 TraR/DksA family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95759"
FT                   /db_xref="GOA:D1AEE3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE3"
FT                   /inference="protein motif:PFAM:PF01258"
FT                   /protein_id="ACY95759.1"
FT                   /translation="MTLDTAHSVTGGYDPDSPRGREVRQRLEEERRSREAQLAALTRSD
FT                   DGQPDDTALVQADALRQTLEDIEEALLRLRQGRYGLCEKCGKPIPEGRLEILPYARCCV
FT                   SCQQRRRGRA"
FT   gene            164250..165227
FT                   /locus_tag="Tcur_0153"
FT   CDS_pept        164250..165227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0153"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: reh:H16_A0780 signal transduction histidine
FT                   kinase containing PAS/PAC sensor domain; PFAM: histidine
FT                   kinase dimerisation and phosphoacceptor region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95760"
FT                   /db_xref="GOA:D1AEE4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE4"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACY95760.1"
FT                   /translation="MRLFWRVFWLNTLVFAVATVLLAIGPWTVSAPIRLVELAVLLTGA
FT                   AALLAINAALLRWGLAPLDRLTRTMATVDLLQPGQRLPVTGSGEVAALIDTFNQMLQRL
FT                   ETERSTSSARALSAQEEERRRIAQELHDEIGQSLTAVLLELKRLTDRVPEPLREDVRYA
FT                   QETIRDSLDEVRRIARRLRPGVLEDLGLASALTALTSQFSEHTGIRVRRSLHPDLPPLT
FT                   PQVELVLYRIAQESLTNAARHSGAGAVELKLAPADGGVRLDITDDGRGLNGAPEGAGIR
FT                   GMRERALLVGGRLTLESGPEGGTRVSLHVPTPPKGPQEGRGPRP"
FT   sig_peptide     164250..164321
FT                   /locus_tag="Tcur_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.468 at
FT                   residue 24"
FT   gene            165224..165958
FT                   /locus_tag="Tcur_0154"
FT   CDS_pept        165224..165958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0154"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: dat:HRM2_24220 TRAP-type
FT                   C4-dicarboxylate transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95761"
FT                   /db_xref="GOA:D1AEE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY95761.1"
FT                   /translation="MTDETAAHPQGRVVSEPAQGRPDGPAKTRILLADDHALVRRGVRL
FT                   ILDGEPDLWVVGEAGDGAEAIEQVRRRAGTPQEVDLAVLDVAMPRMTGLQAARELSRMY
FT                   PRLRILILTMHDNEQYLFEALKAGAAGYVLKSLADRDLVQACRAAVRGEPFLYPGAISV
FT                   LIRSYLEQARQGEEPETPLTPREEEILKLVAEGHSSREIADTLFISVKTVERHRANILA
FT                   KLGMKDRLELTRYAIRTGLIEP"
FT   gene            complement(165962..167140)
FT                   /locus_tag="Tcur_0155"
FT   CDS_pept        complement(165962..167140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0155"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG: sat:SYN_00323
FT                   M50 family membrane endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95762"
FT                   /db_xref="GOA:D1AEE6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE6"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACY95762.1"
FT                   /translation="MNESVRLGRIAGIPVGLNVSVLVIVVILVVGLAFGLFPESFAGYS
FT                   TAAYLLAALLAALAFLASLLAHELAHAVVAKRHGVEVEGITLWLLGGVARLHGEPRTPR
FT                   ADFLIAVVGPLTSVALGAVFWLLALAVGWATGSPLAVGTLVYLALLNVVLAVFNLIPAA
FT                   PLDGGRVLRAALWRWRGDRHAAAISAARAGRAFGFVLITLGLLQVVTGMGVNGLWLALI
FT                   GWFLVNAAAAEEQQTRVQTVLGGVRVGDVMTPHPLTAHPDETVADFIHQVVLARRFSTY
FT                   PLVDELGRLDGLVTLNRIRDVPAALRATTTLREIACPLEGIPLGRPEQPLTELLANMSG
FT                   CTDGRAVVLSPDRRVIGLVTPSDISRAIQVGELTGPYAHRGADVVTLPPRRP"
FT   gene            167376..167585
FT                   /locus_tag="Tcur_0156"
FT   CDS_pept        167376..167585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95763"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95763.1"
FT                   /translation="MSAKPEPGGTPHPVSGRGRPAAPAASAAGSTPRTTAQPTGRSSRS
FT                   RGKDYGMRGNTAHRSEEFSPDDFE"
FT   gene            complement(167664..168104)
FT                   /locus_tag="Tcur_0157"
FT   CDS_pept        complement(167664..168104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95764"
FT                   /db_xref="GOA:D1AEE8"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95764.1"
FT                   /translation="MRFLTRSHHLPVRLAVGAYVLNSGLSKKNADEETAAGVHGMAAGA
FT                   YPFFKNMDPAVFTRLLSRAEIALGTALLLPFVPSALAGAALTAFSAGLVGLYLRTPGMR
FT                   QEGGLRPTVEGTGLAKDVWLLGIGIGLLIEELAGKDRSRKDG"
FT   gene            complement(168173..168952)
FT                   /locus_tag="Tcur_0158"
FT   CDS_pept        complement(168173..168952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95765"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95765.1"
FT                   /translation="MDLTGTSRTGPGRLDPLHRRRLTRAVERALRGTGRARLSVSACDL
FT                   TTGAGYSYGTARRFVTASIVKVDILAALLLRLGRQGRSLDGPQREQAARMIIDSDNDAA
FT                   SALWAQIGGAAGLSEANEALGLRETTATGAGWGLTGTSARDQIRLLRALAGPGGPLAAS
FT                   DRELIWEFMGAVNAGQRWGVGAAAGSAGRVALKNGWLPRSADGGLWVINSIGRIRDGHD
FT                   YLIAVLSDRNATKEAGIALVERVAVTVMDALRQTTSR"
FT   gene            169158..169991
FT                   /locus_tag="Tcur_0159"
FT   CDS_pept        169158..169991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0159"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sml:Smlt2516
FT                   putative esterase/chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95766"
FT                   /db_xref="GOA:D1AEF0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF0"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY95766.1"
FT                   /translation="MPFVTTSDGTEIFYKDWGSGRPVVFSHGWPLNSDSWEGQMLFLAE
FT                   HGYRCVAHDRRGHGRSAQVWDGNDMDHYADDLAAVIDALDLREATLVGFSTGGGEVARY
FT                   IGRHGTGRVVQAALVSAVPPFMLRTDDNPGGVPIEQFDEARANSLADRAQFYRDLADGP
FT                   FYGNNRPGASVSQGVRDFFWLQGMQSGHKNAYDSIAAYSATDFRDDLAAFDVPTLVIHG
FT                   EDDQIVPLEVGGRASAGLIKEAELKVYPGAPHGLTDTHKDRLNEDLLEFLNSYKS"
FT   gene            170199..171182
FT                   /locus_tag="Tcur_0160"
FT   CDS_pept        170199..171182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0160"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   bvi:Bcep1808_1087 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95767"
FT                   /db_xref="GOA:D1AEF1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF1"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACY95767.1"
FT                   /translation="MSILDLVPIPEGRTAAEGIAASMEAARQADELGYRRLWFAEHHNT
FT                   PGLAASASALLIARAASLTERIRVGAGGVMLPNHSPLMVAEQYGTLANMFGGRIDLGLG
FT                   RAPGTDPMTARALARSAADAQSFARNIADLQGWFGAAGTARSAPIFSAVSAGTDVPIWV
FT                   LGSTVNGASIAGRLGLPFSVASHFAPEQVMQAIEVYRDAFDPKAPTAQIDRPYVMAGIN
FT                   VLVMPTDEEARRQWTTVQQMFLNIRRGRRGKIPPPVDPDQVAPAFELAFAESALRFKAV
FT                   GSPKTAVRALEEFVARTGVDELIAVTYTYDPADRMKSFQLLAEHWF"
FT   gene            complement(171194..172675)
FT                   /locus_tag="Tcur_0161"
FT   CDS_pept        complement(171194..172675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0161"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: scl:sce4973 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95768"
FT                   /db_xref="GOA:D1AEF2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF2"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACY95768.1"
FT                   /translation="MEYAADVLVVGAGPTGLLLAGDLAAAGAGCVVVERRQGESNLSRA
FT                   FAVHARTLEQLDARGLADELAATGHRLRALRAFGDVTVDMSRLPSRFNYVLITPQYETE
FT                   RLLERRARACGAEIWEGTEAVGLRQDASGVEVTLRRRNGTARTVRARYVVGADGARSTV
FT                   RRALGLAFPGRSVVRSMMLADVRLAEDPPDALTVNATGDAFALLAPFGDGWYRVVAWDR
FT                   HHQVPDSAPVGLPEIRRTMRLALGSDYGARDPRWMSRFHSDERQVPRYRVGRVFLAGDA
FT                   AHIHSPAGGLGMNTGIQDAANLSWKLAAALQGWAPPGLLDSYQAERHPVGRAVLLASGA
FT                   IVRVVVTGPPPLRAVRNLLGRAVTGVAPLRRRATGLASGLSIAYPAPKGAHRLTGRRAP
FT                   DIPLADGRRLYQALRDGCFLLVAPRADDPAAAAAGAAWADRVRTLGAGGPTASTVLVRP
FT                   DGYIAWAADRPSAAAVRDALAAHCGPPRFRAPVPG"
FT   gene            complement(172804..173361)
FT                   /locus_tag="Tcur_0162"
FT   CDS_pept        complement(172804..173361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0162"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_5253 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95769"
FT                   /db_xref="GOA:D1AEF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY95769.1"
FT                   /translation="MYPVMVHGERLVLREFTEADIDAVLAIYGDPVVTEHLSFEPRTRD
FT                   QVAATIRTVTQAARAVPRTEYSLAAALISTGEAIGFARLAVDTGHPGQSSAQLGFALRK
FT                   DHWGQGLGSEMLGLLLTLGFDHLGLHRLWGARSPANTTSARLMLKHGMVEEGRIRHHLR
FT                   IGGQWRDSIVHSILEHERRPSP"
FT   gene            complement(174258..175775)
FT                   /locus_tag="Tcur_0163"
FT   CDS_pept        complement(174258..175775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3854 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95770"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95770.1"
FT                   /translation="MSGWSKRDVNRLRSQMIQQGRSTEEIAAEIRQMTGCSPLAAFRMA
FT                   LGWSQPEVVERYIASAPGSVMDQPLLSRLEGFPAAGSRQPQATQIIVLASLYGTSPLRL
FT                   LSPCALDRMDEHERAVLIRCNAAFTAASAAPAPASREIAAEPALAPAKATPPQAASTAG
FT                   TDQLERQVEMAARRAVRFTVTAEGSNIGPETLDQLREEVGRLAAAYPKQPLPSLLGDLV
FT                   DLQDVAFRLLEGRQRPAETTDLYVLAGAVSGMLAKASHDVGNPHAAMAQARTAYVCADN
FT                   AGHDGLRTWTRCLQSLIAYWAGWLNESVRYAQLGAESAARTTGTASVWLPAQEARARAA
FT                   LGDAERAEEAIARALRAREAVQGDDLDELGGIMSFPLPRQLYYAADARIWLPGADAEAE
FT                   RAAGEAIAAYESAPPAERSFSDEAGARTDQALARVNTGDLDGAAAALRPVLELPPDRRI
FT                   GGIVASVMRVHSALGAPAYRAAKIARDTQQAIEAYTQVPAAALSRIR"
FT   gene            176061..176585
FT                   /locus_tag="Tcur_0164"
FT   CDS_pept        176061..176585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0164"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95771"
FT                   /db_xref="GOA:D1AEF5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95771.1"
FT                   /translation="MSVLPVERHVPMPPAHFRTNQHDPDLRREKLRLAALPNAVGTARR
FT                   FVTAQLRGWGLDQLAGDCELVVSELVTNAVIATGDRTVPAGYARLHDRTPPTIVVQLRL
FT                   TWYRLLCEVWDASPRPPVPAAASPLSEGGRGLHLVAAYAAGWSAYTSPAGGKVVYAWWN
FT                   LPAAGPEGTAR"
FT   gene            176582..177142
FT                   /locus_tag="Tcur_0165"
FT   CDS_pept        176582..177142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95772"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95772.1"
FT                   /translation="MTRRPFRDFDAPRLKEPTWRRPGPPHAAPAPADDLTEAIAELRRT
FT                   FAEWLRDLARQAQNAQGDATETASLLLRLGACAKAAASLTEENPATPRNRPDRRKPERT
FT                   PPPPTRPLHEPRDGPGRHDKSRLKSPARRGPTPLFRSMAPRPRPGVFPNPETPTPGPRP
FT                   GGPGSRRSPPALVPPEPVPWLRP"
FT   gene            177598..178821
FT                   /pseudo
FT                   /locus_tag="Tcur_0166"
FT   gene            complement(178963..181125)
FT                   /locus_tag="Tcur_0167"
FT   CDS_pept        complement(178963..181125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95773"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95773.1"
FT                   /translation="MVFGSGKKLTFRDYVQGTWGSFTTPAGKVDYIMTKARLGEDSEDP
FT                   ERQLTKSLAPVREVMEVSDMDFNQLLQRDLDDHRVAVKLIPYLLKAQQTGPAFFPPIVA
FT                   VLLPFRNRRPSSFPKLGEPIVVEDDEARWLQERAGDSFQVQRLLRSDNQLHPASVGKLW
FT                   WNSTQARLVVLDGQHRAMALIAIERTMTNGWQSSSGARFRSFYEHQVKQVLLEAKQEGI
FT                   DLNKVEIPVTVCWFPELTGEDAKPHDAARKLFVDVNNEARQPSQSRIILLSDAELSNVL
FT                   TRRLLNELRGETDGSYIPLYAVEYDNPDANSTRPARWSVMTNIHLLKSAVDTCIFGPRD
FT                   YLKDVTKKSKGRTKPGDRDRFMREQLNIPDLFPSEFEDGGFTYHPDRIGNTEFPLGKVD
FT                   RISDRFAETWGRAILTLLSKTAPYAAHSRALRKLNESWHIDDTAMTLAHDALFNGVGVF
FT                   WTLKDSYDHYEERKSRGHSVTKSDVIRAWEALDRRESEFEAYRAQEYLDNDKSIKQSNS
FT                   AYSVFNTHACQLGLVMTLGSLWELRKSQLGWVNIYDLPAFAEDMTKGINAYFDQKHGRA
FT                   RDRRLAFIKDVSVITNPLNRIDSMETSQAVHFRYFWMQVLDTPMAWQHVSPWIKNQQDF
FT                   KLLLSAARENYLKLRENQMIRALKNDPNIPEKELQKEARKKASLLLKRALRDWFYLPEE
FT                   YYDEWFRSIGTSQNALDASPSTSNAP"
FT   gene            181472..182923
FT                   /locus_tag="Tcur_0168"
FT   CDS_pept        181472..182923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95774"
FT                   /db_xref="InterPro:IPR024019"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF8"
FT                   /inference="similar to AA sequence:KEGG:Sfri_2083"
FT                   /protein_id="ACY95774.1"
FT                   /translation="MNTVTWNSDRRLTAVSRTSLSVAAKQAVIDGEINSSVSVLDYGSG
FT                   RGGDVRGLREMRFQVQGWDPFYAPDEPPRPADVVLLTYVLNVIEDREERSQTLKRAWEL
FT                   ANRLLVVTTRLTWERSKIRGEEYEDGILTRRRTFQYLFSPAELRSYVEETTGVRCVSAA
FT                   PGIVYAYRNEEDRLRYLARKIVPHAEWLASDDTGSAIAAVVDYTERRGRLPRLEEMPEE
FT                   MAKLLSHLRPNELQRIVKKSADPEKVSEGVKRSTLSTLLFLAVELFNGRGPYSSLPLSI
FT                   QLDIRAFFSSYKEACRRADRLLLKLRDDSYVRGAMQASRVGKLTPTALYVHRRAVPQMP
FT                   AVLRLYEHCASIAAGRPASWTIVKLRHQGRAVSWLDYPEFDTDPHPKLSSSYMVDLTTL
FT                   KTSFKSYEGSKNRPLLHRKHEFLAPDDPDAPKYRRLTWAEMRAGLYQNPHLIGTEEGWE
FT                   AELRRCGRELHGHRLVRRKDTAQPS"
FT   gene            complement(182911..184062)
FT                   /locus_tag="Tcur_0169"
FT   CDS_pept        complement(182911..184062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0169"
FT                   /product="cysteine desulfurase DndA"
FT                   /EC_number="2.8.1.7"
FT                   /note="KEGG: gur:Gura_2472 aminotransferase, class V;
FT                   TIGRFAM: cysteine desulfurase DndA; PFAM: aminotransferase
FT                   class V"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95775"
FT                   /db_xref="GOA:D1AEF9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017644"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF9"
FT                   /inference="protein motif:TFAM:TIGR03235"
FT                   /protein_id="ACY95775.1"
FT                   /translation="MAVYLDAAATTRVDPRVAEVVLHWMTEEFGNAGSRTHEWGARSKR
FT                   AVQQAREQLASQVGATPSELIFTSGATESNNLALLGLAPYGEREGRRHIVTSAIEHKAV
FT                   LEPLEHLASRGFEVDLISPGPSGRVTIEAVLERLRDDTLLVSLMHVNNETGVIQPVAEL
FT                   AEHLRGTATYLHVDAAQGFGKLTEDLRAPIDLISISGHKIGAPKGIGALVIRRRGRDGI
FT                   PLTPLMYGGGQERKLRPGTLPVPLIIGLAKAAEIFEKERDQWWAQAAAFRNRLVEALSK
FT                   TKVHFNGDQEHVVPHILNVSFEGVDAEALIVHLKELVAISTGSACTSASYTPSHVLRGM
FT                   GLPDEIAANGLRLSWFPDQAREVDVDELAAEIAEFQASMAQLG"
FT   gene            184156..185274
FT                   /locus_tag="Tcur_0170"
FT   CDS_pept        184156..185274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0170"
FT                   /product="DNA sulfur modification protein DndB"
FT                   /note="TIGRFAM: DNA sulfur modification protein DndB; DGQHR
FT                   domain protein; KEGG: dal:Dalk_4799 DNA sulfur modification
FT                   protein DndB"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95776"
FT                   /db_xref="InterPro:IPR017601"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG0"
FT                   /inference="protein motif:TFAM:TIGR03233"
FT                   /protein_id="ACY95776.1"
FT                   /translation="MPKSSIADTTAGFEYVFPAIRGVQARREFFVSMCPLRLIPRLFLF
FT                   DEDELAPELRAQRVLNKARIPALTSYILDNPDSYVFSALTASVDGEMRFVGISDEGPGM
FT                   RIGQLHISMAARFLINDGQHRRAAIEAALNENPELGDETIAVVFFQDAGLARSQQMFAD
FT                   LNRHAVRPARSIGVLYDHRDERARVARLLALKSPVFRGFVEMERSTLSARSNKLFTLSA
FT                   LYYATRSLLQGVELTGEDQATKVAGAFWSAIDELIPEWELVRQRKMTAAEVRRQYLHSH
FT                   GIALHALGRLGNALLRESIELAFWRPRLEPLGKIDWSRANPDWEGRAVVGGRVSKNHSN
FT                   VVLTVNYLRQRLGLELSPEGAHIEATYLGGER"
FT   gene            185271..186794
FT                   /locus_tag="Tcur_0171"
FT   CDS_pept        185271..186794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0171"
FT                   /product="sulfurtransferase DndC"
FT                   /note="TIGRFAM: sulfurtransferase DndC; PFAM:
FT                   phosphoadenosine phosphosulfate reductase; KEGG:
FT                   gur:Gura_2474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95777"
FT                   /db_xref="GOA:D1AEG1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017598"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG1"
FT                   /inference="protein motif:TFAM:TIGR03183"
FT                   /protein_id="ACY95777.1"
FT                   /translation="MKVPLGTPTRRAIPFKDRGGLAAVVKELTEEIRELYQADTVPWVV
FT                   GYSGGKDSTAALQLVWLALQDLPVDKRTKPVHVISTDTLVENPIVARWVTQSLVTMAKA
FT                   AEEQQLPIQPHRLTPEVKDTFWVGLIGRGYPAPRPKFRWCTERLKIRPSNSFIRNVVRE
FT                   HGETILVLGIRKAESQARAKAMAKHEKRRVRDRLSPNANLPNSLVYSPIEDWSNDEVWT
FT                   FLMQYPNPWGHENKDLLTMYQGASSDGECPLVVDDTTPSCGDSRFGCWTCTLVDKDKSM
FT                   AAMIQNDEEKEWMLPLLELRNELDVRNEEGYRDDKHLRDWRKMNGTIQLFNDRIVHGPY
FT                   TQQAREQWLRKLLNAQAWIRKNAPENVRDIELITMDELHEIRRIWVFEKHEIEDSLPRI
FT                   YEEETGEKFPGEPLDEHLTLAGDEVEILREVCGDDELHFTTVRELLAVERRFRTMTRRA
FT                   GLFEELEKTIRRGYYQDKDDAEAYALRIRKAQEVPELPLFEEKAADAPA"
FT   gene            186781..188775
FT                   /locus_tag="Tcur_0172"
FT   CDS_pept        186781..188775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0172"
FT                   /product="DNA sulfur modification protein DndD"
FT                   /note="TIGRFAM: DNA sulfur modification protein DndD; PFAM:
FT                   SMC domain protein; KEGG: dal:Dalk_4797 DNA sulfur
FT                   modification protein DndD"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95778"
FT                   /db_xref="InterPro:IPR017599"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG2"
FT                   /inference="protein motif:TFAM:TIGR03185"
FT                   /protein_id="ACY95778.1"
FT                   /translation="MLLHNVTLKNFGAYKGEQSLELTTEPGRPIILIGGLNGCGKTTLL
FT                   DAIQLALYGARARTSGRGNRSYESYLRDSINRQANPKHAHVTVEFSLAIEGRERRYKVR
FT                   RSWEANGKNVREFLNVLVDGELDLVVSDNWADHIEDILPLEAASLFFFDGEKIESLADP
FT                   ERAAPVIESAVYSLLGVNTVEQLRTDLLALQRRQKVPDEDKQALERIQQLEREIREVDQ
FT                   LCADTNQKAAAARDALQRAEAHFSAVDEAFSKEGGDLYSRRAELEAEKEQAEAHLRSIN
FT                   ETLANTLAPGPLPLLLLGPQVVALQKQVQKERTAAKNAQVIEILNERDHLLLETLKDLV
FT                   PAEGLAAAEKYLAEDRQRRAKETAETRQVLNFPADSFPQLVSLDEVLRQEAKRARELVD
FT                   QAQELRERLDILERQLAGVPDKTVIAALIEERDAARDQVTRHRLALAAAEEELSAARRR
FT                   REQLLSERERAYKGRAQKLAKAEAAARIISYADRVRDTLEKFKTALLRRHINRLEVAVL
FT                   DSFNRLMRKSELVRDLRIDTEKFTLTLIGPDDEKLAPSRLSAGERQLLAVSLLWGLARV
FT                   AGNRLPSVIDTPLGRLDSRHREHLVERYFPHASHQVLLLSTDEEIDEYLLGKLKPSISH
FT                   SYTLVHDDKNFTTTVEPGYWWGTGAIHVA"
FT   gene            188765..189142
FT                   /locus_tag="Tcur_0173"
FT   CDS_pept        188765..189142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0173"
FT                   /product="DNA sulfur modification protein DndE"
FT                   /note="TIGRFAM: DNA sulfur modification protein DndE; PFAM:
FT                   Domain of unknown function DUF1832; KEGG: dal:Dalk_4796 DNA
FT                   sulfur modification protein DndE"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95779"
FT                   /db_xref="InterPro:IPR014969"
FT                   /db_xref="InterPro:IPR038472"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG3"
FT                   /inference="protein motif:TFAM:TIGR03184"
FT                   /protein_id="ACY95779.1"
FT                   /translation="MSLDNIRLSQPAKDQLIKLKRITGIKNWNVLCRWALALSLQDPSP
FT                   PLVREIVTDSNIEMNWKTFAGAYGDIYLALLKQRCVADGQEPTEENVSHTLTVHLHRGI
FT                   GHLAGRKDLKNIGDLISLAVA"
FT   gene            189451..191031
FT                   /locus_tag="Tcur_0174"
FT   CDS_pept        189451..191031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0174"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: bph:Bphy_7133
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95780"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG4"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ACY95780.1"
FT                   /translation="MEDFWSDLERAFDSKGEYFLGTVVLAKDSEEGKRTVIDGQQRLAT
FT                   VSLLLAAIRDEFGKRGSEKREVVQNDYLAKRTLMSDGPEPRLELNPDDNEYFNKFVTGE
FT                   GFKPPVVGGRQQFKRTSHKLLYDAYDYLADKISKDVDSAGCDSAAIERLKKWIIFLHNR
FT                   ARIGVIEVSSEADAYVIFETLNDRGADLTTADLLKNYLYGRADKKLGVVQRNWQQALNT
FT                   LDLTAADRKFTAFLRSYWSSYHELTRERDLYKAIRDEVTSSSRAVEISQEIAETASYYA
FT                   ALENPAHDLWRAQLDGSRDDVAILASFDLSPNKPLMLAALKHFNPEELRELLRALVSWS
FT                   VRGMIMNTMNSGSVEKEYCRVAVKIRDGEVSTVQQIREELDKVIPSDREFKLAFEIAQV
FT                   KRNKIARYYLRALERGYSGDPEPELVPNPNGSQITLEHVLPRNANPGEWPGFEDIDTHA
FT                   YMLGNMVLLRKSKNSEIGNRPFEVKRETLAESDFLLTREVGELADWTQEALTERQKRLA
FT                   ELAVKVWPR"
FT   gene            complement(192477..193908)
FT                   /pseudo
FT                   /locus_tag="Tcur_0175"
FT   gene            complement(194479..194568)
FT                   /locus_tag="Tcur_R0005"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(194479..194568)
FT                   /locus_tag="Tcur_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(194742..195131)
FT                   /locus_tag="Tcur_0176"
FT   CDS_pept        complement(194742..195131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB2134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95781"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95781.1"
FT                   /translation="MRTQTTRLLGVLAIGGAMLAATACLPGSDSEKTAACQAMVEEIGA
FT                   VPSKASQHLSNPGAAAQVYSDAAAKVRAEGRKAGGDVQEAAEQVADDLEELAQVLRDAG
FT                   SGNLRMPDTSKLISSGAKLRDACNA"
FT   sig_peptide     complement(195060..195131)
FT                   /locus_tag="Tcur_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            complement(195246..196355)
FT                   /locus_tag="Tcur_0177"
FT   CDS_pept        complement(195246..196355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0177"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: pag:PLES_03441 glycerophosphoryl diester
FT                   phosphodiesterase, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95782"
FT                   /db_xref="GOA:D1AEG6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG6"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACY95782.1"
FT                   /translation="MSRITRILAGGLVAAAVAGFCTVVLDEPAPAAAERAGRPIVIGHR
FT                   GASGLRPEHTLAAYRMAIAQGADYIEPDLVMTKDRRLVARHDNWLADSTDVEEHPEFAD
FT                   RKRTKTVDGVTRTDWFTEDFTLAELRTLRAEERIPGLRPGNTVFNGLEPIPTLEEVLDL
FT                   ARKHGVGVYPETKHPSYFDSLGLSMEEPLVAALHKYGFDSRRDKVFIQSFETSNLRDLR
FT                   KLTKVRLIQLIDGSGAPYDLVRKGDRRTYADLVKPAGLKWISSYADGIGPATGWIVPVD
FT                   SSGRLGKPTTLVRDAHRHGLAVHTWTVRNENEFLPADFRQGNAAAPGYRAATGDVGGWL
FT                   SKLYRLGVDGVFCDDPSAGVGARTAVFGS"
FT   sig_peptide     complement(196278..196355)
FT                   /locus_tag="Tcur_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.709 at
FT                   residue 26"
FT   gene            196591..196800
FT                   /locus_tag="Tcur_0178"
FT   CDS_pept        196591..196800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95783"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95783.1"
FT                   /translation="MSGFWCDGEWRRKELISTVGRWLNSAIGLQGISLDSSRGVDCFGW
FT                   AAKAMNVSAEDFPAFACWSDQIGL"
FT   gene            197163..197726
FT                   /locus_tag="Tcur_0179"
FT   CDS_pept        197163..197726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3154 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95784"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95784.1"
FT                   /translation="MTLVEFEAKLLDIDPEEMACRIESAGGRRTSEDRLQRRYVFDIDT
FT                   PPDPARWMRLRDDGVRATLAVKHIVHDGIDGTKEVEVSVDDFDQTLLLLQELGYKPKSY
FT                   QENRRTSFQLGEVHLEVDEWPLIPPYLELEGPSKEAVLAAADRLGIEHGRLTGINTVEV
FT                   YRRYGMDITDYPELRFDLEGGSRR"
FT   gene            198065..198137
FT                   /locus_tag="Tcur_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            198065..198137
FT                   /locus_tag="Tcur_R0006"
FT                   /product="tRNA-Arg"
FT   gene            199042..200268
FT                   /locus_tag="Tcur_0180"
FT   CDS_pept        199042..200268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: BLD10; basal body protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95785"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95785.1"
FT                   /translation="MSDNGAAPLGRDEIDRALASLRDERDRISTALYDLENHPGYRLLE
FT                   GSRLTGLTRRRWQEATDRLTTLWRLFDAYQRVLEEAEALRERHPRPAAAVLRELTGLLS
FT                   GPSVKLLPQEVSLRRRSLLDPTGERCTLAESVRRMSEAYREVTELVATVDAAWEALLGP
FT                   LGELEEQWRQATRLARSLGRGRDAELDRIGRELAAVGQTVRTDPLALARDGKADTARLE
FT                   ALRSDLAAARRALAEAVRLREDYDRRIGELTSSLEKLEEVVRRARRDYRTVQVKIASPG
FT                   VSEPADPAPRLRERLASLDGLRRAGRWAELAGEVAELEEAVAGALRQAERSRHLIVGLL
FT                   ERRDELRGRLEAYQVKAARLGLAEHGELVRLQERARSLLWTAPCDLQRSTVVLAEYQRV
FT                   LRSLETGTD"
FT   gene            200268..202592
FT                   /locus_tag="Tcur_0181"
FT   CDS_pept        200268..202592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0181"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; Tetratricopeptide
FT                   TPR_4; SMART: serine/threonine protein kinase; tyrosine
FT                   protein kinase; KEGG: scl:sce1432 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95786"
FT                   /db_xref="GOA:D1AEH0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH0"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACY95786.1"
FT                   /translation="MEKCTRPGCPGYIEDGFCNVDGLAPEPVPAQPTAVSGAPGGQPAP
FT                   PTRPSVPAPSQPSGASGATGSGRTASGRSARTGGTASTGSSRRGMLGAGLVEVPPVPYR
FT                   DPATAIMRNPEVPENRRFCSVDGEPVGRSRDGRPGRTEGYCRKCGHPFSFTPKLRPGDL
FT                   VGGQYEVLGCLAFGGMGWIYLARDKNVSDSWRVLKGLLDSGDADAMRAATAERAFLAQV
FT                   DHPNIVKIYNFVQHPDPHTKQPVGYIVMEYVGGKSLKEIVTQLRREHGEEASLPLPQVI
FT                   AYGLEVLRAMGYLHSRGLLYCDFKPDNAIQSEEQLKLIDLGGVRRIDDEDSPIFGTIGY
FT                   QAPEVPTDGPSISSDLYTVGRTLAVLSFPFRGYTGRYAHSLPPREEVPLLMRHESFYRF
FT                   LCRATHPDPRARFQDAAEMAEQLTGVLREVLAAEDGRPRPAPSTLFGTEQQAAGATLLE
FT                   PADEAGSGQSAVLPALDVRAATAALPVPQVSPADPAAGFLSGLTARDPADLEAALAYSP
FT                   VSSPEVSLMLVRARIGQGKLGEAVELLDRLAAERPEDWRLDWYRGLAALAADDRATAVA
FT                   IFDDLCNLMPGEKPPKLALAFAHERNGNLPAAVLYYDLVARTDPGYVSAAFGAARVRLA
FT                   LGDRAGAVAVLDSVPRVSSHHAAAQLAAVAAVVRGRPPAELNPAELVAVGRRLEALQLD
FT                   AERYQRAAAEVLEAALSWTLAHRSSAGQGAPQVLGVPLQEGPLRRRLEKLYRGLARLSD
FT                   DVETRHRLVNRANRVRPRTLL"
FT   gene            202628..203869
FT                   /locus_tag="Tcur_0182"
FT   CDS_pept        202628..203869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0182"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: scl:sce2514
FT                   phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95787"
FT                   /db_xref="GOA:D1AEH1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH1"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACY95787.1"
FT                   /translation="MEPTAATRCPGCTEAVSADDQFCEACGRFLHGASSTARPSAPHPG
FT                   PGDGGGSAAASPGPEKEEKAASAPPPPADSTAWEWDLPSTVAYGPPSAAGGAVPEPEPK
FT                   RAGAPCVECGAAEISEDGYCERCGVRQPSGREHLEIEIAGAAGVSDRGLRYRRNEDAMA
FT                   VATAAGKVIAVVCDGVSSAPRPEEASKVAADTGAAMLVAQLTAGADPQTATRAALARAA
FT                   RAVTALADSPYDAPACTYVSVVVGDGTVTVGWAGDSRAYWISGGGGARPSTALTVDDSW
FT                   AAQMVQRGLMTRAQAYADHRAHTVTAWLGADAGEVTPRAETFRPGGSGVVVVCSDGLWN
FT                   YLPEAAELAEAVHGARSRCASGSPLEIARSLVRTALEAGGHDNVTVVLIPFPPGDAETP
FT                   PARAEALVRGETGR"
FT   gene            203875..205173
FT                   /locus_tag="Tcur_0183"
FT   CDS_pept        203875..205173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0183"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: mxa:MXAN_2537 von
FT                   Willebrand factor type A domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95788"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041176"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH2"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY95788.1"
FT                   /translation="MPEFTIKVDQNRYLPVSGGEVHAIVTVEATGSSAPPGGGAAEAAE
FT                   VIIIDTSGSMASDGKLAEAKRAARTAVDTLRDGVHFAVIAGFHRAEPVYPGGERLAVAS
FT                   ASTKKEAKKAIGRLTSGGGTAIGSWLRMAHGLMSRQGAGGVRHAILLTDGQNQHETAEE
FT                   LDAALRAVSGSFVCDCRGVGTDWRVAELRKIASALLGSVDIVADPRDLAADFRAMTENA
FT                   MGKTVADVTLRIWTPLHGTLKFIKQVSPALEDLTGKRTDSGPQTGDYPTGAWGEEIRDY
FT                   HLCVQVPPGEVGRQMRAAWVKLVVPDGAGGERVAATGNVLAEWTDDEARSTRINPRVAH
FT                   YTGQEELAEAIQEGLDARREGDLDTATARLGRAVQLARRAGNRQMEELLGNVVDVIDPV
FT                   TGTVRLKKKVEKADEMSLETRSTKTVRTRKDGG"
FT   gene            205178..205819
FT                   /locus_tag="Tcur_0184"
FT   CDS_pept        205178..205819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0184"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   ank:AnaeK_2044 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95789"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH3"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACY95789.1"
FT                   /translation="MPHCPNGHSSAAEDYCDVCGELMAGAASTASGPAEPPPEPCPVDG
FT                   TPRSGRFCETCGYDFETGNRGGGPPPQPARPAVSGGWSAVVSADREYFATVVAEMGPDA
FT                   AALTFPPYAPDRRYLLVGPQVRIGRRSLSRGFVPEIDLSIPPADPGVSHIHAVLLARPD
FT                   GGWALVDPGSTNGTTINGSTEPIACNVEVPLKNGDRIHVGAWTTITLRKE"
FT   gene            205839..207308
FT                   /locus_tag="Tcur_0185"
FT   CDS_pept        205839..207308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1206 multi-sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95790"
FT                   /db_xref="GOA:D1AEH4"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95790.1"
FT                   /translation="MRRPASPHPSAATRRPGAPARPRRRLHLRTVPARIRALTAVVLVA
FT                   VAALFGTASWAIGNARTGLEVIGHDAGPQVMVTGDLFFALSDMDAQVATVLLLGRDHRL
FT                   GRGRAAALERYEQRRSEANRALLQAAQLAGDDPIERRTVQAVLDGLGRYERLAGQAMQL
FT                   DQEPQYAHPAGRPSPRVLELYRQAGELMKLELLPQAYNLTLESGSIVRKTYESKHWSVR
FT                   AGRVGVLAAGLAVVAALLVLQWYLARRFRRLLNPALVLATLGVLAVTLPAAGLLDSLAG
FT                   RLQSAKRDGFDSVLALSRARAISNSAYADESRYLLDPARADTYEQVYFDKSQAILYLDA
FT                   ERTKSLTDYHAGVGPAVERFVTGGRAQVDFLGFFGDQARRAEPGTSRARALAEVLTGYR
FT                   AFQEGDRRLRELVAAGRPAEALAQHLQADAFERYDAALVRLAEQHRTAFTGAIADGDRR
FT                   LRGWHVALPGACAVIAVLVLLGVRPRLAEYR"
FT   sig_peptide     205839..206009
FT                   /locus_tag="Tcur_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.754 at
FT                   residue 57"
FT   gene            207332..208171
FT                   /locus_tag="Tcur_0186"
FT   CDS_pept        207332..208171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0186"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   reh:H16_A3310 ABC-type transporter, periplasmic component:
FT                   PAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95791"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACY95791.1"
FT                   /translation="MRSSRIAGRRAAAAASAVLAAVALAGCDAGGAGSILDKSTLRIGV
FT                   KADQPGLGLKRPDGTFEGFDVDVARYVAGRLGFAEEDITFVETPSSVREQALQERRVDM
FT                   IVATYSITAGRKTKVTFAGPYYVAHQDTLVRAGDGAVRNVRDLSGRRLCKVTGSNSWRR
FT                   VTEERKVPARLVETSSYSDCVNRLLSGELDAVSTDDLILAGFAARYGDRVKIINAPISD
FT                   EKYGIGLHKSDIDGCEAINTALTQMYQDGTARRLLDKWFGRTSLRTNPYVPQFEGCG"
FT   sig_peptide     207332..207409
FT                   /locus_tag="Tcur_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.569 at
FT                   residue 26"
FT   gene            208406..209086
FT                   /locus_tag="Tcur_0187"
FT   CDS_pept        208406..209086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0187"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: gur:Gura_4298
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95792"
FT                   /db_xref="GOA:D1AEH6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH6"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACY95792.1"
FT                   /translation="MFYTFMSRVVAPILRLLFRPKVEGLENVPAYGPLIIASNHLSFID
FT                   SFIIPLSIPRPVTYIAKAEYFEQPGLKGRFIRWFLTTLGHMPIQRGARRAAMGALEQAL
FT                   KVLENGGAFAIYPEGTRSRDGRLYRGRTGTGWLVLASGARVLPIGLQNTEILQPIGRRL
FT                   PRICWPGRPRPIVRIGPVMDFSHYRDLPPAKARRVITDEIVETIQKLSGQDYAGVYNEN
FT                   ADVS"
FT   gene            209146..209871
FT                   /locus_tag="Tcur_0188"
FT   CDS_pept        209146..209871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95793"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95793.1"
FT                   /translation="MASSRSVNALFLSVLTCAALATACGGQSGDGKAGADQESERAAPA
FT                   GTGYTSDQLRQALPTELSGYRRTGEPEAGEYASLKSIANFLQLQRQVTYDKPRCAKVTG
FT                   ASVALDEELRTVPAAVAIFSKGGGHSVSTTLMAVPNSTAERHVQVRMPEQCKQFRTKIN
FT                   GKWAEHEVVEAGSGDTGLGSRIVGVASTLNETAVKTWYVVLRGRGYLATIALYGPTATR
FT                   AEAEQLARQTYDHAERILP"
FT   sig_peptide     209146..209217
FT                   /locus_tag="Tcur_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.703 at
FT                   residue 24"
FT   gene            210018..210689
FT                   /locus_tag="Tcur_0189"
FT   CDS_pept        210018..210689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0189"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aeh:Mlg_0745 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95794"
FT                   /db_xref="GOA:D1AEH8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY95794.1"
FT                   /translation="MTVPRLAVSVDLVVLTVREQRLCALTWRRDRPPYEGCWSLPGGFI
FT                   QLDEDLPVAAARLMAERAGLADVRIHLEQLATYGYPDRDPRQRVVSVAYLGLAPDLPAS
FT                   SRAQVLWRSVDELDNERAAFDHRRILRDGVERARAKLEYTSLAAAFCPPEFTVAELRRV
FT                   YEIVWGTHLDPRNFHRKVTGADRFLIPTGRTTTRDGGRPAQLYRRGDAEQLRPPMLRPR
FT                   P"
FT   gene            210743..211825
FT                   /locus_tag="Tcur_0190"
FT   CDS_pept        210743..211825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0190"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: reh:H16_A0793
FT                   histidinol-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95795"
FT                   /db_xref="GOA:D1AEH9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH9"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACY95795.1"
FT                   /translation="MPEVATPRFRSVLDRFAAYKPGKTAVSPDGRSYKLSSNESPFGPL
FT                   PSVLEAIGEAARRVNRYPDNNATALIEAISERFAVPADHIAVGCGSVGVTQMLLEAVAE
FT                   PGAEVLYAWRSFEAYPVLVALSGAQAVQVPLREETHDLAAMAEAITERTRLIFVCNPNN
FT                   PTGTAVRRAELESFLDRVPADCLVVLDEAYREYIRDEQVPDGLTLYGDRPNLAVLRTFS
FT                   KAYGLAGLRVGFLVAHPVVAGAVRKTMLPFSVNSLAQAAAIASLAAEDELLERVEGTVK
FT                   ERHRVVSALRDQGWSVPPTEANFVWLRLGERTLDFAAACEAQGVSVRPFAGEGARVSIG
FT                   LPEENDAFLAVAAAYPHRNR"
FT   gene            complement(211837..213321)
FT                   /locus_tag="Tcur_0191"
FT   CDS_pept        complement(211837..213321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0191"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: scl:sce5109 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95796"
FT                   /db_xref="GOA:D1AEI0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI0"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACY95796.1"
FT                   /translation="MLAVRKSTGTPVAIRYLPPQPPGRQAFHDEARLIAGLDDPGLVRL
FT                   HEYVTSPHGTALISELVDGISLERIIKAEGRLAPEASLLVCKAVLLALAAAHRSGLTHG
FT                   SVSPGNVLVDDEGTCKLAGLGVIAGGGTAASAGAERYRAPELAAGGPVTTAADLYSATA
FT                   ILYECLTGEPPVFTGGRCAGPIGPQLPQPLVSLVTTGLAADPNERPVTAPVFVSRLESV
FT                   ALAAYGPAWEQRGREQLSERASVLKLLFPLSRKLVSDEQARAMLNGRRRRSRGRLLIAL
FT                   AAALLLVVGTGAVVYASGKNARGTGEALPGVSETGPAPPVESSALPGFDAGESPAVKGG
FT                   RSATGGAASIGIDRPSAGAPTGSSPSSGPAVPPGRPSSPPSPPPTPSPSPSASFEATAV
FT                   EIVGLSLDETGTTATAQVKVTASGAGTVTLTVQFYADDVAHGAPETVTVTVPATGSTTV
FT                   EVTHSYDACPAVYAGQASASPGSAPSHRLAAEGECA"
FT   gene            complement(213869..215221)
FT                   /locus_tag="Tcur_0192"
FT   CDS_pept        complement(213869..215221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95797"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95797.1"
FT                   /translation="MSASRSTGSTPDLTIGVVGPHDLVERVMLMGNHSSTPIPSRLVAA
FT                   AYRDEQEAADKVLRLGSAVDVCLFASPVPYDFARKAGVLTMPATYVPLNGAALQGALLQ
FT                   AALDDRYDPAKVSIDVLTRSDVEEAYSEINLGIENVHLREEAAGPGTLAAFHERLWRRG
FT                   ITTVAMTCVHATAERMEMAGVPTIRVRPTGAAIRSSLQTAALLGAHHRLEESQLVVIVV
FT                   DVPTLRETPRRVTPRYWREELKLALHRTLVQEAHRMNASVWPVDDHSYLVTATRGSVSA
FT                   VTEGFRTPPFVDRVREELGVAIEVGIGMGRTAHEAETHARAALARSQTSQRAQGFALDR
FT                   DGRALVPAPRTPPRTQPQPKPKGLEILARLADKIDAENGGRNGDSQPLIVDAENAGRML
FT                   GVTPRTARRLLRTLVEEGLAWPLPPNRTPQPGRPRQLYRLIVEKLGPKATT"
FT   gene            complement(215873..217165)
FT                   /locus_tag="Tcur_0193"
FT   CDS_pept        complement(215873..217165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0193"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   scl:sce9145 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95798"
FT                   /db_xref="GOA:D1AEI2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI2"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACY95798.1"
FT                   /translation="MSMGHEVRYRVRGGRKLQGTVFIQGAKNAVLPMIGAALMATKGRT
FT                   VLRNVPIIEDVRRAVELAQAVGAKAELHEAERTLVIDASTLSSPVLPAEIASRFRGSFL
FT                   FVPALLHRLGEAVIEGVGGCNLGSRNLDFHYNGFKRMGATVTEQVDGDGNGVIYIKAGD
FT                   LRGATLYCDTPSHTGTENLVMAGALAKGTTLIKNCALEPEVLDNIEFLQRMGARISGGG
FT                   TGFITVEGVEELAAVEHTVMPDRIDAGVFIMAAAITGSELSLVGASLEHLGVAADKLEQ
FT                   MGVEFHQEGAVLQVRRERPLRPINVITDEYPGFATDLQSPIMAVSCLADGPSYIYERIF
FT                   DGRFKLAGELTKMGANIEVNGNRAKVFGPTPLHGAEVVAHDLRTGSALVLAGLSAEGET
FT                   VITQAYYLDRGHAHVAERLSQVGADIVREVL"
FT   gene            complement(217652..218509)
FT                   /locus_tag="Tcur_0194"
FT   CDS_pept        complement(217652..218509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0194"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamides
FT                   ynthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: cvi:CV_0165 phosphoribosylaminoimidazole-
FT                   succinocarboxamide synthase; TIGRFAM:
FT                   phosphoribosylaminoimidazole- succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95799"
FT                   /db_xref="GOA:D1AEI3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI3"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACY95799.1"
FT                   /translation="MKHLHSGKVRDLYELPGGELLMVARDTISAYDFVLEPVIPDKGKI
FT                   LTQLSLWWFEQLADVVPNHVISTELPDGAPAEWAGRAVVVRRLEMVPVECVARGYLTGS
FT                   GLKEYRRSGSVCGVPLPEGLVDGSKLPEPIFTPTTKAALGAHDEPMTFAEVVSAVGAEV
FT                   AERLREVTVEIYRRGARLAAERGIIVADTKIELGWSPEGELVLADEVLTPDSSRFWPAD
FT                   RWAPGGPQPSFDKQFVRDWLTSAEAGWDRASGDPPPPLPPHIVERTRAKYIEAYERLTG
FT                   RAFG"
FT   gene            complement(218576..219376)
FT                   /locus_tag="Tcur_0195"
FT   CDS_pept        complement(218576..219376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0195"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG: pmy:Pmen_1573
FT                   MOSC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95800"
FT                   /db_xref="GOA:D1AEI4"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI4"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACY95800.1"
FT                   /translation="MTAVLTGLTVYPLKGGGGTPLTTAELVPTGLRHDREFMLVTPEGR
FT                   FLSQRDLARMALLRPSYDGEVLTVKVADPSLADAPLVHKATDAGPVREVYVHRSQCLGI
FT                   DQGDEAAGWFSALLGTDCRLVRFTGHRATRRADGRVAFADAYPLLLISQESLEDLNGRL
FT                   ERPVPMNRFRPNLVVRGLGAFGEDRVRLLRIGETVIELVKACARCVVITTDQETGERGR
FT                   EPLRTLGSYRAIGRGIRFGQNGVPRTVGTLRVGDAVEVLERRPA"
FT   gene            complement(219466..220776)
FT                   /locus_tag="Tcur_0196"
FT   CDS_pept        complement(219466..220776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0196"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: gme:Gmet_1943 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95801"
FT                   /db_xref="GOA:D1AEI5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI5"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ACY95801.1"
FT                   /translation="MIERYTLPEMGRVWSDAHKYELWCRVETLVVEAHAQAGTIPAEVV
FT                   EPIRKAPPPTPERVREIEAVTQHDVIAFLTAWADNTEPREAAAYVHFGMTSSDLLDTAL
FT                   AVQLVEATDILLEKADRLVAVLRDHALEHRNTLRVGRTHGIHGEPDVWGHRVADFAFAM
FT                   ARSRDRLRRAREAVGVMAISGAVGTYSNIDPAVERYVAERLGLKPADVSTQVVMRDGIS
FT                   EWISALAIMATVCEAIALEVRHGQRTEVRELWEPFGKGQKGSSAMPHKKNPIMSERLAG
FT                   LARIVRAQIVPVLEGIPLWHERDISHSSTERIALPDASIALDYMLNLTIKLMSGLVVDA
FT                   ERMRANLESTGGLIYTSTVLLELVEMGMSRDDEAYPLVQKAAMETWETGTPFRETLRKH
FT                   AAAAGLTLDEARLDEVCRPERFVERLGPVFDRLAALS"
FT   gene            complement(220845..222092)
FT                   /locus_tag="Tcur_0197"
FT   CDS_pept        complement(220845..222092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0197"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: pzu:PHZ_c0508 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95802"
FT                   /db_xref="GOA:D1AEI6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI6"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACY95802.1"
FT                   /translation="MRILVLGSGGREHAITRALHRDPAVTDLHAAPGNPGTLQIAENHA
FT                   LDPTDVAAVTELAGRLRPDLVVVGPEAPLIAGVGDALRRAGIAVFGPDAAAARIEGSKA
FT                   FAKEVMRAAGVPTADSRVCQTPEEVAAALELFGPPYVVKDDGLAAGKGVVVTEDREQAA
FT                   RHAAACGRVVIEEFLDGPEVSLFALSDGTNAVPLLPAQDFKRAHDGDQGPNTGGMGAYA
FT                   PLPWAPPGLVDEVMTTIVQPTVDELRRRGTPYAGLLYAGLALTSKGVRVVEFNARFGDP
FT                   ETQVVLDRLETPPAGLLHACATGALDPKTALQWRPGAAVTVVIAAENYPASPVKGDVIT
FT                   GLEEAAAVPGAYVLHAGTRLTDEGTLVTAGGRVLNVVGTGPDLTAARTTAYQAVSKITI
FT                   RGSHHRTDIALKASQA"
FT   gene            222533..223606
FT                   /locus_tag="Tcur_0198"
FT   CDS_pept        222533..223606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0198"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mno:Mnod_7673 Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95803"
FT                   /db_xref="GOA:D1AEI7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI7"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACY95803.1"
FT                   /translation="MALFRPLARPLRGSAAPAVPPPRSSAVTDWAAYIDGQRVDTETVA
FT                   DAVRLVRDGELTDNDGGMGFVWVGLHEPDAAELERLAPVFGLHPLAVEDAVHAHQRPKL
FT                   ERYDDVQFLVMKTVGYAERGGDDGDLVETGEIMIFCGHDFVVTVRHGPHGDLDAVRRRL
FT                   EADPARLALGPTAVLHAIADHVVDAYMSVAEAVADDIDRVEEAVFSPERSDEARRIYRL
FT                   KREVIQLKRAVGPLAGPLRSLAGRRFVPPEIKEYLRDVEDHLTRVREQVESYDELLNPI
FT                   LHAHMTQVTVADNRDMRRISAWGAILMLPTAVTGIYGMNFDNMPALHTEWGYMAVLAVI
FT                   AVMCLTLYRGFRRNGWL"
FT   gene            complement(223666..224583)
FT                   /locus_tag="Tcur_0199"
FT   CDS_pept        complement(223666..224583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0199"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bja:blr6584 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95804"
FT                   /db_xref="GOA:D1AEI8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI8"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACY95804.1"
FT                   /translation="MPNGRIEVHGHRGARGLRPENTLPGFAHALELGVDVIELDVGLTA
FT                   DGVVVVNHDQSLSPVTTADTAPVVPGDPLFPYVGRELRDLTLAQIKTVDAGVRRLGPGQ
FT                   DCDPFLLTQLPLPGTRLPTLAEVCDLLQGLEEVDPAVELKTDPGWPDDEVRRFVLAVAE
FT                   VLDSFGLLSRARLLAFDWRVLAEARIHVPQAARVALVERKTLADGTAWLAGLSAADPAA
FT                   AAADAGANVLSPEHDLVTSRLVHDAHGRGLRVSVWTVNDPVDMARFIEYGVDAIVTDYP
FT                   DRLHQVLATYDIPRPQPRTPVRLP"
FT   gene            complement(224748..226160)
FT                   /locus_tag="Tcur_0200"
FT   CDS_pept        complement(224748..226160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0200"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   bam:Bamb_6316 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95805"
FT                   /db_xref="GOA:D1AEI9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI9"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACY95805.1"
FT                   /translation="MQDHWVNSGSDLHLELTGDGTVRERLMRALREAIRSGRLAPGTRL
FT                   PPYRSLAGDLGVAPNTVGAAYAELVAEGWLVARQGSGTRVAPRALPPPARRPRRTVPAR
FT                   RRPVHDLRPSSPDASAFPRTEWLRSARRALNAAPAEAFGVGDPRGRIELRTALAEYLAR
FT                   ARGVRTTPDRIIVCAGFAHALRLLGEVLEGPVAVEAYGLGFHRSLLTGAGLDTPPLRID
FT                   EGGARIDELPGTGARAVLLTPAHQYPTGGPLHPERRAAVIDWASATGGLVLEDDYDGEF
FT                   RYDRQPVGAVQGLDPDRVVYLGSVSKSLSPSLRLGWMVVPAHLTDELLRVKGERELWSG
FT                   VVDQLTLADFIACGGYDRHVRRMRQVYRRRRDRLVAALAERAPHITVSGIAAGLHAVLA
FT                   LPPGTEEDTVRAARRHGVAVDGLGDYRHPAGVMPPRDGLVVGYGTPPEHGFAAAVDALV
FT                   RALPPARTGYGK"
FT   gene            226208..226660
FT                   /locus_tag="Tcur_0201"
FT   CDS_pept        226208..226660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0201"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   psa:PST_3591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95806"
FT                   /db_xref="GOA:D1AEJ0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ0"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACY95806.1"
FT                   /translation="MQAVQIPQRMNLPKVAPKVFSAMLALDAAARQGLDQTLIDLVQIR
FT                   ASQINKCAYCLDYHIADARKAGETEDRIYQLSAWEDAGLYTARERAALALTEAMTLLPG
FT                   GVPDEVYDEAARHFAEAELAQLIALIATINAWNRLNVTTRKTPGTA"
FT   gene            226757..227929
FT                   /locus_tag="Tcur_0202"
FT   CDS_pept        226757..227929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0202"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   smt:Smal_0427 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95807"
FT                   /db_xref="GOA:D1AEJ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95807.1"
FT                   /translation="MTTAPLADAPPSPLRGWCAASAVALGIFALMTSELLPVGLLSPIG
FT                   RELGVSEGTAGLMVTVPGLVAVVSAPLLTVAAGRLDRRIVLAALVGTVGTANLLSALAE
FT                   AFALILLARVLIGVAVGGFWALAGGIATRLVRPEDVPRATAVIFGGVEAASVLGVPAGT
FT                   LLGDLGGWRTAFAAVGALGLAALAGLVLLLPPLPPQRSITFADLPRAFRANAGLRVGLA
FT                   LTFLIVTGHFLAYTFVRPVLSGHDVPDETVGVLLLVFGVAGLCGNFLAGALIGRRLAAT
FT                   VVAICLTLAAATALVALSGDGVAAVAGPLVLWGLGYGAVPVTLQTWIMRSSPTATEAST
FT                   SLYTSMFNLSIALGALAGGLVVDTLALTAVLWAGGAMALAALPFAIRGAR"
FT   gene            complement(227939..229222)
FT                   /locus_tag="Tcur_0203"
FT   CDS_pept        complement(227939..229222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0203"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: geo:Geob_0846 adenylosuccinate synthase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95808"
FT                   /db_xref="GOA:D1AEJ2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ2"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACY95808.1"
FT                   /translation="MPAIVLVGAQWGDEGKGKATDLLGGQVDYVVRYQGGNNAGHTVVI
FT                   GDNSYALHLLPSGVLSPGVVPVIGNGVVIDPGVLLSEIDGLAERGVSCERLLISADAHL
FT                   IMPHHRALDKVTERYLGRARIGTTGRGIGPAYADKITRTGIRVQDLFDPNILTQKLDLA
FT                   LREKNQVLTKVYNRRRIETAPIVEEYLAYGERLRPYVADTTLVLNRALDEGKVVLLEGA
FT                   QGTLLDIDHGTYPFVTSSSPTAGGACAGSGIGPTKISRVIGILKAYTTRVGSGPFPTEL
FT                   RDEMGEYLRKTGGEYGVTTGRDRRCGWFDAVIARYATRVNGITDYFLTKLDVLSGLERI
FT                   PVCVAYDVDGVRHEEMPMSQTEFHHAKPILEYFDGWQEDISDAKTFDDLPPNAQAYVRA
FT                   IEEMSGAPISAIGVGPGRDQTLSIRPLV"
FT   gene            complement(229498..229917)
FT                   /locus_tag="Tcur_0204"
FT   CDS_pept        complement(229498..229917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95809"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95809.1"
FT                   /translation="MAAMSQNLLGGPPPTELPENAEAEAALEKGMDPAEVAAKYPAFSA
FT                   AWAALADRAFEAGKVIESYAYARTGYHRGLDQLRRAGWKGHGPIPWEHAPNRGFLRSLH
FT                   ALGRAAAAIGEDEEAERCRTFLRDSSATAAEVLGG"
FT   gene            complement(229950..230468)
FT                   /locus_tag="Tcur_0205"
FT   CDS_pept        complement(229950..230468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0205"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tbd:Tbd_2024 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95810"
FT                   /db_xref="GOA:D1AEJ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY95810.1"
FT                   /translation="MGFMTQLISESRTLELSDLRVRPYGITDAPRLRRMSDRLSERSLY
FT                   FRFFIGTPRIPEIYVRHLDRLDHWDHEALVALADYDMVGVAEYIRDPADRTRAELAVLV
FT                   ADPWQHRGVGRLLIGALAHTAVRRGITAFDAGVLPGNDPALAAIRSLWPQARPRYEDGS
FT                   ARFRLPLAA"
FT   gene            complement(230531..230992)
FT                   /locus_tag="Tcur_0206"
FT   CDS_pept        complement(230531..230992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0206"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   pzu:PHZ_c2215 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95811"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACY95811.1"
FT                   /translation="MALPRTYENQNCSIARSLEVVGDRWTLLVIRAAFEGVRRFDDFAE
FT                   HLGVARNVLADRLNRLCAEGIMRKQRYQERPDRYEYRLTRKGVGLWPAMMMLLKWGDRY
FT                   YATDGPPVLVVHRGCGGTLTDRLTCDSCGAPLGPTDVEARPGPGARTSA"
FT   gene            complement(231131..232153)
FT                   /locus_tag="Tcur_0207"
FT   CDS_pept        complement(231131..232153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0207"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: sfu:Sfum_1469
FT                   fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95812"
FT                   /db_xref="GOA:D1AEJ6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ6"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ACY95812.1"
FT                   /translation="MPIATPEVYAEMLDRAKAEGFAYPAINVTSSQTLNAALRGFAEAE
FT                   SDGIIQISTGGAEYLSGTAVKDMVTGAVAFAEYARVVAAKYPVNIALHTDHCPKEKLDG
FT                   FMRPLVKISQERVAKGQEPLFQSHMWDGSAVELRENLQIAAELLEECVKARTIMEMEIG
FT                   VVGGEEDGIVGEINEKLYTTTEDALATAEAVGVGEKGRYILAATFGNVHGVYKPGHVKL
FT                   RPQVLKEIQEAVGAKYGKDKPFDLVFHGGSGSTLEEIREAVSYGVIKMNIDTDTQYAFT
FT                   RPIADHMFRNYDGVLKVDGEVGNKKTYDPRSYGKAAEAGMAARVVQACQDLMSAGKKLK
FT                   "
FT   gene            232435..233115
FT                   /locus_tag="Tcur_0208"
FT   CDS_pept        232435..233115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0208"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   cbc:CbuK_1318 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95813"
FT                   /db_xref="GOA:D1AEJ7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ7"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACY95813.1"
FT                   /translation="MNFLDPQSLIVAFGVVGVLAIIFAETGLLFGCILPGDSLLFAAGI
FT                   FTVGSAAAGIGLDQPLSLPVLLVGGPICAIAGAQLGHWLGAKYGRKLFDRPDSRIFRQE
FT                   WVERAEYYFDKFGPAKAVVLARFIPIVRTFLNPLAGILGMDARKFFVWNVIGGIIWTDG
FT                   LFIAGHFLGSKIPNIETYILPGIIVIVLLSVIPIVREVMKGRREARNGGPEEPRPSLSG
FT                   ESSR"
FT   gene            233209..233574
FT                   /locus_tag="Tcur_0209"
FT   CDS_pept        233209..233574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95814"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95814.1"
FT                   /translation="MIGGYALINALTSPAPGPAPSDTVSRELDAGDSGQSAGSSQIPLQ
FT                   ITVTGPPTNVFVQVAGGGEVLQKGILATGETRMYTQTPLNVVVEDSSAVVVRIYGKVVE
FT                   DGNGRGRGEWIVEAPED"
FT   gene            complement(233654..234190)
FT                   /locus_tag="Tcur_0210"
FT   CDS_pept        complement(233654..234190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0210"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: bra:BRADO0748 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95815"
FT                   /db_xref="GOA:D1AEJ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ9"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACY95815.1"
FT                   /translation="MNDREELLQEIKKKAVVHGDFVLSSGQRATWYVDLRRVTLDGTAA
FT                   PLVGRVMLDLTADLDYEAVGGLTLGADPVATAMLHAAHARGRRLDAFVVRKAGKTHGLQ
FT                   RRIEGPDVAGRRVLAVEDTSTTGGSVLTAVQALREAGAEVVAVATIVERGAADRIRAEG
FT                   LEYRSAYRVADLGVG"
FT   gene            234299..234796
FT                   /locus_tag="Tcur_0211"
FT   CDS_pept        234299..234796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95816"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95816.1"
FT                   /translation="MILLHPPRTTAGLWGELPEALRSHGLDVIAPDIREEEGMRYVARA
FT                   SLVISAAAPNPPLVLVGGGDAGPLLPAVAAAQRAAHRTVGGYVFLDAELPVPRRFTDHD
FT                   HHGHGAPPVPADWPDAPCGYLSTRGERTPPVRLARLRGWQVAALPAGGDLARALSDLVR
FT                   AL"
FT   gene            complement(234860..235438)
FT                   /locus_tag="Tcur_0212"
FT   CDS_pept        complement(234860..235438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0212"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: aeh:Mlg_2483
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK1"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ACY95817.1"
FT                   /translation="MTHVTEDDLDDLEFDTLRTGDHASAARRLSELAASVSGGVSRAKV
FT                   LLRAGEQWQHAGDHAKAAELYRQAIEDGGETYGDPRAYLADALFELDRADEARDLIEQI
FT                   RADEPRDPEVYRTVAEVLYAHGDPEGAHDWATAGVELVLALRERGEEDVEIAEDSLEGL
FT                   LRLRYRTRVDLGRPEDDYDAMLDDLLKTS"
FT   gene            complement(235609..236022)
FT                   /locus_tag="Tcur_0213"
FT   CDS_pept        complement(235609..236022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0213"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   sit:TM1040_2369 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95818"
FT                   /db_xref="GOA:D1AEK2"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK2"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACY95818.1"
FT                   /translation="MSHWIQTPVKVGWNDCDMQGHVYFVSYLNFLEAGREDLADQIGID
FT                   RRDWPLVVTEMNVRYHSPALYRDELIVCTRIEVQSVRCRFYQRILRKHGRELLVESTLT
FT                   VAFHGERGIRLSRVHELHDLYENFLKQRQGALN"
FT   gene            complement(236062..236820)
FT                   /locus_tag="Tcur_0214"
FT   CDS_pept        complement(236062..236820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0214"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   pla:Plav_1760 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95819"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95819.1"
FT                   /translation="MGRPGLSGRVAVVTGAAGGIGAAVARTLVADGAGVVLADVDVAGA
FT                   EKVARRLREEGHPGRALAARLDVTSPADWQAVCRTACRAFGRPQLLVNNAGVHGLHGVE
FT                   SLGEEEWSTVVDVCQRGTWLGMRALAPLMRLAGGGSIVNLSSVFALIGTGAAVAYHAAK
FT                   GAIVSMTRTAALEFAPQRIRVNAVSPGIVRTPLTDGLPAGFVDRIAADTPLGRPGAPAE
FT                   IAAAVHFLLSDAASYITGTNLVVDGGLTAR"
FT   sig_peptide     complement(236743..236820)
FT                   /locus_tag="Tcur_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.713 at
FT                   residue 26"
FT   gene            complement(236820..237176)
FT                   /locus_tag="Tcur_0215"
FT   CDS_pept        complement(236820..237176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU1803 holo-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95820"
FT                   /db_xref="GOA:D1AEK4"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95820.1"
FT                   /translation="MPHGSIQLEVVSLGAQLRAEADDLLSAAELAYCLGFLRAEEHMGA
FT                   RVAAKRAVSRLLGGDLRHCRHQIELIREDTGPVRVRLHGELLERAQRAGLGVPRVSLTH
FT                   AAGRAAAIAWLGSR"
FT   gene            complement(237178..239616)
FT                   /locus_tag="Tcur_0216"
FT   CDS_pept        complement(237178..239616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0216"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: scl:sce3351
FT                   putative beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95821"
FT                   /db_xref="GOA:D1AEK5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK5"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACY95821.1"
FT                   /translation="MASANTREHAPEGVVITGLAVVCALGSQTEQVWRAVRDGECGVRP
FT                   TRHIDVSTLTCRYSAEMVQLPRSGPQRRDRATTMTLQVGQAAIESAGLHPRQLDPYRFG
FT                   VAIGTSVGGLESGERFHAELIHRGLEETDRTHLLSYPLYTSADELSTAFGAKGPKVVIS
FT                   NACAAGANAIGYAADALRLGRADVMLAGGVDPIDILSLAGFDSLKALDSQPCAPYSRSG
FT                   GLSLGEGAAILVLETESHAAARGATVLGHVLSYALTSDAHHATAPDPGGEGARRAMAGA
FT                   LAEAACGPEEVDYVSGHGTGTPANDSAELRAFGNLFPDPQRPPVSSTKSQVGHTLGAAG
FT                   AIEAAMCVLALRDQVLPPTVNVAPDRTPARDIVPGRGRPHRIETVLSNSFAFGGNNCSI
FT                   LLGRRPGPRRRPAPRRVVVTGAGVVSPLGTGRAEFLRALREGAVAVRPAERLDIGGARS
FT                   RLAAELPDERHRRLVDRSYARRLDQLGLLTLAATRLALQDAGYQVSRAESERVGMIFGT
FT                   GTGPMETVAALSETIIKEGPHRVNPRLFPNSVMNAAAGHACLAFQIKGPLSTVATGCAA
FT                   GLTAVGYAADLIRQGRADVMIAVAADELTPLLHLGFDRLGLLTETQVRPYDRRRSGMAL
FT                   GAGAVAVVLESAEHAERRKAAIAAEFGGHAITADAHRVAGNDPTGAALAECMTRALADA
FT                   GIPPERVGGVYGDARGVRSIDLLEARAIGRVLPWAQVACLSGQSGHINATTPLLSLVSA
FT                   LESCRSGWLPPIRGLCEPLPVPALRTSVPAGAARRDAYLVNAIGWGGTYASAVLTAWDG
FT                   "
FT   gene            complement(239622..240644)
FT                   /locus_tag="Tcur_0217"
FT   CDS_pept        complement(239622..240644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0217"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   bba:Bd0684 aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95822"
FT                   /db_xref="GOA:D1AEK6"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK6"
FT                   /inference="protein motif:PFAM:PF01571"
FT                   /protein_id="ACY95822.1"
FT                   /translation="MNEVHTSIEDEYTALRNGCGLIDYQGIGLFQVQGPGAIRFLNEVT
FT                   TRNIEFLLEEQSSTALVLDDAGHVISDVLVHCQGTEFLVEVEPARRARTWEHLRAVAES
FT                   LDYVELTDVSPARRVFGVEGPASFRIAQHFLSFPVSSLAYRGFTTVRWRDHELLLSRTG
FT                   VTGEYGYKFHIDAAGAEELRQELRSLGALPVGSAALDICRTEMRFVDLDAEGGRECFPF
FT                   EVGLQWMVDMHHDFRGKEALARRIDEGFPRRPVCWTADPELAAPPAPGTALSIEGQPVG
FT                   EVTHAVRSPGLGRVIGTARLDETVAAVDVELTLAGAASPAVRTVSAPFLIPASFNVKPE
FT                   "
FT   gene            complement(240858..241343)
FT                   /locus_tag="Tcur_0218"
FT   CDS_pept        complement(240858..241343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0218"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; KEGG: nis:NIS_0540
FT                   (3R)-hydroxymyristoyl-ACP dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95823"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK7"
FT                   /inference="protein motif:PFAM:PF07977"
FT                   /protein_id="ACY95823.1"
FT                   /translation="MTVAPAFAALDADDIARMLPHRHPFLLLDRVIELEPGVAGTAIKN
FT                   ISVSDPVLAGHFPGRMIYPGVLLVECIAQLAAVVYGSGALSAAGSADLSAAAGRVGYLA
FT                   EISRVKFLQPVRPGDQLLIKAKTTTRVGSLMSVQGQISVGRDLVMTARLGVTERTDH"
FT   gene            complement(241340..241627)
FT                   /locus_tag="Tcur_0219"
FT   CDS_pept        complement(241340..241627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0219"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   mxa:MXAN_6392 putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95824"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK8"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACY95824.1"
FT                   /translation="MPMTLAEARSRAARRQELCSAVKKLIVDRLDLDVDPALIGDDQPL
FT                   FGRGLELDSIDTLELAVSIQEEFDVVIDDDDRESLMSINRLVDHLEANLP"
FT   gene            complement(241677..242420)
FT                   /locus_tag="Tcur_0220"
FT   CDS_pept        complement(241677..242420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0220"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: chloroplast 3-oxoacyl-"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95825"
FT                   /db_xref="GOA:D1AEK9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95825.1"
FT                   /translation="MNVEGKVALVTGASKGIGLAIARSLAEGGARVLLNYRRDEEAAQR
FT                   ALAEIRALSPDSALIRADVGDPEAISRMFRTVKADYGGLDLFVSNAGITDDGYALMMSR
FT                   RKWQSVIDTNLTGAFLCCQAAGRMMLARRRGAIVAVGSTSGLVPPAGQVNYAASKAGLF
FT                   SLVRVLANELGQYGVRVNAVAPGFIDTAMTRAMPPGRLKEHLQHVPLGRVGRPEEVAPL
FT                   VRFLLSEEASYVTGAVMVVDGGLTS"
FT   gene            complement(242417..243448)
FT                   /locus_tag="Tcur_0221"
FT   CDS_pept        complement(242417..243448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0221"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: csa:Csal_1600
FT                   [acyl-carrier-protein] S- malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95826"
FT                   /db_xref="GOA:D1AEL0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL0"
FT                   /inference="protein motif:TFAM:TIGR00128"
FT                   /protein_id="ACY95826.1"
FT                   /translation="MMETTASPAAPVFVFPGQGSQYPGMGRDLAACGPVARELAARAET
FT                   ATGLAVWELMHRADAAALADPEVAQVLVFVAGAAHWRAFTERGCRPAAVAGHSLGEYTA
FT                   LLAAGCLDWEQALSLVHTRGKAMARAARRTPGAMAAIVGIPAERLEQMCRQVADRSGQT
FT                   VVIANHNTHRQLVVSGHAEAVELLIAQARDAGALRARRLPVGGAYHSPLMEPAEREMAS
FT                   ALDRVRLRPPRLPLVSSVTGRQVTDIDAYRDVLRGQITAPVRWDRCVAALLEHGARTFI
FT                   ETGPGRVLTGLGRELARQAKHHSAQQALRMPDLWRPARQGTAPPLGGGRPETTPFSTME
FT                   ARR"
FT   gene            complement(243445..243864)
FT                   /locus_tag="Tcur_0222"
FT   CDS_pept        complement(243445..243864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0222"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   aeh:Mlg_1351 holo-acyl-carrier-protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95827"
FT                   /db_xref="GOA:D1AEL1"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL1"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACY95827.1"
FT                   /translation="MSAADGARFTDSGGVDLADALRLGRAAERTGPAVLARALTERELC
FT                   ECRLAGDRFITEAAIRFSIKESVVKALGGLPPGGRLRDIEVGPAAGDALHRRVRLHGPV
FT                   RERAAARSGEELRAGAAEWAPGLVLGWAIGTTGRS"
FT   gene            complement(243939..244673)
FT                   /locus_tag="Tcur_0223"
FT   CDS_pept        complement(243939..244673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0223"
FT                   /product="thioesterase-like protein"
FT                   /note="KEGG: mxa:MXAN_0761 thioesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95828"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL2"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0761"
FT                   /protein_id="ACY95828.1"
FT                   /translation="MQALAGAFGDGWRARSLSVHFASPVTPGPVLISTNVEHTGRRTGI
FT                   AQARVSQGERLALTATATFTPGLSGPEFTEAAMPNVPEADLCQVLPEIPDLLPEFFTQF
FT                   EHRPCLGALPFSGATDSQTASWVRPRDLFCKNEEALLTVLSDCWMPAMFTRLPEPKTMA
FT                   TLSMNIHFRNAPGDLREPGREHLLVVAHSRLAHSGLCDQHIDIWSAPGTLLAQAHQLCM
FT                   LLEPRGGTQDHHRSDDREMSTI"
FT   gene            complement(245168..246637)
FT                   /locus_tag="Tcur_0224"
FT   CDS_pept        complement(245168..246637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0224"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcm:Bcenmc03_5634 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95829"
FT                   /db_xref="GOA:D1AEL3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95829.1"
FT                   /translation="MSATQAPATEGRELESGPSRWLMVAVLGGMFLSMLDQTIVGPALP
FT                   DITADIGGENLYSWFVSAYLLTTTVSVPLYGRLSDVYGRKPLLLTGLGIFIAGSALCAL
FT                   AQTSWQLIAARALQGLGAGALIPLSLALLFDLFPGRAMGKVQGWIGAVMGVSYVTGPML
FT                   GGLLNDHAGWPWIFLVNVPIGVVLAAVVVIRLPHRPGTAERARPDYLGIAVFSAAVSLL
FT                   MVGLTQKGLTGADGRLHHWTDWPVLGYLLAALALLAVFLLIELRVSEPLIPLGLFRNPV
FT                   YTATNVASFATAFAMYSAIIFLPRYLRDARDYSAVASGVLIYPLLIGIVVGSFAAGAII
FT                   GATRRYKLLLASVQLLTGIGAVCFLWLEADTPLPVLSVWMATLGLGIGPMLSGLTITVQ
FT                   NSVPIEHIGTATGKVTFFRQIGGAVALTFAGSIYMETMTDHAPAVGPQQAAAEAAAQVL
FT                   PLLGALGAGTAFLAMLLVPRRPLWLLGDGGD"
FT   gene            246749..247312
FT                   /locus_tag="Tcur_0225"
FT   CDS_pept        246749..247312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0225"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: vcm:VCM66_2567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95830"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL4"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACY95830.1"
FT                   /translation="MSLRMAVLGLLAGLGPASGYDLTQRFDASLAFVWYAQHSQIYPEL
FT                   NRLAAEGLIEVAQEGPRGRKTYAITPAGREAVTRWLQHAEPAPTRRNEGALRAFLLPLL
FT                   DPAEAVKVLQREAAFYAERVRELQNLRGLADSAPHRFGRHALELGIRQMTAIREWAEWA
FT                   AQDLAGGTEEVAEKTPESSESAER"
FT   sig_peptide     246749..246808
FT                   /locus_tag="Tcur_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.991 at
FT                   residue 20"
FT   gene            complement(247416..248756)
FT                   /locus_tag="Tcur_0226"
FT   CDS_pept        complement(247416..248756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0226"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   Hypothetical protein CBG04553"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95831"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL5"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACY95831.1"
FT                   /translation="MDRCALFVDAGYLLADGAMAVHGTRHREAVSWDFAGLLQLLSNLG
FT                   RERTGLPLLRCYWYEATVEGRRSPEHEALADLPGLKLRLGRIRPGRREGVDAEIQRDLM
FT                   TLARNRAIADAVLVGGDEDMAPVVAEAQEFGVRVTVVHVAVDGNWTISRVLRQECDDLI
FT                   EIGAGHLRPYVNLISGLDQGKGGSVSPLSNGHGSTGSGGRTTIAPLQTTGPLSSPPPGS
FT                   PITGQPVGGGSSSPTAGATPAPSGNANGGQGYGGGMRALGGSALEQPSGPPPPSAGFSG
FT                   AGGTGGSSAASTGPQLPPPPVQPSTAPAPASPPAAPGGGTGPYNASPAPAAPPSRPSGP
FT                   QPAVPPAPYNGPQQLSPVPAAQQNTPTLADAVKAAHKEGQDFGESVARDAPALWLEAVL
FT                   ARKPRMPSDLEARLLQGSSLPIDFLLHDEVRHALRRGFWDALERSRR"
FT   gene            complement(249095..250699)
FT                   /locus_tag="Tcur_0227"
FT   CDS_pept        complement(249095..250699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_0508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95832"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95832.1"
FT                   /translation="MTELVLGPLLRHVDDRTATVWVETDRPCTVEVLGSSAPTFTVHGH
FT                   HYALVEVTDLEPGSRTPYRVLLDGRPVWPEPGERRFPPSVIRTRRPGEAVRLVFGSCRR
FT                   SPDPGGVHGPDALSAYAHRLAASEDAEWPSALLMIGDQVYADELGPEIEEFIHRRRGAG
FT                   SEPVGELADFEEYAHLYRLAWRTDPAVRWLLSTVPTYTIFDDHDVRDDWNTSHAWRERM
FT                   WALPWWRRRIVGGIGSYWIYQHLGNLSPRERAADSLYAAVRRAGGDAGEILDEFAERAD
FT                   KDPACARWSFTRDFGGTRLVMVDSRCARLLTPGRRAMLDDSEQRWLTQQLRGGFDHLLI
FT                   ASSLPYLLPRSIHHAENWNEAVAGGAWGRALAGLGERMRQAADLEHWAAFEASFRTMAR
FT                   DVLAVARGERGPAPASVAFLSGDVHYSYLAKVTAPVTGAAPISQVVCSPLRNPLAGPFR
FT                   WANVLACKPGLAAPLRALAAAAGVPRPPLKWRITRGPWFDNMIATIEISGRDCRVRWEA
FT                   ATGGGRLAERGTAALSA"
FT   gene            250952..251872
FT                   /locus_tag="Tcur_0228"
FT   CDS_pept        250952..251872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0228"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bac:BamMC406_1201 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95833"
FT                   /db_xref="GOA:D1AEL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95833.1"
FT                   /translation="MTKAGRQPRMDGRVVVVTGAARGLGELLARKLAARGARLALLGLE
FT                   PTRLAEVAESCGEHAGWWEVDVTDDAAMAKAASEIRARYGRVDVVIANAGIATGGPVEH
FT                   SDPRTFARVIEVNLLGSVTTARAFIPALRESKGYFFQVASLAALCAAPMMAAYCASKSG
FT                   VEAFAHSLRAELAAHGVDVGIGYLSWTDTDMVRGADQNEVLRQMRAGLPFPANRTYPLE
FT                   PTVERLVDGIVRRRAHVYGQRWLPAMQLVRGLIPAVVTRHARRVMAEFETRWLAAGGDT
FT                   GLVGAGGAAASAALSEPDRRAASAD"
FT   gene            251902..253221
FT                   /locus_tag="Tcur_0229"
FT   CDS_pept        251902..253221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0229"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   scl:sce5736 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95834"
FT                   /db_xref="GOA:D1A1B2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY95834.1"
FT                   /translation="MLSTMQDARLQIRRLLEHGAALHASATVDTAAPGGLRRVPYARIG
FT                   ADAAALAHALGELGVGEGDRVGTFMWNNAEHLTACLAVPSMGAVLHPLDARLPGEQIVR
FT                   LAEHAEDRVLIADEALLPHLGPLLPQMKTVEHVIVNRAGGTGAGPAVPSGVTVHEYAAL
FT                   LDGRPPAYPWPDLDERAPAAICYAGDGSRAPKGVVHSHRSIYLHALSAAMPDAFGLSSG
FT                   DKVLAVVPPSCALGWGLPYLAFLTGASLAMPDRFQAPQALAGFIAASRPTKGAAPLRVW
FT                   RDLLAHIEADPDADLSSLTEVFADGRPCSPDLLEGYERRGVTLLHVWGAAAAPARPPAD
FT                   ATGAGARHYRLAQGRLPASVQARLVGPDGAALPHDDFSVGELQLRGPWIAGSYHRDEAP
FT                   GDFHDGWLRTGETGRISPDGYLTVTGRLADARRDDHAGAG"
FT   gene            253587..254849
FT                   /locus_tag="Tcur_0230"
FT   CDS_pept        253587..254849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0230"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: avn:Avin_43380 carbohydrate diacid
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95835"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95835.1"
FT                   /translation="MTLMASDRQVPPWSLVPPQAAALLRRYQADLATEIFDEVRAQVPE
FT                   YAWREAPERRAEMAEATRRTVAEFANLMGGPAPTWPRHLLEHFMEAGAEEARAGRGLEL
FT                   LQAALRAGARAALRWLAVQSERLRLPGEVYRVFAEMVFTTLDELAAAAAEGHRRELARQ
FT                   GGDRARHRTRLLSLLATEPPVAPEVIADAAAQAGWAVPRSMAVLLLAPLDEAGGRDAPE
FT                   DWAQREEPAPPNLPAEVLMDGRGSRPWGIVPDPERPGGLPFLADLPAPWVAVLGPTVSA
FT                   REVGTSRYWAQQTLSLVERGLIPRGPGRRPVISWADHLPTLVLFQRPELPRMMARRLLA
FT                   PLLRLRPREAERLGLTLLTCLQHGFNVKNAARALHVHPQTVRYRIHRLQELFGQDLHAA
FT                   DRRLEMEMALHAWLADPFFEE"
FT   gene            254960..255712
FT                   /locus_tag="Tcur_0231"
FT   CDS_pept        254960..255712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0231"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: pap:PSPA7_1798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95836"
FT                   /db_xref="GOA:D1A1B4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B4"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACY95836.1"
FT                   /translation="MAQPRRPEREYRIEELAKEAGIPVRTLRYYQERRLLPPPRRQGRV
FT                   AYYSQAHLDRLRLIAELLERGYRLDGIEELLAAWEQGRDVGELLGFEWAAAAPWSRQPE
FT                   IEMTMAELTEMFGDQLTPDVLAEAEELGYIKVDGDRVTHRIPRLLEATAALVQEGIPLS
FT                   AILAVSWELEAAFDRMAYAFVRLARRHLLDPLGDNPTPADLARLARTVERLRPVARTVA
FT                   DEHFARAMDRRIRKELPQLNARLSPPDH"
FT   gene            complement(256076..256612)
FT                   /locus_tag="Tcur_0232"
FT   CDS_pept        complement(256076..256612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0232"
FT                   /product="adenylyl cyclase CyaB"
FT                   /note="TIGRFAM: adenylyl cyclase CyaB; PFAM: adenylate
FT                   cyclase; KEGG: rso:RSc1389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95837"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B5"
FT                   /inference="protein motif:TFAM:TIGR00318"
FT                   /protein_id="ACY95837.1"
FT                   /translation="MREVEVKFRVRDAESLQAALKAQGIEPGEPIHQDDQAYAPVGWRF
FT                   GDSKLGVSFVRLRTVNGRHFFTLKQPRENAQSCLEYETEVADREQMHHAIVHMGFYPTV
FT                   RVAKTRRTAKVGDITLCVDDLDGVGTFLELERMIPADAPVIEAQRQLAAFVAGLGIDAE
FT                   HTDETYDSLVRAAQG"
FT   gene            complement(257051..257206)
FT                   /locus_tag="Tcur_0233"
FT   CDS_pept        complement(257051..257206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95838"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95838.1"
FT                   /translation="MRKIDSIKGNGKKGKKEADPAFRFGGRHAALARGARPNARRLPTR
FT                   NMTRGR"
FT   gene            complement(257648..260239)
FT                   /locus_tag="Tcur_0234"
FT   CDS_pept        complement(257648..260239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0234"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: acp:A2cp1_0414 ATP-dependent chaperone ClpB;
FT                   TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95839"
FT                   /db_xref="GOA:D1A1B7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B7"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACY95839.1"
FT                   /translation="MDYKLTRKSQEAVSIAVRRAAAEGHPQVEPLHLLVALLALPEGTA
FT                   VPLLEAVGADWQAVRSAAEERLARLPRAAGSTVSSPQMSRQLIMAMNTAGNRARQMEDE
FT                   YVSTEHLLVGLAADGGEAAQVLREAGATPQALLEAFEKVRGHARVTSEDPEGTYQALEK
FT                   YGVDLTARAREGKLDPVIGRDTEIRRVVQVLARRTKNNPVLIGEPGVGKTAVVEGLAQR
FT                   IVAGDVPESLKGKRLVALDLGAMVAGAKYRGEFEERLKAVLNEIKSSEGQVITFIDELH
FT                   TVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRERIEKDPALERRFQQVFVGE
FT                   PSVEDTIAILRGLKGRYEAHHQVQISDAALVAAAALSDRYITARFLPDKAIDLVDEAAS
FT                   RLRMEIDSRPVEIDELQRTVDRMRMEELALAKESDEASKQRLERLRRDLADKNEQLNAL
FT                   IARWEQEKAGLNRVGELKKRIDQLRGEAERAQRDGDLETSARITYGEIPALEKELKAAA
FT                   EQAEKRDAMVKEEVGPDDVADVVASWTGIPAGRLLEGETAKLLRMEEEIGRRLVGQTQA
FT                   VKAVSDAVRRARAGVSDPDRPTGSFLFLGPTGVGKTELAKALAEFLFDDERAMVRIDMS
FT                   EYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYCVVLLDEVEKAHPEVFDILLQVL
FT                   DDGRLTDGQGRTVDFRNTILIMTSNLGSQYLVDPTLSSEAKRESVMNTVRASFKPEFLN
FT                   RLDDIILFEALSTEDLTRIVDLQVARLAKRLADRRLKLTVTDAAREWLALTGYDPLYGA
FT                   RPLRRLVQTAIGDQLARELLAGTIGDGDEVVVDLDEAADRLTVKPAASLTK"
FT   gene            complement(260267..260725)
FT                   /locus_tag="Tcur_0235"
FT   CDS_pept        complement(260267..260725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0235"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: nis:NIS_0956 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95840"
FT                   /db_xref="GOA:D1A1B8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B8"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACY95840.1"
FT                   /translation="MDHFGDDTPVYVISVAAQLSGLHPQTLRAYDRMGLVSPNRTAGRG
FT                   RRYSMRDIVMLREIQRLSQEEGINLAGIKHILELQRETERLRQELAQLRATIEELSNEL
FT                   ESTRAVAARLAAQLRHGPPAQGAGPSGGDLVPIRRTSVVLWRERNQGI"
FT   gene            complement(260931..262073)
FT                   /locus_tag="Tcur_0236"
FT   CDS_pept        complement(260931..262073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0236"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: seg:SG0013 chaperone protein DnaJ; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; DnaJ central domain protein; heat shock protein
FT                   DnaJ domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95841"
FT                   /db_xref="GOA:D1A1B9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B9"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ACY95841.1"
FT                   /translation="MSTKDFLEKDYYKALGVSKTATQDEIKKAYRKLARKYHPDANRGD
FT                   AEAEERFKEISEAYDVLSDEKRRREYDEARRLFGAGGFRRGQGGGFGFDLGDLFGQGPG
FT                   ADRFGDLFGGLFGRTGTRAGARRARRGADVETEVTLTFSEALEGVTVPLRLTSEAACAS
FT                   CQGTGARAGTMPRVCPSCEGTGQETRNLGSFGFSEPCRVCRGRGMVVDDPCPTCHGSGR
FT                   ATGTRTIQARIPAGVADGQKIRLKGKGAPGEHGGPAGDLYVTIKVTPHKVFGRSGDNLT
FT                   VTVPVTFAEAALGAQIKVPTHRGMPVTLKIPPGTRNGRKFRVRGRGAPRRDGTKGDLLV
FT                   TIEVQVPQKIDDTMREALEKLRAAEDGDALRSGLLLQARE"
FT   gene            complement(262235..262891)
FT                   /locus_tag="Tcur_0237"
FT   CDS_pept        complement(262235..262891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0237"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: EMB1241 (EMBRYO DEFECTIVE
FT                   1241); adenyl- nucleotide exchange factor/ chaperone
FT                   binding / protein binding / protein homodimerization;
FT                   K03687 molecular chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95842"
FT                   /db_xref="GOA:D1A1C0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C0"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACY95842.1"
FT                   /translation="MTSPSPKKDEEREGLVIRDRRRIDPETGEARERSAKDTASKPSGE
FT                   SGAPKPSAPSADAEEVAKLKAQLEERTADLQRVQAEYSNYRKRVERDRVAVREQALANV
FT                   LTELLPVLDDIGRAREHGELTGGFKSVSEALEATLGKLGLQQYGEKGEPFDPTVHEALV
FT                   HSYSTEVTETTCVEILQPGYRLGERILRPARVAVADPQPEEDKQESAGEENSAEE"
FT   gene            complement(262888..264741)
FT                   /locus_tag="Tcur_0238"
FT   CDS_pept        complement(262888..264741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0238"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: gme:Gmet_3532 chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95843"
FT                   /db_xref="GOA:D1A1C1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C1"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACY95843.1"
FT                   /translation="MARAVGIDLGTTNSVVAILEGGEPTVIANAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVDRTIRSVKRHMGTDWKIDIDGKKYTPQEISARVLQKLKRDAE
FT                   AYLGEKITDAVITVPAYFSDHQRQATKEAGQIAGLNVLRIINEPTSAALAYHLEKEKEA
FT                   TILVFDLGGGTFDVSLLEVGDGVVEVKATSGDNHLGGDDWDNAIVNWLVERFKNAHGVD
FT                   LSKDKMAMQRLREAAEKAKIELSGATETQINLPYITASSEGPLHLDEKLTRAEFQRMTA
FT                   DLLERCKGPFNQVIKDAGVSVKDIDHVVLVGGSTRMPAVSDLVRELTGGKEPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKIIERNTTIPTKRSEVFT
FT                   TAEDNQPSVEIQVYQGEREIAAYNKKLGTFQLTGLPPAPRGVPQIEVTFDIDANGIVNV
FT                   SAKDLGTGKEQSMVITGGSALPKDEIERMMREAEQHAEEDRKRKEEAEVRNQADTLAYS
FT                   TEKFLRENSEKVPEDVKKEVEEAVADVKKKLEGSDVDAIRASAEKLAQVSQKMGAAMYA
FT                   QSSGEGAQAGGANAQAGSDQGGDDEVVDAEIVDDDKKGGAA"
FT   gene            265352..265855
FT                   /locus_tag="Tcur_0239"
FT   CDS_pept        265352..265855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95844"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95844.1"
FT                   /translation="MVPGRVPAGLHRARAHRPHAASGERNVQAHAAGDTAQAPRLTRAP
FT                   LVDGDKIFWLGRNVTMKNLRALPADPARLKAELLKWYRGHGTEAAGDPMSADVRLFTVT
FT                   QGLILDMPITPKVRAAAFRMLAGLDSVKAAGPVRDGPAPHPADPGAFVMEPAGNDGAFR
FT                   TTSR"
FT   gene            265878..266231
FT                   /locus_tag="Tcur_0240"
FT   CDS_pept        265878..266231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95845"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95845.1"
FT                   /translation="MRAVDEEAERFTAIYDACRRHVWAYAVTRAGRQTAWRRAGRSGIG
FT                   PAARGVVRCSCWNKGTVFGQVVVLEPGTYRLLGRQRTVVRAGGRARGMAPGTVPDHSVI
FT                   RSMGGTDGQPEKP"
FT   gene            complement(266283..266999)
FT                   /locus_tag="Tcur_0241"
FT   CDS_pept        complement(266283..266999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95846"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95846.1"
FT                   /translation="MKRPLRRLTVLASATAAALAALISPPAASAAQAADEFADCPSLPA
FT                   DARPLTWKCYVLTAEDTLIGVSLGRMHAHTKEPIRLTVAQGSLTNGKTVAKLGALRANP
FT                   IPFVTGVPGTPFEVPHPTGWKLEITPTGMIEPGILVPHKLGVTARIIGDGLGDSCRVGS
FT                   SSRPIVIDPVVNWALPWVSNGKVGTRMKVADIVYSLPIATGCNGKDFTVNQLLGLPANS
FT                   VSNQFQVTWTMISKRY"
FT   sig_peptide     complement(266907..266999)
FT                   /locus_tag="Tcur_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.486 at
FT                   residue 31"
FT   gene            267337..269490
FT                   /locus_tag="Tcur_0242"
FT   CDS_pept        267337..269490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0242"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: afw:Anae109_0009 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95847"
FT                   /db_xref="GOA:D1A1C5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C5"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACY95847.1"
FT                   /translation="MYWLTLIIGLAGIAVAVALAARRVLFLYKLIKSGQPDPDRVLRVK
FT                   RDPKGDIEGQLKEVLGQRKLLKWTVPGMAHFFVMWAFLLLASVYGEAGVQLLFGLEAHI
FT                   PFLQTWGPIGFVQDTIALLCLGGLIVFTVIRIQQSPKRIDRKSRFKGSHTGGAWLILFM
FT                   IFNVIWTMFAFRGAEVANGNFSYGKAAYASYGVGKLMEGIGEPESTLMNGLESFFLLAH
FT                   IGVALVFLIIVVNSKHLHIFLAPLNVMFKRRPDGLGAAQPMMSNGKVLDFEEADPDTDV
FT                   FGRGKIEDFTWKGFLDMATCTECGRCQSQCPAWNTGKPLSPKMVILELRDHAFAKAPYI
FT                   LASEEQREKFTDEQKAAMQVDKPLVGEDGVIHPDVLWSCTNCGACVEQCPVDIEHIDHI
FT                   LDMRRFQVMIESSFPSEAGVMLKNLENKGNPWGMSEMKRLEWIEELDFEVPVVEDSMPE
FT                   DAEYLFWVGCAGALEDRAKKTTKAVAELLHIAGVKFAVLGPMEACTGDPARRLGMEFIF
FT                   QMLGQQNVETLNEAGVKKIVATCPHCFNTLANEYPQIGGNYEVIHHTQLLAKLVEEGKL
FT                   TPVTPIEEKITYHDPCFLGRHNKVYKQPRDIMATVPGVKTQEMHRHKDRGFCCGAGGAR
FT                   MWMEERIGKRINTERVDEALGTDPDTVSTACPFCLVMLGDAINEKKNAGQAKESLEVVD
FT                   VSQLLIRSIKGEDAAPKETVAAE"
FT   sig_peptide     267337..267399
FT                   /locus_tag="Tcur_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.934 at
FT                   residue 21"
FT   gene            269520..269612
FT                   /locus_tag="Tcur_0243"
FT   CDS_pept        269520..269612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95848"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95848.1"
FT                   /translation="MTAGASSRSGAGYGKPEPDGGSIGPDVQFS"
FT   gene            complement(269703..270278)
FT                   /locus_tag="Tcur_0244"
FT   CDS_pept        complement(269703..270278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0244"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: yen:YE2782 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95849"
FT                   /db_xref="GOA:D1A1C7"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C7"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ACY95849.1"
FT                   /translation="MLLSDRDIRAEIEAGRVKIDPFDPEMIQPSSVDVRLDRYFRVFEN
FT                   HKYPHIDPAVEQPDLTRLVEPDGDEPFVLHPGEFVLASTYEMFSLPDDLAARLEGKSSL
FT                   GRLGLLTHSTAGWIDPGFCGHVTLELSNVATLPIKLWPGMKIGQMCLFRTSSPVEHPYG
FT                   SKEYGSRYQGQRGPTPSRSYLNFHRTKI"
FT   gene            270410..270483
FT                   /locus_tag="Tcur_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            270410..270483
FT                   /locus_tag="Tcur_R0007"
FT                   /product="tRNA-Gly"
FT   gene            271004..272044
FT                   /locus_tag="Tcur_0245"
FT   CDS_pept        271004..272044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpr:GBP346_A2207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95850.1"
FT                   /translation="MMPPTKHRRPGWDPAKLRERREAHGLTLEAASEKLRQVARRSGLR
FT                   VAANFHTLWGHETGVVYPGPHYRRAYCLMYEATEPELGFRLPLPDEQTLDLSALVGSLA
FT                   DPATTGQAASAIAKGLDQVSEHVRSDGLAVAETLKARIVNGWRGRALARSLGTTTLVLV
FT                   GGYAGSGKTEFARFLGDVSGWAILDKDSLTGRMTERLLISLGGDPHDRHSETYLKEVRP
FT                   LEYECLMDAANDNIERGISTILSAPFIAEFRDEAWLAGLTNRCRAKGVDVVAIWVRCDA
FT                   ESMREYIEFRDAPRDAWKLAHWDEYVSTLDTENSPPGVHLRVDNRMGAAISVADRMRET
FT                   LRRLLG"
FT   gene            272041..272658
FT                   /locus_tag="Tcur_0246"
FT   CDS_pept        272041..272658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: guanylate kinase; K00942 guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95851"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95851.1"
FT                   /translation="MTDQGVILYGPPASGKDTITGELAELDERFTLVPKLKAGTGRSTG
FT                   YRMVTAAELETLRGMGRLVVETSRYGNVYAVDRHDIEAMTKAGRVPVVHMGNVADLQRL
FT                   RLSVPLEWTCVLLWAPREVCARRSRGRGDADRPARLRAWEETRADLAAHRDEAVFHLLI
FT                   RTDETEPGRAARRIIDAVAEGPHRALPLSGLDHSSPASRAIT"
FT   gene            complement(272595..273026)
FT                   /locus_tag="Tcur_0247"
FT   CDS_pept        complement(272595..273026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95852"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95852.1"
FT                   /translation="MNESSLVAGGEAGKRLTAAYAHGPASPSPLVREVLWDFMHSDGGP
FT                   EWTPGADEGYHGRHVRERRRDCESIHWQRRRPPLTRTRVLAHTCECRATIYELCARGGA
FT                   YFIRRTTRGPRGIEVDESPHVIAREAGELWSKPLSGRAR"
FT   gene            complement(273324..273557)
FT                   /locus_tag="Tcur_0248"
FT   CDS_pept        complement(273324..273557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95853"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95853.1"
FT                   /translation="MSAVAGSVRPAVGSSNVQQWYLQAVVRVYEPWTTSKTISSKERAL
FT                   AVQRVRHASHVLADLEAQMPRENSGRWTAASG"
FT   gene            complement(273554..273877)
FT                   /locus_tag="Tcur_0249"
FT   CDS_pept        complement(273554..273877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95854"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95854.1"
FT                   /translation="MAFDQSRFESANVQGAFGPRREHLAALDAALCKRRKVLCGVVVRD
FT                   GMPLLRVTAPGAALRALEVDCEQGADGWVFTRADTKEPLGPVSDLAAVADRVAESLTGG
FT                   AIR"
FT   gene            274175..275107
FT                   /locus_tag="Tcur_0250"
FT   CDS_pept        274175..275107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95855"
FT                   /db_xref="GOA:D1A1D3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95855.1"
FT                   /translation="MATGKRREFGAYLARLRGSRSQRALAQLLCELSGTDTLTRHEISR
FT                   WERGKRVPTDWLPYLAQALGVPLTVLERAAAQARDDETPPDGSPVDLSAFFPAGDTLKS
FT                   RITNALHSRAAAGAGGNPVLVLVGGYAGSGKTEFARFLSSISGWAFLDKDALTRRMTER
FT                   LLLTLTGDPHDRHTDTYRREVRPLEYRCLLDAARTNIDCGVSIILAAPFVEEFNNPTWL
FT                   DRLTHRCKAKNVDVVTVWLHCDLDSMHEYIELRDAPRDAWKLANWDQYASTLNTDTSPP
FT                   GAQITIDNRLGAAVSLAEQTHEALRKIIT"
FT   repeat_region   275374..275598
FT                   /rpt_unit_range=275374..275404
FT                   /note="CRISPRs"
FT   gene            complement(276393..277598)
FT                   /locus_tag="Tcur_0251"
FT   CDS_pept        complement(276393..277598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0251"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: abo:ABO_1716
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95856"
FT                   /db_xref="GOA:D1A1D4"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D4"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACY95856.1"
FT                   /translation="MPTAASLSRADLEEFGRELDKIRQEVLADLGEDDAAYIRGVIALQ
FT                   RRLEVTGRALLLVSWLPPAWLAGTTALAVAKILENMEIGHNVLHGQWDWMRDPKIHSTT
FT                   WEWDNATPAAQWKHSHNVVHHTWTNVLGKDRDIGYSALRVHPAQQWHPIYLAQPFYNAL
FT                   LALFFEYGIAIYDAELERVAKGEKDAREALRQLRAVAAKAGRQILKDYVAFPLLAGPGM
FT                   LPTLLGNLTANMARNVWAHIVIFCGHFPEGAEVFTEEEIENETRAQWYLRQLLGSCNFD
FT                   GGPLLHLMSGNLSHQIEHHLFPDLPSNRYAQIAPRVRALCARFGLPYNSRPLIKQTCSV
FT                   WKRILRLSLPGGSQAPRPEETTASPGELRATAPKEAPTQAERSPNGDGKEAARKSRGLI
FT                   AR"
FT   gene            complement(277615..278697)
FT                   /locus_tag="Tcur_0252"
FT   CDS_pept        complement(277615..278697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0252"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: abo:ABO_1717 flavodoxin reductases (ferredoxin-NADPH
FT                   reductase)putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95857"
FT                   /db_xref="GOA:D1A1D5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D5"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACY95857.1"
FT                   /translation="MTTPRAAGRWNVRRWLAGTARWLTTPLTPDDYLALVNPLWSAKET
FT                   CGRVEAVHPETADAATLVIRPGRHWVPHKPGQWVRVGVDIDGVRHWRTYSLSSPPTRPG
FT                   GCVTITVKAIPDGLVSGHLVRRTPPGTILGLGRPEGEFVLPEPPPPRVLFLTAGSGITP
FT                   VRPMLHALLARPDSPDVMLVHSAPTPQEVIFGRELRELAARLPNLRLHERHTRIEGRLK
FT                   LAELPELCPDWTERAVWACGPPGLLEEVTTHWTGPAERLHIERFRPEPVAEGGEGGRVR
FT                   FTKSGREARADGGTPLLTVGENAGVLMPSGCRMGICRSCLVPLASGRVRDLRTGRVHGE
FT                   AGDLIQTCVSAAAGPVEIEL"
FT   gene            279081..279374
FT                   /locus_tag="Tcur_0253"
FT   CDS_pept        279081..279374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95858"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95858.1"
FT                   /translation="MRAAGPEVWIATADGRDVVRADAIVVVRLDGGRVTAQLRDEARQA
FT                   VTLIDGTTGVRPPPDFHRRLVRLVAELADASGAQLVRTVCDEGGWRWVAEPL"
FT   gene            complement(279382..279855)
FT                   /locus_tag="Tcur_0254"
FT   CDS_pept        complement(279382..279855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95859"
FT                   /db_xref="GOA:D1A1D7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95859.1"
FT                   /translation="MAQTQQAGGREKRKKGTPGAFSRWMQQRMNARMIRKIRRGRGHFM
FT                   GMDVLILHTVGRRSGLPRQTPVAYFPDGEDARLIVASGGGSLNPDWFVNLMAHPERASV
FT                   ELPGRDAVPVRPHVLEGAERERAWERIAAAQPRIAKYQSKSERRYPVIRLVPQ"
FT   gene            280047..281307
FT                   /pseudo
FT                   /locus_tag="Tcur_0255"
FT   gene            complement(281367..283010)
FT                   /locus_tag="Tcur_0256"
FT   CDS_pept        complement(281367..283010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0256"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: Carboxylesterase type B; KEGG: tau:Tola_1500
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95860"
FT                   /db_xref="GOA:D1A1D8"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D8"
FT                   /inference="protein motif:PRIAM:3.1.1.1"
FT                   /protein_id="ACY95860.1"
FT                   /translation="MVHPSPVPPGPAAGRRHASSRRPGRRRTFAALAASLTGLALSAAL
FT                   GATPVQAAGNAPATAPVVRIHEGLIRGVSGENGTSYLGIPYAKPPVGPLRWKPPAPPEG
FT                   WRGVRDATKPGNPCMQSKVQTPWGDLAGPGTPSEDCLYLNVHVPAKRSLRPRPVMVWIH
FT                   GGGFTIGSGAFYDGGVLAQRGDVIVVTLNYRLGAFGFLAHAGLSAESPTGSSGNYGLLD
FT                   QQAALRWVQRNIAAFGGNPRNVTIFGESAGGGSVCQNLISPLAKGLFHRAIAQSGCAFP
FT                   AAPKQTAEAAGENFAAAVGCFDVACLRAKPAEQLLAAAGTPAFDRITWGPSVDGHVVRE
FT                   QVMEAFRAGRLPRVPVIQGTTRDEARLNVATAYDLAGRVLTAEEYPQAVRRAFPSTADQ
FT                   ILARYRLSDYGTPAEALAAIYTDAQFACPSYASTALLARHTRAYAYEFSDPHAMDYLNL
FT                   PVSFPLGAPHGSEIRYIFGGVTGTPAQQALADRMLTYWTRFAHTGVPNGKGSPVWKKFP
FT                   LVQDLAPGAIKPTLTFAKDHKCDLWAQITG"
FT   sig_peptide     complement(282852..283010)
FT                   /locus_tag="Tcur_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 53"
FT   gene            284139..284315
FT                   /locus_tag="Tcur_0257"
FT   CDS_pept        284139..284315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95861"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95861.1"
FT                   /translation="MRRRLVRWMIVAALVAAAGALPGDGPHRIELHDVPETLSFFTGAD
FT                   SDRPGETGSDRRS"
FT   sig_peptide     284139..284201
FT                   /locus_tag="Tcur_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.673 at
FT                   residue 21"
FT   gene            284396..284983
FT                   /locus_tag="Tcur_0258"
FT   CDS_pept        284396..284983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0258"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95862"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E0"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ACY95862.1"
FT                   /translation="MASSNGDDRRARAAGAGAGDGARDEREGLFVYGTLRFPEVLAVLL
FT                   GRVPRLEPARAPGWRVRALPGVVYPGLVPDPACTADGTLILGLSEAEQRLLDAFEGDLY
FT                   ERRRLALEDGRHGWAYIWRGRTEPRDWDLAGFAERHLAAYVDGCRIWRARHERAMGLGR
FT                   EDHRAVLRGVARGGPDSPGIGAEHERGMEPRA"
FT   gene            285069..287186
FT                   /locus_tag="Tcur_0259"
FT   CDS_pept        285069..287186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0259"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase; KEGG: mxa:MXAN_0056
FT                   polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95863"
FT                   /db_xref="GOA:D1A1E1"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E1"
FT                   /inference="protein motif:PRIAM:2.7.4.1"
FT                   /protein_id="ACY95863.1"
FT                   /translation="MTMSVNPGHIPVKGDSLPEDRYLDREESWLRFNQRVLELAEDPAL
FT                   PLLERVRFLAIFASNLDEFFMVRVAGLTRRMATGLAVQSASGRLPREVLERTSEVAHEL
FT                   MLRHASVFRDEVLPELSKEGIEILRWDELSQTEQERLHRLFRERIYPVLTPLVVDSAHP
FT                   FPYISGQSLNLAVIVRDPDTEATMFARVKVPPVLPRFISASPDRFTPLEDVIAAHLDQL
FT                   FAGMEVVEHHVFRVTRNQDLEIDEDISEGLLQALERELLRRRFGPVVRLEVEESISPEV
FT                   LELLTGELGIEERQIYRLPGPLDLAGLHAIADLDRPELKYPPFVPSKDALPLDTDIFAA
FT                   IRERDVLVHHPYDSFTTTVQRLIEEAAADPRVLAIKQTLYRTSGDSPIVDALIDAAEAG
FT                   KQVVVVVELKARFDERANIEWARKLEQAGCHVVYGFVGLKTHCKLSLVVRQEADGTLRR
FT                   YCHIGTGNYHPKTARQYEDLGLLTAAPDVGEDVSELFNHLTGYSKQTSYQRLLVAPRTL
FT                   RSGLIQRFEREVDHHLAGRPAHIRIKCNGLVDEAIIDALYRASLAGVPVDIWVRGICAL
FT                   RPGVPGLSENIRVRSVLGRFLEHSRIFAFENGGDAEVWLGSADLMHRNLDRRVEALVRV
FT                   TDRAQRADLVRLLDMAMDDGTASWWLSGDGTWTRHQYADPPQGGEGGRGEPLLDIQRHL
FT                   MKTRRWRTVEG"
FT   gene            287189..288100
FT                   /locus_tag="Tcur_0260"
FT   CDS_pept        287189..288100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0260"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; Phosphoglycerate mutase;
FT                   KEGG: rpb:RPB_1059 NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95864"
FT                   /db_xref="GOA:D1A1E2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACY95864.1"
FT                   /translation="MKSEEGRIRAAGAVLWRRAPDGPRVALVHRPRYDDWSFPKGKVDA
FT                   GEHVLGAALREVVEETGIAVRLGRRLPSITYLKDGRPKQVDYWSATPIDAEAVFVPNEE
FT                   VDRLEWLPVAEAVERLSYERDAQVLREFAAGPLTTRPVVILRHALAGRKSDWRDDDALR
FT                   PLDDRGRAQARALAALLGVFGRLRPVSSATARCVETLLPYALASGGEVTTDRAFTVGRT
FT                   DAGRAGSRLVELACDGADPLVVCTHGEIVGDLIAELCRKFGEPVPDDPSLRKGGFWVAH
FT                   LAVDDDGTSGVAALERHWAPPS"
FT   gene            complement(288106..289740)
FT                   /locus_tag="Tcur_0261"
FT   CDS_pept        complement(288106..289740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0261"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: mno:Mnod_4215 CHAD domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95865"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E3"
FT                   /inference="protein motif:PFAM:PF05235"
FT                   /protein_id="ACY95865.1"
FT                   /translation="MADPKSQLEVERKYDADRDFTLPDLSGLPGVASVSEPRTHVLIAN
FT                   YFDTCDHRLAARGITLRRRRGGADAGWHLKIPVAPDSKNELRASLGRPQVVPAKLARLV
FT                   AVHVRGAQLRPVAVLETERTVILLRDAGGRLLAEVADDTVTGRLIDSEGAEQPGTTVWR
FT                   EIEIELGPAGTPELLRAAGERLQQAGARPASGPAKLGRVLEPVMAVPFGGHRRALPDLP
FT                   AGSAGAAVIGYLAKQVDAVISYDPKARLAEFDAVHKMRVAVRRIRSALRSYAPLLDPVR
FT                   IAPLEPELRWLAEVLGEVRDLEVLRMRFTDRLERPYGLHPAASQSWLEALSKREKSAYR
FT                   RMNTTLTQPRYFALLDALDALVADPPLSERAFRPAVAELPRLVTRQWRRLTRKYEAIAT
FT                   AKDPEEARHDARKAAKRARYAAELAAAALRELKPQAADGARPAKGKGKKRKASRRAAAE
FT                   PARSPAELAEIAAQTAAHAKRLQEVLGGYQDGVIAMQHLRAAAAERSTTPAEAFVLGVL
FT                   YGIERCEALESLSRVEATWEQTAPPAF"
FT   gene            289801..290871
FT                   /locus_tag="Tcur_0262"
FT   CDS_pept        289801..290871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0262"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; sigma-70
FT                   region 4 domain protein; KEGG: ade:Adeh_3124 RNA polymerase
FT                   factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95866"
FT                   /db_xref="GOA:D1A1E4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E4"
FT                   /inference="protein motif:TFAM:TIGR02960"
FT                   /protein_id="ACY95866.1"
FT                   /translation="MTSITRSGKQSETQVYENDQVRVGKDDAVRLERWWEAHHAELTAH
FT                   CYRMLGSAFDADDAVQETLERAWRGRGRFEASRGSARSWLYAIATNVCLDMLRGARRRA
FT                   LAMDLGPAAEPGSPLGRPLPEEHWVLPIPDRRVSPAGADPAEAAVARETIRLAFVAALQ
FT                   HLPPRQRAVLILRDVLRWRAAEVAGLLGVTVAAVNSALQRARATLRTVHPDGTEGAAPL
FT                   GEAEGDLLDRYCTAFENHDVDALVALLHEDAAMSMPPFTWWLQGREHIRRALSAPDAGC
FT                   RGSRLVPVAANGSPAFAHYVPTGPGGTFEPRALVLVDVRGGLIAGTTSFLDTARLFPLF
FT                   DLPPTPPRRPVSPDER"
FT   gene            290931..291431
FT                   /locus_tag="Tcur_0263"
FT   CDS_pept        290931..291431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0263"
FT                   /product="transcription activator, effector binding
FT                   protein"
FT                   /note="KEGG: sdn:Sden_1132 transcription activator,
FT                   effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95867"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E5"
FT                   /inference="similar to AA sequence:KEGG:Sden_1132"
FT                   /protein_id="ACY95867.1"
FT                   /translation="MSTEPKIETRPAQPYAAIPVKAPMREWGRVNALVPEVYGRLGRRR
FT                   IVPAGPLFYRYRVIGGMDVPFELEVGVPVPEPIEPDGRIIPGSIPPGRYATLTHHGHPD
FT                   GLFDAITALQEWGTAQGITWDIRREGGTEIWGGRFEFYLTDPAVEPDMTKWSIELAYRL
FT                   QDA"
FT   gene            complement(291673..292908)
FT                   /locus_tag="Tcur_0264"
FT   CDS_pept        complement(291673..292908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_2920 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95868"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95868.1"
FT                   /translation="MSTADDPRAIAARLRAEREKRGWGQRKTARFLRDATDDHQKPDLS
FT                   SFVTYVKRWESGEVRPCDPRYRAAYAKVFGVSEDELFGPRPQPSSSRPPEPHDDPDERE
FT                   RLALAARNPARLDEAVVDGLAATLAHQRRLEDSTGSGRMLAPAAEHLKLILRLLKEARA
FT                   APAARLAQTAAEASQFVGWLHTAVGAYEDASTLYDQALRLGMQSRNTDLAATALSMQGH
FT                   LAWVTGDIGAMAELSKAAAEMATATGTRAMAVQQSGRALAVLGDRQGALRSIGEAEEIL
FT                   AGGTRADDPDGLYFYGPAYLTMQRGLILSYLAEDPAQHGAAAGLIASGIQALAADVRNS
FT                   EWVAWYRVRAAAAHARGGDITEAVTGLRTALGIVTGTGGGRTRAELVKTHRALIRRWPR
FT                   HPGLAELGEALR"
FT   gene            complement(293058..293540)
FT                   /locus_tag="Tcur_0265"
FT   CDS_pept        complement(293058..293540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0265"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vha:VIBHAR_01508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95869"
FT                   /db_xref="GOA:D1A1E7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY95869.1"
FT                   /translation="MTFREAVRDDLPTIVRLLADDPLGSTRETPGEELPEPYWRAFEAI
FT                   EKDPNNAIIVAEIDGEIAASLQLTYIPSLTYTGGERAQIEGVRVASEYRGKGVGQALIN
FT                   WVIEQARARGCRVVQLTTDRQRPNAIRFYQKMGFRPSHMGMKYPLIEKPGQIDPDS"
FT   gene            293962..294243
FT                   /locus_tag="Tcur_0266"
FT   CDS_pept        293962..294243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0266"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95870"
FT                   /db_xref="GOA:D1A1E8"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E8"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ACY95870.1"
FT                   /translation="MLNPDKHWTDYAICRGADPELFYPINYTVPVMAEQVEAAKAICGN
FT                   CPVKAECLDWALRAGEPDGIWGGTTPEERRYIRREMRRGERTGRIVAA"
FT   gene            294300..294974
FT                   /locus_tag="Tcur_0267"
FT   CDS_pept        294300..294974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0267"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: dat:HRM2_28470
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95871"
FT                   /db_xref="GOA:D1A1E9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY95871.1"
FT                   /translation="MGTFIRAGALSQQRDPYGGCQMNDPLVPRRSRSEGLATHAARAVS
FT                   AAVLVGTVTAVMWVLEALDYALGGALDRYGIRSYDLGELPDIFTAPFLHGGFGHLMANT
FT                   MPFLVLGFLAAVRGIGRFLAASLIIIVVGGLGVWFTGSPSVETLGSSILIFGYFGYLLS
FT                   RGLFERSLLDLAIAVVVVLSYGTMIYGILPTHPMISWQGHLFGLIGGVLAAWVLRRRDA
FT                   WS"
FT   gene            complement(294991..295746)
FT                   /locus_tag="Tcur_0268"
FT   CDS_pept        complement(294991..295746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0268"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bac:BamMC406_3907 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95872"
FT                   /db_xref="GOA:D1A1F0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95872.1"
FT                   /translation="MGTYLITGATGGIGAAVAELLADRGHDLVLVGRSPERLAQVTARL
FT                   GGVQARTQVLYRDAAGAPRAADAGRRGTVLPVVLDLTEPRRIEAALAAAGLPDRLDGVV
FT                   HSAGVVELGTVAELDADRWIEQIMVNLVAAAELTRLLLPALRAAEGQVVFVNSGAGLRA
FT                   NPGWSAYAAGKHGLKALADALRAEEPRLRVTSVYPGRTATEMQRKVRAQEGRPYRPEDF
FT                   IDPMTVARVIVNALETPRDATITDVSVRP"
FT   gene            complement(295813..297285)
FT                   /locus_tag="Tcur_0269"
FT   CDS_pept        complement(295813..297285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_01273 putative membrane-associated
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95873"
FT                   /db_xref="GOA:D1A1F1"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95873.1"
FT                   /translation="MPDPTSVETLELTAAETRVWEAYPTGTMVVLGENRPDEPLPERTV
FT                   RAEVISRLLLGAREGRPGHVPAVKLRGAYIRGRLRLSGGTIECELRLERCHFDEVPDLS
FT                   NARTRQLRMSECRMPGLDAGGLQADGYVSLSRSRIDGEVRLQRAQISGGLRMNDVIVTQ
FT                   SDPNRWALFGGGLVVDAGAFLRDAEFNGGVRLVGARMNGGLFMEGALLCNPSGPALDAQ
FT                   NIVVEDAAEFSAGFIAEGMVRLRGAKVHGTLSFDLATLRAGADPRALQATLMQVEEMLF
FT                   RPTEPVNGRVALSYSHIGTLRDGGPMVWPRELWLRGLTYDALRGCPPEERLRWVGREEY
FT                   HPQPYEQLASWYRQIGHEDLARKAMLAKMRARRRTLSLPARIWSHLLDWTIGHGYRPWM
FT                   AAVWVALLLIAGTVVFSVEPPRSIRPPEERPHYNAFIYTLDLLIPIGTFGRRELFDPVG
FT                   WTEWVAYVLIASGWILVTALIAGATRVLRPNA"
FT   gene            complement(297449..298237)
FT                   /locus_tag="Tcur_0270"
FT   CDS_pept        complement(297449..298237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0270"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: vsp:VS_1221
FT                   putative sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95874"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F2"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ACY95874.1"
FT                   /translation="MVFKKLLKAMGVGGPSVETVLHNPNTTPGGTISGDVHLMGGEHDS
FT                   DIRYVSVALRTRVEVESGDSEYNTNMEYAKVQLTGPFQLRKGARHSLPFTLQIPWEAPL
FT                   THMYGQPLHGTTVGVATELEVARAVDATDLDPIAVHPLPAQERILAAFANLGFRFRSAD
FT                   CERGYIRGIRQELPFYQEIEFYPPPQYASGINELEVTFVASPHSMEVVLELDKRGGLFT
FT                   EGHDSLTHFTVDYASVHTTNWEHELQQFLNQAARRRGLFF"
FT   gene            298786..300618
FT                   /locus_tag="Tcur_0271"
FT   CDS_pept        298786..300618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0271"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mxa:MXAN_0422 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95875"
FT                   /db_xref="GOA:D1A1F3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACY95875.1"
FT                   /translation="MGHYKSNLRDLEFNLFEVFNRQELLGKGPYADLDEETARSILEEV
FT                   NRLATGVIADSFEDADRNPPVFDPESGTVTMPESFKKSYQAYMDAEWYRADLVPEFGGT
FT                   GAPRSLTWAIAEQILGSNPAVFMFASGPGFAQILWQIGTPEQKRFAELALERKWGATMV
FT                   LTEPDAGSDVGAGRTKAIQQPDGTWHIEGVKRFITSAEHDMAENIFHLVLARPEGAGPG
FT                   TKGLSMFLVPKYLVNLETGELGERNGVYVTNVEKKMGLKVSTTCELTFGEKHPAIGYLV
FT                   GGVHEGIKQMFLIIEYARMMVGTKAIATLSTGYLNALEYAKQRVQGGDMTQMADKTAPR
FT                   VTITHHPDVRRSLMTQKAYAEGMRALVMLTATYQDAIQVAKHEGREDKLAEKLNDLLLP
FT                   VVKGFGSERAYALLGSESLQTLGGSGFLQDYPIEQYIRDSKIDTLYEGTTAIQGMDLFF
FT                   RKILRDNGEALRHLAGEIKAFVASDAGNGRLKTERALLGKALEDVEGILNPMIGWALAS
FT                   TENPKEIYKVGLNTTRLLMALGDVIVAWLLCRQAEVALNKLAGEVSEEDRAFYTGKVVA
FT                   AQFFCANVLPRIAADRAATEATTLDLMEMPEEAF"
FT   gene            300853..301326
FT                   /locus_tag="Tcur_0272"
FT   CDS_pept        300853..301326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dno:DNO_1166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95876"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95876.1"
FT                   /translation="MCVPESSFDALLARAKEIDGLEFGCVLDAATGMVLGTVRADKARE
FT                   SGGADGRIPVAAAGAADVAGAVSLMAGALAADEGLEDVIITLTGHYHLIRRFDPTPRLQ
FT                   FLLLVVLDRARANLAMALRQLRDLHVDPPPVPEPVGGRHREAPGPGEGDGVLS"
FT   gene            301310..302035
FT                   /locus_tag="Tcur_0273"
FT   CDS_pept        301310..302035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95877"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95877.1"
FT                   /translation="MAYFHREPIAVRLGKLADSGRSGVLRVSGDCGGVIYLSEGEVLYA
FT                   ESQRTPALAAWPVIPPDSTGRGASWAEPGAPGSLEWEYSVREATMDAALELIAGSGRNP
FT                   PKHRFRESGTLRIEGTNGIPVPALLAEVERRRRVLEQLSALLTPDTVVVRNPRFDPPAL
FT                   QVSAAQWTLLRHMGDRATPRELALELGCSVFGTTIEVFRLVVLRLLAVAGVPAPPVPAG
FT                   GSAWPDPRRSTVSFLRAVL"
FT   gene            302089..302535
FT                   /locus_tag="Tcur_0274"
FT   CDS_pept        302089..302535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0274"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   bbt:BBta_6136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95878"
FT                   /db_xref="GOA:D1A1F6"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F6"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACY95878.1"
FT                   /translation="MTGPGTETAPLEERLRAELRRLREQVVGVHGSLIATSDGFLVAHD
FT                   TDAEEPSQLAALVATTLGLARQTTQATGRGRFREAVVRGEDGYLAVYALGETAILAVIG
FT                   GEDLNVGMLHYQTRDAAKRMTVLLAGSSWSRYGHNLPYGSFGHR"
FT   gene            complement(302747..303610)
FT                   /locus_tag="Tcur_0275"
FT   CDS_pept        complement(302747..303610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGP9; AGP9 (ARABINOGALACTAN PROTEIN 9)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95879"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95879.1"
FT                   /translation="MVGNFRGTVFLEDGRITFAESPGIPDPAARLVGSGRLSEDQWPVP
FT                   RENPARDTGALLLERGLLGEEELRAVLHSVVLDVLIALLADRSPAADVRFAPLERHWAG
FT                   RLLALNPGAALAEAERRSALPAVRRVSPRARPKACELLRPWAVLRREHWPLLQRADGVR
FT                   TVRDLAWHSGLALHDTIESVDALAHAGLCVLLPPVPHPDVPEPAARPPGQTAPPPRPAL
FT                   PAPPSSAAPAADPPLPHRVRGASAPPGADALLAAAPRVHDDEQPVFTAHPDVLRRVLEG
FT                   LKRLGR"
FT   gene            304016..304429
FT                   /locus_tag="Tcur_0276"
FT   CDS_pept        304016..304429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95880"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F8"
FT                   /inference="similar to AA sequence:KEGG:Daci_1596"
FT                   /protein_id="ACY95880.1"
FT                   /translation="MNLTHIVNTALKSFRQDVPDYVASGIVDLSTGMLLAIDTVDHHPR
FT                   EILDVVAAATADLFQGRTIVHIEELWKQHRGTPDTGHYFNEILVNSENLVHLFLRSRTN
FT                   PDIVAVVICTRQVNVGMLFAQARRVFKELENAR"
FT   gene            complement(304466..304915)
FT                   /locus_tag="Tcur_0277"
FT   CDS_pept        complement(304466..304915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0277"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bgl:bglu_1g18830 transcriptional regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95881"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F9"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACY95881.1"
FT                   /translation="MPKDVSPRPCSIADTLELVGERWSLLAIREIFHGVRRFDGIVRNT
FT                   GASRDILTARLRKLEAAGILRRERYSDHPPRFEYHLTPAGRDLGDVLLTLMKWGDRYLN
FT                   PDDPPVRWQHSCGNVLDPVVTCAHCGRPARQGAHSPTGRGVRADR"
FT   gene            complement(304998..306401)
FT                   /locus_tag="Tcur_0278"
FT   CDS_pept        complement(304998..306401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0278"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_4007 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95882"
FT                   /db_xref="GOA:D1A1G0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95882.1"
FT                   /translation="MTRPDTRTGAPPEARPSTGRLGPVFAVVAAGVAMSNLDMFIVNVA
FT                   LPEIGEEMSGSSLPALSWVLNAYAVVFAALLVPLGDLADRVGARRTYLAGVAIFTAASA
FT                   LCAPAPSVWALVAARIVQAAGAAMLTPASLSLLLAAAPPERRTAAVRGWTAISGLAAAL
FT                   GPVAGGLLCQAGWRWVFLVNLPVGAAALVAGLYVLPRTAAVRNARRHDTAGAGVLTVAV
FT                   AALALGLVRSDEWGWASAEVIGCLAAAALLAAVFAVRSARHPDPIVPPALLRVPAFGSA
FT                   TLANVLFAVAFAAMLLSAVLWCQEVWRWSPLRTGLAITPGPLMVPALAVGAGPIVRRVG
FT                   AAAVAAAGCAVFAAGIGWWAVVLEPDGGYLTGMLPGMLLTGVGVGLTLPTLISAAVAAL
FT                   PPHGFATGSAVVTMARQVGMVLGVAMLVAALGGTDEAEAAFAGGWLLTLSATAAAGAAA
FT                   AFIRRGRPA"
FT   gene            complement(306601..306834)
FT                   /locus_tag="Tcur_0279"
FT   CDS_pept        complement(306601..306834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95883"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95883.1"
FT                   /translation="MPSKAPLALLRSLLALVTTLSPASVPALAVAAGTTVAVTASCASP
FT                   GDEDDGDDGDDDRDRGDHDGDDHHDRDDRDGD"
FT   sig_peptide     complement(306745..306834)
FT                   /locus_tag="Tcur_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.481 at
FT                   residue 30"
FT   gene            307097..307375
FT                   /locus_tag="Tcur_0280"
FT   CDS_pept        307097..307375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0280"
FT                   /product="glycoside hydrolase family 13 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 13 domain protein;
FT                   KEGG: dde:Dde_2682 isoamylase protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95884"
FT                   /db_xref="GOA:D1A1G2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032640"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G2"
FT                   /inference="protein motif:PFAM:PF02922"
FT                   /protein_id="ACY95884.1"
FT                   /translation="MLRRSRLFGRKTRVTFSLPADEPPGTVSVVGDFNDWEPGRHELVK
FT                   RRNGTRSVSVTLAPGTYRFRYLGTGGLWFDDDTADAIDSQGSVITIG"
FT   gene            complement(307411..308370)
FT                   /locus_tag="Tcur_0281"
FT   CDS_pept        complement(307411..308370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95885"
FT                   /db_xref="GOA:D1A1G3"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95885.1"
FT                   /translation="MKASPRILTLSLLSATTLASTLLVPTAAAAAAPRPAAKAQATTKA
FT                   ARQQVEAFWTKARMRSATPMERLLTPGTATARKLLEVDGAGLLAPTAYPSGGASWTGGG
FT                   QVVKTTGRVFFTYQGRTASCSGSAVVSQNKSTVITAGHCVKLNGAWHTNWVFVPGYHNG
FT                   NAPYGVWTARRTLTTPQWGSSENFSYDVGAAVLNPQDGKLLTDVVGGQSIAFNQPRWRR
FT                   MYAFGYPAEAPYDGSKLTYCSGPTIVSLLWGTHGMNCNMTGGSSGGPWFVNFNEATGTG
FT                   TLASVNSYRLNLPILWRNMYGPYFGNDAKALYEEAQKS"
FT   sig_peptide     complement(308278..308370)
FT                   /locus_tag="Tcur_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.427 at
FT                   residue 31"
FT   gene            complement(308510..309805)
FT                   /locus_tag="Tcur_0282"
FT   CDS_pept        complement(308510..309805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0282"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: scl:sce6417 ECF subfamily RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95886"
FT                   /db_xref="GOA:D1A1G4"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY95886.1"
FT                   /translation="MIGVMTQPRQEASGVHRAIDAVWRLESPRIIAGVARLVNDLGLAE
FT                   ELAQDALVAALEQWPGSGVPDNPGAWLMAVAKRRAIDAIRRERRLERKIAELGHGLETG
FT                   APGTDPEEALDPERIEDDLLRLVFTACHPVLPAPARVALTLRMLGGLTTGEIARAFLTS
FT                   EATVAQRIVRAKRTLARANVPFEVPAGAERAARLASVLEVIYLIFNEGYAATAGDEWVR
FT                   ADLCREALRLGRVLAGLMPGEAEVHGLVALMEIQASRARARIDPSGEPVPLAEQDRGRW
FT                   DRLLIHRGFASLLRARALGGPPGPYVLQAAIAACHARAATAEDTDWKQIAGLYELLART
FT                   APSPVVELNRAVAVGMAFGPERGLAIIDALAGEPALRNYHLLPSVRGDLLARLGRTAEA
FT                   AAEFARAAALTRNAPERRLLRRRADELAARSG"
FT   gene            complement(309953..310303)
FT                   /locus_tag="Tcur_0283"
FT   CDS_pept        complement(309953..310303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0283"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: afw:Anae109_0580 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95887"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G5"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACY95887.1"
FT                   /translation="MRFLMMTTDDGSDQSPPSERLQAEMGAFIAEMSRAGVLLATGGLE
FT                   PGGVHITARDGEITVTDGPFSESKEAVAGFALVEVRSREEAIELSRRFWKIVGNGRGVI
FT                   KQVFGPEDLPGQ"
FT   gene            310621..311955
FT                   /locus_tag="Tcur_0284"
FT   CDS_pept        310621..311955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0284"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: acp:A2cp1_2983 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95888"
FT                   /db_xref="GOA:D1A1G6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G6"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACY95888.1"
FT                   /translation="MRAGVLIAARYRLDRRVGAGSAPEVWRATDEMLARRVMVALVPPE
FT                   HAGDLRYRHRFQQGARAAAALTHPGIVAVCDHGEVADIDGRPVPYLVMEPAEGETLADR
FT                   LAAGPLPLEEAVRIGARVAEALAAAHAAGVAHGDLRPANVICGPDGAKVLGFGLPRGPG
FT                   GDEAAPAADVHAFGVLLTELLTGQRALRALRAAHLPPEIAELCSRCRAGDPRRRPPAAE
FT                   AHAVLAAAGGRAAPPAGVLPAGRRRRFSGGATWTLGLATTVGLTAAAALTSVVLPGADG
FT                   ASGRSPALAGPSSPAATLEPPLFVSPTYATPPQPSSPPPRRKSPSGKPPQTPGPPHNRV
FT                   EAPPTRRPSREELVHRLSRVREVIVAGRARGEIAPETAAELDHLVTDFQTELAAGRPVR
FT                   VAERVDLLRTKVGERRRDGKIAKPRAQWLLAAIDAVDPTPYAAPA"
FT   gene            312107..312511
FT                   /locus_tag="Tcur_0285"
FT   CDS_pept        312107..312511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95889"
FT                   /db_xref="GOA:D1A1G7"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95889.1"
FT                   /translation="MTTSATTRRTITSGWLTFAAVVFLLTGVFNVINGLVGIFSSDFYV
FT                   VDAGQVLVFNFTAWGWLWLILGFVQIAVAAGIMNGMTWARAAGIALAALSIIGHMLFLA
FT                   AFPWWSVLTIALSVLVIYALTVPPHGATAA"
FT   gene            complement(312521..313531)
FT                   /locus_tag="Tcur_0286"
FT   CDS_pept        complement(312521..313531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0286"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ade:Adeh_0779
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95890"
FT                   /db_xref="GOA:D1A1G8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G8"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACY95890.1"
FT                   /translation="MAGRIAPPAQDQLLACIEAAVRAPSIHNSQPWQFLLLPDGVEVHS
FT                   DPSRRLPAIDPAGRALHISLGAAVLNLRLALEHFGRRTRTELLPDPQDRRHVATVWAEE
FT                   PQEPGRDVDELYGAIARRHTNRMPFQDVPPPQEDLQALTRAAEAEGAVLRFPEPGERDF
FT                   LLSLARTSDERHRGDRAYRAELRLWTTDDPYREDGIPLTAVGPYSEGGLTTLRDLAPER
FT                   EVPGRAAVRFEPEPTVGVLALPGEDGPLQWLRAGQAMQRVLLEATRRGLSTSVFTQALD
FT                   DPELRRMLHRPGDHTTPYVGLRVGYGPPAPVTPRRPVDEVITFTRPVPIRPPRLS"
FT   gene            complement(313717..314544)
FT                   /locus_tag="Tcur_0287"
FT   CDS_pept        complement(313717..314544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0287"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95891"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G9"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACY95891.1"
FT                   /translation="MTTNPAESGGASADATPKIDTSVPHSARIWNYWLGGKDNYEVDRI
FT                   AGDQFLKVFPGMAETARQSRAFLVRTVRYLAAEAGIRQFLDIGTGLPTADNTHEVAQRV
FT                   DPTCRIVYVDNDPLVLVHARALLTSTPEGATDYIDADIRETDKILKAAAKTLDFTKPIG
FT                   LTLNGIMGHIVDFDEALSIVRKLVAALPSGSYLVLQDGTNVHSEANKKAHDEYNQSGAA
FT                   PYIQRSPEQIAQFFEGLELVEPGLVSVTQWRPTLVGDKEPPPVDGYGGVGRKP"
FT   gene            314754..315839
FT                   /locus_tag="Tcur_0288"
FT   CDS_pept        314754..315839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0288"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: ade:Adeh_1294 dihydroorotate oxidase A;
FT                   TIGRFAM: dihydroorotate dehydrogenase; PFAM: dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95892"
FT                   /db_xref="GOA:D1A1H0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H0"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACY95892.1"
FT                   /translation="MYRLLFSLLLVRLPAETVHRITLWALRRLQAVPGAVPLLRRLLAP
FT                   RDPALTVRALGLEFPGPLGLAAGFDKDAQVYRALGAFGFGHVEVGTVTGRGQPGNPAPR
FT                   LFRLPEDRAVINRMGFNNDGSQAAADRLRDRRRDTIVGVNIGKTKAVPEERAVEDYVTS
FT                   ARRLAPHADYLVVNVSSPNTPGLRDLQAIERLRPLLQAVRRAADEAAGGRRVPLLVKIA
FT                   PDLADPDIDAVAELALELGLDGIIATNTTIARRGLRSAPELVAQAGGLSGAPLKERSLQ
FT                   VLRRLRERVGDRLVLISVGGVETADDVWERLRAGATLVQAYTGMIYGGPLWAYRIHRDL
FT                   SRRLRGSAFRTLQDAIGPKDA"
FT   gene            complement(315836..317290)
FT                   /locus_tag="Tcur_0289"
FT   CDS_pept        complement(315836..317290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0289"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: ppd:Ppro_3005
FT                   HemK family modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95893"
FT                   /db_xref="GOA:D1A1H1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H1"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACY95893.1"
FT                   /translation="MNDRVDALERVRAAFERAGYTVAGVRELLGPMAGGALAREQIVPA
FT                   LRATSGNSPLEAAVRLFWLQVPVPESAFPEAEALVAAGLAERSGGELRALLHIEPLEGT
FT                   DGSHLGHVVSDLKVRPGEGRALRPDHVVGAGGASASLAQLVIHRPVDNALDLGTGCGVQ
FT                   ALHLRDRAARITATDLNPRALALARLSFALSGLKDVELLEGSLYEPVKDRRFDLIVSNP
FT                   PFVISPGGGLVYRESGLPGDEVCRRLVGGAAERLTAGGWCQMLANWLHIDGVPWQERLA
FT                   EWLPQGCDAWVVQRDVQDPAEYAELWLRDSCEVGSPEYAARYEAWLDYFERQRATGVGF
FT                   GWITLRRTETDRPAVRIEELRHAVEQPVGAYVARILDGLTAARRFSTGCAQPLRTAVDI
FT                   VQEQIGLPGAEDPERIVLRQRGGLRRAADVGTVAAALAGVCDGTIPLPPLLDAIAELTG
FT                   MPARQVHDHAEAVLPELIADGFFEMP"
FT   gene            complement(317346..318197)
FT                   /locus_tag="Tcur_0290"
FT   CDS_pept        complement(317346..318197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0290"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; SMART: cell
FT                   wall hydrolase/autolysin; KEGG: tdn:Suden_0722
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95894"
FT                   /db_xref="GOA:D1A1H2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H2"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ACY95894.1"
FT                   /translation="MGRCGSAIAALAMSIGALTACGGGGDGGVGEGARPALPPTVTADA
FT                   PHGERTPLPEEDRRGGDDVLRGRTIVIDPGHNGGNARAPERINRQVDIGNGRKACDTTG
FT                   TATNAGYSEHAFTWDVSQRLRRLLQQRGAKVILTRSDDKGVGPCIDERAAIGNENDADA
FT                   VISVHADGSSATGHGFHIIEPAPVPGVTTEEYVEESHKLALAIRDAYRAGTGMPYSNYL
FT                   GREGIDRRNDLGGLNLSKVPKVFIETGNMRHAGDAAKLSNAQFRQRIAESLAEGLQKYL
FT                   RG"
FT   sig_peptide     complement(318129..318197)
FT                   /locus_tag="Tcur_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.618 at
FT                   residue 23"
FT   gene            complement(318587..319828)
FT                   /locus_tag="Tcur_0291"
FT   CDS_pept        complement(318587..319828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to mucin"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95895"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95895.1"
FT                   /translation="MRDPELALCAQRAASELERAWSRWRRAHGLAGRPAESVASYVTHS
FT                   LDHPWGRPRVVLGLDAEEARALAALLGRLDPPQGRPQPPSTRPGAPSHPEGRAQAPFAP
FT                   VGAPLTRLAPPPSWAAVSAARTGAPAGPADVPSSQVDTLPNRIKDLLNGTHPPAERPQE
FT                   PDSQSGTTPTPNGAARPAFPPQNCVENPPNGTGAPAGQPDSPAPAEPPQNHTGKPLNGT
FT                   NTAAEQTQELRLPGALPNCADLPPNGTAAPLNGIVRPAGRPALAALPPGRADLMQNRAK
FT                   NPPNGTGAPAGRPDSPGRTEPPQNHTGKPLNGTNTPAEQAPDSPGRAAPPPSGATVLFG
FT                   GIVRPVERLACVDAPPSGPAERFIPVDLQVEPPQGPAVSSPGNGADAALGNTDRPTEWL
FT                   IQVGPPPGCAGSPQ"
FT   gene            complement(320030..321040)
FT                   /locus_tag="Tcur_0292"
FT   CDS_pept        complement(320030..321040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0292"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: aav:Aave_4199 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95896"
FT                   /db_xref="GOA:D1A1H4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H4"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACY95896.1"
FT                   /translation="MPGPTTPKPTIRNVAERAGVSKSLVSLVMRGSPHVSERRRQAVLK
FT                   AARELGYRPNAVARSLVEGRTRLIGAIVADLHNPFFAEFLDGLQESLHGEGLRMLVGSG
FT                   RWDPLFEAEAVEAFLEMRVDGLVLLSVVPDSLQEAAASVPVVVVGERDVAGVDIVVDDD
FT                   ELGASLAVDHLVRLGHRRIAHIEGAPSTTARYRRAGYESAMRKHGLADQIVVEPGDFTE
FT                   EGGYRAARSLLSRPDRPTAIFAPNDLVATGALSAADELELRVPADVSIVGYDNTHLAAI
FT                   RHISLTSVDQPRRDMGRIAAEMLCARIGNPHREPKQKLVVPHLVVRSTTGPAPTL"
FT   gene            321758..322450
FT                   /locus_tag="Tcur_0293"
FT   CDS_pept        321758..322450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0293"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: acp:A2cp1_2776
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95897"
FT                   /db_xref="GOA:D1A1H5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95897.1"
FT                   /translation="MVSGERFASPARRRRGQGRRRLSVDERRDELIEAALQLFSTRPPD
FT                   EVSIDDVAVAAGASRALVYHYFGGKHELYVAALRSAANRLSVLLEPPTEGKPLERLRVS
FT                   LSRYFDFVESHASGYGALLRGGPADRSGEVGEIVNGIRSLLLDRILHALGASGPNPVLR
FT                   ITLRSWMACVETAAMDWLEQRDLDRRKLERLLVDQIVMLLNVAGRHDPQIAAMLDRLTQ
FT                   EERGKPEE"
FT   gene            complement(323018..323221)
FT                   /locus_tag="Tcur_0294"
FT   CDS_pept        complement(323018..323221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0294"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; KEGG: cps:CPS_4926
FT                   MerR family DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95898"
FT                   /db_xref="GOA:D1A1H6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H6"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACY95898.1"
FT                   /translation="MSARTPEAEPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGG
FT                   HRRYREAEVRALLAGIPQQRSE"
FT   gene            complement(323460..324473)
FT                   /locus_tag="Tcur_0295"
FT   CDS_pept        complement(323460..324473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95899"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95899.1"
FT                   /translation="MLPYAAYLRVYEPVTAFPEPLRSLWAAYAESGRRPRRAQALAAEH
FT                   GEAVRRLVSVPPVVAPDSESRHAYVRRAGGITYICPWETRLRSWLAFARFRAGLPPGVS
FT                   AAFVPEGQAERITGEFERWKASGHSLRPHILSSTWHVPLSWFVPFDPAERCLLLGDRDP
FT                   GGGNGAPNGLNGRHSGAEGHPGEGTFPARFEDPVGLRGPAGAWAADAGGAGRDRPAAGS
FT                   SMRTLIYVTSMREARRRLERAQRLIATGPEGGPEPAELEAVARHLAAFHAAALVELDYG
FT                   GLVHLIDDRRLRADESVHEMAVALAALERGEPELAVAMYQRLGARWRPVRALESAN"
FT   gene            324670..325758
FT                   /locus_tag="Tcur_0296"
FT   CDS_pept        324670..325758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0296"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerization
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; Glu/Leu/Phe/Val dehydrogenase; KEGG: sml:Smlt3523
FT                   putative valine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95900"
FT                   /db_xref="GOA:D1A1H8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H8"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ACY95900.1"
FT                   /translation="MTNVFGAPHKGTGSPHEQVVFCQDEASGLRAIIAIYSTALGPALG
FT                   GTRFYPYASEDEALADVLNLSKAMAYKNALAGLDHGGGKAVIIGDPATDKSEALLRAYG
FT                   RFVQSLGGRYYTACDVGTYSEDMDVVARESRYVTGRTVANGGAGDSSVLTAFGVFQGMR
FT                   AAAEATWGSPTLRGRRVGIEGVGKVGRRLVEHLREDGAEVVICDVDPAAIDRVRGRWPE
FT                   VEVVADRDALIRADLDVYSPCALGGALSDETVPLLRAKVVCGAANNQLAHPGVEKRLAD
FT                   RGILYAPDYVVNAGGVIQVADEITGFDFERAKAKAAQIFDTTKRIFALAAEEGVPPAVA
FT                   ADRLAERRMTAVGRLRGIWLGG"
FT   gene            326098..326313
FT                   /locus_tag="Tcur_0297"
FT   CDS_pept        326098..326313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95901"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95901.1"
FT                   /translation="MGRGRAKAKQVKVARRLKYNTGGTDLDRLKEELGVSSPSRDPYED
FT                   SYEDLAKKYADYADDDDDGEDDKSGR"
FT   gene            complement(326439..327131)
FT                   /locus_tag="Tcur_0298"
FT   CDS_pept        complement(326439..327131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0298"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   csa:Csal_1238 protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95902"
FT                   /db_xref="GOA:D1A1I0"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I0"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ACY95902.1"
FT                   /translation="MIVTIVRRVWAAVRARRLAGPGAVALALAGYAALLPTGWFYAGTA
FT                   PHRASVTTVEAAPVALVLGAAAWGDAPSPFLAGRLDAAAELYRAGKVRAILVTGDNSRE
FT                   GYDEPTVMWNYLTAKGIPGHKVVRDYAGFDTWDSCVRAKRIFGVERAIVVTQTFHLPRA
FT                   VALCRAAGLEATGVGHDSMATAALPTCYGYFRETLASLKAVVDIATGRQPRFLGPQEPG
FT                   VRRALQSP"
FT   sig_peptide     complement(327033..327131)
FT                   /locus_tag="Tcur_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.835 at
FT                   residue 33"
FT   gene            complement(327262..328305)
FT                   /locus_tag="Tcur_0299"
FT   CDS_pept        complement(327262..328305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0299"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: avn:Avin_36890
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo- ligase; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95903"
FT                   /db_xref="GOA:D1A1I1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I1"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ACY95903.1"
FT                   /translation="MTAAQRPVSYEAAGVDIAAGERAVELMKASLAKARRPEVVEDASG
FT                   FAGLFDASALLRYRRPLLATSTDGVGTKVDLARRLGVYDTIGRDLVAMVVDDLAVCGAE
FT                   PLFMTDYIACGKVVPERIATIVSGIAEGCALAGCALVGGETAEHPGLLEPDEFDLAGAA
FT                   TGVVEADEMLGPDRVRPGDAVLAMASSGIHSNGYSLVRHVLRISGLELDGEVAELGRPL
FT                   GEELLTPTRIYARDCLALARAGGVRAFAHITGGGLAANLARSLPGGVDAHLRRSSWTPP
FT                   PIFTVLQEHGKIPQPEMDKTFNLGVGMVAVVAPDAADAALRLLQERGVPAWVLGEITTG
FT                   TGAVHLV"
FT   gene            complement(328302..329798)
FT                   /locus_tag="Tcur_0300"
FT   CDS_pept        complement(328302..329798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0300"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: ank:AnaeK_4338
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95904"
FT                   /db_xref="GOA:D1A1I2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I2"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACY95904.1"
FT                   /translation="MTQGDGRLSHDLDPHDRGPQDACGVFGVWVPADEATRAEVSKLTY
FT                   YGLYALQHRGQESAGIAVSDGARIVVFKDMGLVAQVFDESVLNTLRGHVSVGHCRYSTT
FT                   GSPTWENAQPTFRSSSDGSLALTHNGNLINTPELAAKLDPGELAGTSDTEVLTALLASR
FT                   GGPGTGTFEAALQVLPTVRGAYSLVFMDERTLYAARDPQGIRPLVLGRLPVAGHAGHGG
FT                   QIRQGWAVASETAALDIVGAQFVREIEPGELLAIDEGGLRSQRFAEADPKGCLFEYVYL
FT                   ARPDTTIAGRNVHSTRVEVGRLLAREHPADADLVIPTPESGTPAAIGYAEASGIPYGQG
FT                   LVKNSYVGRTFIQPSQTIRQRGIRLKLNPLREAIAGKRLVVVDDSIVRGNTQRAIVSML
FT                   REAGAAEVHVRISSPPVAWPCFYGIDFATRAELIAGSLNVEEIRASLGADSLGFISLEA
FT                   LISATRLPARRLCRACFDGEYPIPVEEDARGKYLLEGAGK"
FT   gene            329999..330376
FT                   /locus_tag="Tcur_0301"
FT   CDS_pept        329999..330376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95905"
FT                   /db_xref="GOA:D1A1I3"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95905.1"
FT                   /translation="MTVPGYQRSQAPARQSRDGMAMTSLVLGLVGLPALLLCGSGLVMA
FT                   MAGLVLGIVAAHRGGTRGLAVAGIAVCLVTLLVGALGLYWMLTKAARCADVDRYPTELD
FT                   RQRCIEQEFPFARSQSSLEGR"
FT   sig_peptide     329999..330136
FT                   /locus_tag="Tcur_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.786 at
FT                   residue 46"
FT   gene            complement(330388..330828)
FT                   /locus_tag="Tcur_0302"
FT   CDS_pept        complement(330388..330828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95906"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95906.1"
FT                   /translation="MSRSPLSRAVLNEQLAALGRPPYEGPDDPAALRLACPEAVLGALD
FT                   AGLEPARPVLRGAVRALLDRLAAAAPGRSVEVRVPPYAAVQCVAGPRHTRGTPPNVVEM
FT                   DAVTWVCLATGRLGWQEAVAAGRVHASGPRSDLSALLPVLAP"
FT   gene            330988..332628
FT                   /locus_tag="Tcur_0303"
FT   CDS_pept        330988..332628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0303"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_1709
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95907"
FT                   /db_xref="GOA:D1A1I5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95907.1"
FT                   /translation="MPQARPLDPNDPERIGGHRLLGRIGQGAQGVVFLGRGPGGGRLAV
FT                   KLLHARLGGDPLAHARLLRELEALTRIDTCCTAAVRQVGIADERPYLVGEYVAGPSLQE
FT                   LVAAEGPRGRGMLERLAVGTAAALAAVHRAGLVHLAFKPADVLLGADGPRVTDYGIVRA
FT                   LRAGGLTPPPGTPAYLAPEQLDGAEAGPAADVFAWGAVMLFAACGRAPFGEGPAPEVMR
FT                   RILHEEPPLEELPPSLRGIVAGALAKDPAARPTARQVLDWLLGQESMVAGMPQPMIAEA
FT                   RELAAERPPRPGPVVAAAEPWPQNPVPGFDDPVEAPTQIVTPSGEAPAPRSAQAETAVY
FT                   PQLGAFGERTATAQQSAPPWPEEAWQTPAPAQMSRPEPPPARSPSRANRPLGVLVSLAV
FT                   GVLAGAAIIVLVLWPQLRDSSGKTGGSAGASRPAADNRPVTSVPEAFEGTWQGTAINQR
FT                   RNATFPIRVTFRGGETTARAVYPRNCVCTLTLTRGTGVRLEMSLRPNPGCKTVTPGEVV
FT                   VTRKPGGGLDYAWAKPGTSLSYRADLTRQ"
FT   gene            332759..333946
FT                   /locus_tag="Tcur_0304"
FT   CDS_pept        332759..333946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0304"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; proteinase inhibitor I9 subtilisin propeptide;
FT                   KEGG: mca:MCA0875 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95908"
FT                   /db_xref="GOA:D1A1I6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I6"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACY95908.1"
FT                   /translation="MRVTGPKVLLITTLATGVAVATAVPLLAKPEPVLVQVAANGTPVP
FT                   GQYIVTLKPGASTAAEAGRIRATGVRRFDGVLNGFSAKLTAEQLDKLRRSDKVAAIEQD
FT                   QIVRIGAVQRAPLPWGLDRIDQRVPKLSKSYTYKSTGKGVRVYVIDTGIKIKHKQFGKR
FT                   ARSVWAAPRFKGNHRDQNGHGTHVAGIIGAKHYGVAKGVQLRSLRVLDRYGQGMMSDVI
FT                   AAVKWLRKNAQKPAVANLSLVGSRSKAANDAVAALARSGVPVIVAAGNGDGASRGYDAC
FT                   RFSPSGAPNVIAVGAIAPGDKRTPWSNFGKCVDLHAPGQGIRSTWRNGSSKVLDGTSMA
FT                   APFAAGTAALYLSRHPRAKSATVYKWLINNASKGRVTGLPAGKGTPNRLLYKGRL"
FT   sig_peptide     332759..332845
FT                   /locus_tag="Tcur_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.825 at
FT                   residue 29"
FT   gene            334270..335223
FT                   /locus_tag="Tcur_0305"
FT   CDS_pept        334270..335223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95909"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95909.1"
FT                   /translation="METPDSTRGARGVRGGLRRAALALAAAAGALVLTSATATSPAAAE
FT                   PGNEQKIAELTQQIKNLEKEYGGNLEQLRDTRLQAKKALLKVKLLRRDLETARDVVAQL
FT                   AASRYMSNGLDPTVQVLASDDPNRVLSNASLAHHLSVTQAAKVTEINTLLAQQERARRD
FT                   AEKKIKILEKEIADIAKERERVRQLLRRYKPESPMVGTGGMTPRMIKVRDEIEEKFGPF
FT                   PVIGCTRPGDPLDHGSGRACDFMESTAGQMPSPSRLAHGDAVAAYAIRNATRLGIKYII
FT                   WKQRIWDVRSSGGWKMMSDRGSITQNHYDHVHISVF"
FT   sig_peptide     334270..334404
FT                   /locus_tag="Tcur_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.862 at
FT                   residue 45"
FT   gene            complement(335614..335862)
FT                   /locus_tag="Tcur_0306"
FT   CDS_pept        complement(335614..335862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95910"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95910.1"
FT                   /translation="MHDHSGVVPVTRECPLVCLGLSRHAANPLRFHLGSRATVGQVLRL
FT                   WENDELQRVRGLGPRRIGEITTALVAAGFVLTPHGHR"
FT   gene            complement(335869..336141)
FT                   /locus_tag="Tcur_0307"
FT   CDS_pept        complement(335869..336141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95911"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95911.1"
FT                   /translation="MTAAATSASGPASPVGPARSSGLVEPAAEDVAVQKWYLQAVTRVY
FT                   GPWTVSKTISARERALAIRRVRYATDVLADLEARFPRAESRRGWE"
FT   gene            complement(336138..336461)
FT                   /locus_tag="Tcur_0308"
FT   CDS_pept        complement(336138..336461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95912"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95912.1"
FT                   /translation="MGFDRKQFEAANVTGAFGPRRVHLAALDAELCRRPGLLCGLVERD
FT                   GLRVLRVMLEGAALRAVEVDCRGKPGGWVFTCADTGKPLGAVDDPAAVADRVIDVLADR
FT                   VAR"
FT   gene            337297..338244
FT                   /locus_tag="Tcur_0309"
FT   CDS_pept        337297..338244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95913"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95913.1"
FT                   /translation="MPLPKATAAVQPDTIGADYAAITVAHRRLYWSVQPAQMHPAVVEH
FT                   TRLGTQLLAETTGVARRVLATALAESLLLAGRIEFFDLRQPEEADQTFVRALQAAGEAD
FT                   DSLLGAAILAHAAFVPGWAGRRDEAAERMRAARTYVRRAPASVEFLAWLDAVEAECETR
FT                   CGRTREALRLIAHGEEVIAEGNEHASPDWFNWFSPIRLAAFKGSTELKAGHIPQARETL
FT                   TKVLEGLPAADIKQRSVILGDLAAVEAAAGNPEAACARAEEALDLLTRTWYATGMDRIL
FT                   SVRRDLEPWADRECVRRLDDRLYGWQTTLSALKR"
FT   gene            complement(338225..338893)
FT                   /locus_tag="Tcur_0310"
FT   CDS_pept        complement(338225..338893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0310"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: avn:Avin_47740 haloacid dehalogenase-like
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95914"
FT                   /db_xref="GOA:D1A1J2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J2"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACY95914.1"
FT                   /translation="MLDMIQAVVFDVGECLVNETREYGTWADWLGVPRHTFSAVFGAVI
FT                   ARGLDYRETFQVFVPGFDLTEQREKRAAVGQAEWFGEDDLYPDARPTLAALREAGLWVG
FT                   IAGNQTVRAGGILRELKLPCDMLATSDDWGVAKPDPAFFKAVVREAPCEAGEILYVGDR
FT                   LDNDIRPAVAVGLKTALIRRGPWGIIQQDDPDADRLPTMRIDSLTELPSRIAEFNASAR
FT                   "
FT   gene            339029..339376
FT                   /pseudo
FT                   /locus_tag="Tcur_0311"
FT   repeat_region   340045..340274
FT                   /rpt_unit_range=340045..340076
FT                   /note="CRISPRs"
FT   gene            complement(340946..343222)
FT                   /locus_tag="Tcur_0312"
FT   CDS_pept        complement(340946..343222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0312"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: afw:Anae109_4362
FT                   phosphoribosylformylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95915"
FT                   /db_xref="GOA:D1A1J3"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J3"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACY95915.1"
FT                   /translation="MSALAAEQTAAEPPVDSVAVAERTPDQRQPYAELGMTEEEYRRVR
FT                   QILGRRPTAAELAIYSVMWSEHCSYKSSKVHLRQFGEKAPKSDALLVGMGENAGVVDVG
FT                   RGLAVTFKVESHNHPSYVEPYQGAATGVGGIVRDILSMGARPIAVMDSLRFGPADAPDT
FT                   QRVLPGVVAGISGYGNSLGLPNIGGETVFDPCYEKNPLVNALCVGVMRHEDIKRAHAPG
FT                   PGNKVILFGAATGPDGIGGASVLASATFDEESQAKRPSVQVGDPFMEKLLIECCMELYR
FT                   EDLVVGIQDLGAAGVSCATTELAAAGTGGMHIVLDAVPLRDATLRPEEILMSESQERMM
FT                   AVVEPGKVDRFLQICAKWEIPATVIGEVTDTGRLVMTWRGEVIVDIPPGTAADEGPVYE
FT                   RPYEPPADLASLQADTPGRLARPATAEDLRNTVLWLAASPNLSSKTWITSQYDRYVLGN
FT                   TVLAMPEDAGVIRLDEESGLGVAISLDGNGRYTRLDPYAGAQLALSEAYRNVAATGARP
FT                   LAVTNCLNFGSPEDPGVMWQFARAVEGLADACQALGVPVTGGNVSFYNQTDDQPINPTP
FT                   VVGVLGVHDDVRRRVGMAFPGEGHLLVLLGETREEFGGSEWAHVVYGHLGGLPPLVDLA
FT                   AERALASVLIAAAREGLLSGAHDISDGGLSQALVESCLRGGLGCRITLPGDPFVTLFSE
FT                   SVARAVVAVRPGGEARLAKLCEAAGVPATQLGRVGGDSFIVEGLFSIPLHELREAHERL
FT                   LPSYA"
FT   gene            343447..344325
FT                   /pseudo
FT                   /locus_tag="Tcur_0313"
FT   gene            complement(344370..345062)
FT                   /locus_tag="Tcur_0314"
FT   CDS_pept        complement(344370..345062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0314"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: pla:Plav_2587
FT                   phosphoribosylformylglycinamidine synthase I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95916"
FT                   /db_xref="GOA:D1A1J4"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J4"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ACY95916.1"
FT                   /translation="MNAARVGVITFPGSLDDRDAARAVRLAGAEPVALWHADRDLRGVD
FT                   AVILPGGFSYGDYLRAGAISRFAPVMDALIPAVRDGLPVLGICNGFQVLCEAHLLPGAL
FT                   LPNAGLHFVCRDQRLRIENTDTAWTADYTTGQEVVIPVKNRDGRYFADPETLAELEGEG
FT                   RVVARYLDLNPNGSLNDIAGICNEAGNIVGLMPHPEHAVESLTGPSTDGLGFFTSIVKA
FT                   GLKQVGVG"
FT   gene            complement(345142..345585)
FT                   /locus_tag="Tcur_0315"
FT   CDS_pept        complement(345142..345585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0315"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sil:SPO3410 anti-sigma B factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95917"
FT                   /db_xref="GOA:D1A1J5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY95917.1"
FT                   /translation="MGFSLALPRESLSIRILRRVLGDALRGLGVAEDCIGDILVAASEA
FT                   CTNVVQHSRTPLDYEVIARVNDGVCALTVTDHGRGLTSGPAAGDPEQAESGRGIKIMHA
FT                   LMDDVTFDTRPGYGTAVHMSKRLTWKDEAPLRRLQGDLVHSAR"
FT   gene            complement(345743..345991)
FT                   /locus_tag="Tcur_0316"
FT   CDS_pept        complement(345743..345991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0316"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: rpb:RPB_3718 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95918"
FT                   /db_xref="GOA:D1A1J6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J6"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ACY95918.1"
FT                   /translation="MARVVVDVMLKPEILDPQGRAIARKLPQMNFDGVISVRQGKRFEL
FT                   ELAGPADEAALEKVRQIAATLLVNPVIEDFEVRVLGD"
FT   gene            346165..347784
FT                   /locus_tag="Tcur_0317"
FT   CDS_pept        346165..347784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_01273 putative membrane-associated
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95919"
FT                   /db_xref="GOA:D1A1J7"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95919.1"
FT                   /translation="MDIEDLTPSERAVWRAFATGESVDLSSGNPAMDDPAHGEQWGPER
FT                   VVRAEVLRALLVGGVEPEPGQIAAVRLTGARIIGTLNLGHAQVSVPLALTGCYFDEAPH
FT                   LYWAGMNSVHLMGCRLPGLVASGARFDGHLWLEGSTVSGGLWLDGAHISGILNMSGVQL
FT                   INPQGDALLGDRLTVDANVYCDKGFTSHGEVRLPGAHVGGQLIFRQATLNNPSGAALYA
FT                   SRLNVAANVFCDAGFTATGEVRLRGARVGGYLSLVGAKLNHPGRTALNAADLAVETDVY
FT                   CSDGFAANGMVSFAGARITGQLSLRGAHLTNESGVALSLQRMQAEEVVLRPAEPVEGIA
FT                   DLSYARINVLRDDPATWASRLQLDGLSYETLDPPLSARERLGWLRRDTDGYQPQPYERL
FT                   AQAYRALGLDADGRTVLLAKARDRRKTQSLPRKVVGWLQDILVGYGYRPFRAASWLAGL
FT                   LVFGTVVFTLHEPPQIEAEQQPAFNAFFYTLDLLLPIGNLGQEPYFAPTGIYQWIANFI
FT                   VIAGLILGLTVAAGATRALSRD"
FT   gene            348257..349162
FT                   /locus_tag="Tcur_0318"
FT   CDS_pept        348257..349162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0318"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bac:BamMC406_1201 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95920"
FT                   /db_xref="GOA:D1A1J8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95920.1"
FT                   /translation="MRTPIAGGPGRAGRTPSLAGRRVLITGAARGIGAALADRLHARGA
FT                   RVALAGLEPQLLAEVAARCGNAPWRACDVADREQVEAAVEHAAQALGGLDVVVACAGVA
FT                   AQLPLVGGDPAVMEQTVRVNLLGTYYTLRAAGPHISHPRGYALAVASLAAAVHPPLMGA
FT                   YSASKAAVEALGNTLRAELRPYGARAGVAYFAELDTDMTHRGFGTRAAAALMGSGPAKA
FT                   LLSRVAPLQVGIDALERGIARRSARIVAPWWVAAALPARTFLQPVIDRAAQRHLRRALE
FT                   IARDEHAPLTTPQPDSGGAS"
FT   gene            349159..349719
FT                   /locus_tag="Tcur_0319"
FT   CDS_pept        349159..349719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0319"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   dol:Dole_1053 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95921"
FT                   /db_xref="GOA:D1A1J9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J9"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ACY95921.1"
FT                   /translation="MTAPAARDRSPRIAPGGLRQVGPFTWLLARISGRIAGTGPLALFL
FT                   TLGRHRRLFHAWLWFAGRLMPGGRLPRRESELVILRVAHLRGCRYEWEHHVRLGHRAGL
FT                   GPADIDRVTQGPGAEGWTPRERALLTAADRLHHHRDLDDDTWRLLREHLTEPECIELCM
FT                   LASHYEMLATVIAALRIQPDAPR"
FT   gene            complement(349850..350470)
FT                   /locus_tag="Tcur_0320"
FT   CDS_pept        complement(349850..350470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0320"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: lch:Lcho_1914
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95922"
FT                   /db_xref="GOA:D1A1K0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95922.1"
FT                   /translation="MVSSPPRRLPRGRHALAPEEVARRQRERLMLAMAQAMSDKGFAAT
FT                   SVEDVLKRAAVSRQSFYRLFSSKLDCFLAAFDEAARLLEERLIAAVGKTGDPLERFERG
FT                   ITAYLEMLAAEPAYSRLFLIEGYAAGPQAIERRLAFQQRLTDLLAEVLDVRTEGGRFAC
FT                   RAVVAATATLVTGPLLTGDAAALRAVGEEIVAHVRRLRAGGVL"
FT   gene            350832..352166
FT                   /locus_tag="Tcur_0321"
FT   CDS_pept        350832..352166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0321"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: secretory lipase; KEGG: reh:H16_A0876
FT                   secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95923"
FT                   /db_xref="GOA:D1A1K1"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K1"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ACY95923.1"
FT                   /translation="MASSEGTAGARRNRLPRRARSVNKGRSSPVSARTRRGLRALMATC
FT                   LGVALTITPVAAGPAAADTVPAPADDPFYKPPTPLPDGRPGDIIRSRASAFTLQPIRKT
FT                   PRADVKSWQVLYRSQSATGEDIAVSGTVLVPTKPWTGTGGRPLLSYAVGTRGIGDSCAP
FT                   SYTLSQGTDYEGLIISAALDKGWAVAVTDMQGLGTPGMHTYEVGRAQGKAVLDIARAAQ
FT                   RLPGTGLNEQTPVGVWGYSQGGTSAGWAAELAASYAPELNLKGVVAGGVPADLIAVAEN
FT                   LEGSATVALAFLAAVGYDAAYPELKLESYLNDAGRKLLASSQDICLASVDGITTVIGTA
FT                   FSKFTDYATVNPLTTETWRRRLNENKLGSTRPSAPVLQVHGRIDAIIPFAQAETLRKNW
FT                   CALGADLTWKVYPLAGHAPGIVRQVPDALSFLSDRFAGLPAQSNC"
FT   sig_peptide     350832..351020
FT                   /locus_tag="Tcur_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.859 at
FT                   residue 63"
FT   gene            352209..352721
FT                   /locus_tag="Tcur_0322"
FT   CDS_pept        352209..352721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0322"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="KEGG: afw:Anae109_4021 dual specificity protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95924"
FT                   /db_xref="GOA:D1A1K2"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95924.1"
FT                   /translation="MPPGGVRWERNPARTPAAATDNHPMTAPLAGAIRLPDGAWVRGRG
FT                   LRGPAPGGPDPHFGLYLGSARLRRRCDAALPWPAEWIRWPDFLLPTDWDEAARAIADLH
FT                   ERARSGQAVEVACHGGVGRTGTVLACLATRAGLPPRQAVAWAREHHHRRAVETPWQRRW
FT                   VAWFAAR"
FT   gene            complement(353157..353576)
FT                   /locus_tag="Tcur_0323"
FT   CDS_pept        complement(353157..353576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95925"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95925.1"
FT                   /translation="MLKNVHPQVADSGFDSFRQTAAACEGYLIERLLFSRIADSGTLDI
FT                   GLRWGPEKPDITLSFQNVHHFSASGLPDVSAGPLDQITTTVLEPGDEPWPDGLEPGFHR
FT                   SAELPPLLWFHVSGPVRISVLSSTAAAYIEARPSI"
FT   gene            complement(354374..355216)
FT                   /locus_tag="Tcur_0324"
FT   CDS_pept        complement(354374..355216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0324"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: scl:sce8968
FT                   nucleotide-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95926"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K4"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACY95926.1"
FT                   /translation="MAKEAPMTILVTGATGNVGRPLVEQLLAAGHRVRALTRDPAKADL
FT                   PAGAEAVAGNLADTDTLVAAFDGVTAAHLITFDAATYGPLTNGAEIVELACKAGVRHVT
FT                   LLAGDVDKSPLEQAVQASTLHWTRLAPVEFMSNTLEWAESIRTEGLVREGFPTARSALV
FT                   HDADIAAVAAVALTEDGHHGKEYWITGPQALTIPERVQIIGQVLGRDIRYVELTQEEVI
FT                   ARWRQEGYSDDDIGFFLQMRTNPPEAGRTVLPTVQEVTGKPARTFAQWVKENAAAFTA"
FT   gene            complement(355545..356015)
FT                   /locus_tag="Tcur_0325"
FT   CDS_pept        complement(355545..356015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0325"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   afw:Anae109_4177 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95927"
FT                   /db_xref="GOA:D1A1K5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY95927.1"
FT                   /translation="MVHDVRLRPAEPADYDAIVAVMDDWWGRPVRAALPRLFLDHFHRT
FT                   SIVAEHDGDLVGFLSPSAPEVAYIHFVGVDPRFRGRGLARRMYRRFFELARSDGRSVVQ
FT                   AITSPHNHGSIAFHTALGFTVTGPVPGYNGPSADRVVFRLDLDDPRPPANRG"
FT   gene            complement(356159..356806)
FT                   /locus_tag="Tcur_0326"
FT   CDS_pept        complement(356159..356806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0326"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   rpc:RPC_0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95928"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K6"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ACY95928.1"
FT                   /translation="MWQDVRIRQPWGVTASVKSAPDLARLKLAGNVTEKTPREAFEAGQ
FT                   AGVAGLRRVLRDHGIPDGRVSSSRLKLSSAYQYQDGVHKMVGCTCEAAFTVETGDLDGL
FT                   QQLLIDVVDAGVNRVEGVEFDVTAKGELRAEARRAAVRAARAKAELYAEAAGVRLGEVV
FT                   HIEDVNPDDPLPNERYRSHGAVSGHSDEDLAPGQIVVSAAVVLGFSLAGPRT"
FT   gene            complement(356899..358374)
FT                   /locus_tag="Tcur_0327"
FT   CDS_pept        complement(356899..358374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0327"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gsu:GSU1108
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95929"
FT                   /db_xref="GOA:D1A1K7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACY95929.1"
FT                   /translation="MSQEDEVMTVNETKPHFEPPGMLIAGEWTPAGENGQMEVRAPYDG
FT                   SLVARVPAGGPRDVDRAVRAAAEALRRDDFPRFDRVRVLEQTAAALSDRRELFARAIAL
FT                   ECAKPLKTARVEASRAVETFAFAAAEARRYAGEVIPMDATPPGSGKTGFTLRVPVGVVA
FT                   AITPFNFPLNLVAHKVAPAIAAGCPVVLKPASQTPVSALLLAELLDGLGVPAGWLNVVT
FT                   GGGGTVGDALATHEEVAYVTFTGSAEVGWSMAAKAPRKKVRLELGSNSPLIVDSPSDWQ
FT                   TAASKVSTAGYAHAGQSCISTQRVYVHHDIADDFLEELLPRVEDLRLGDPLDEHTDVSS
FT                   LITRDDTERMKEWTDEAVAAGARLLTGGEALEHGIFRPTVLEGPPPQARVQCQEVFGPI
FT                   VTVTRYADFEEALRLADDSRYGLQAGVFTDELGKALKAAKSLHFGGVLINDVPTSRADQ
FT                   QPYGGVRDSGNTREGPAYAIEEMTETRLVTLQT"
FT   gene            358584..359726
FT                   /locus_tag="Tcur_0328"
FT   CDS_pept        358584..359726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0328"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: gme:Gmet_2509 dehydrogenase, E1 component;
FT                   TIGRFAM: pyruvate dehydrogenase (acetyl- transferring) E1
FT                   component, alpha subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95930"
FT                   /db_xref="GOA:D1A1K8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K8"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ACY95930.1"
FT                   /translation="MTIDSARGAPASGLQQAPPPELIQLLTPEGVRVEHPDYPLELTPE
FT                   EVRALYRDLVMVRRIDMEAVALTRQGELGLWASLLGQEAAQVGSGRALGERDMVFPTYR
FT                   EHGVAWCRGVDPIRLLSLFRGLSNGGWDPAEHNFHLYTIVIGSQTLHATGYAMGIQRDG
FT                   VLGTDKAAAAIAYFGDGATSQGDVNESFVFASVFNAPIVFFCQNNQWAISEPLEKQTRI
FT                   PLYRRAQGFGFPGLRVDGNDVFACLAVTRRALEAARSGQGPTLIEAYTYRMGAHTTTDD
FT                   PTRYRLEAELEAWKLKDPIERVKAYLIKNEQADAEFLAGVEEEAKQYAADLRRRCLQLP
FT                   DPEPGAIFEHVYAEPHPLITEEQREYAAYLESFEDEGERS"
FT   gene            359723..360730
FT                   /locus_tag="Tcur_0329"
FT   CDS_pept        359723..360730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0329"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: ade:Adeh_1826 branched-chain
FT                   alpha-keto acid dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95931"
FT                   /db_xref="GOA:D1A1K9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K9"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACY95931.1"
FT                   /translation="MTAVTQQTTTTLTMVKALNEGLRRALEDDPKVLVMGEDVGRLGGV
FT                   FRVTDGLQKDFGEDRVIDTPLAESGIVGTAIGLALRGYRPVVEIQFDGFVFPAADQIIT
FT                   QLAKMHLRSLGAVRLPVVIRIPCGGGIGAVEHHSESPEIYFTHTAGLRVVACSNPLDAF
FT                   TMIQQAVRCDDPVIFFEPKRRYWDKAAVDLAAPAESWTPLHAARVVQPGHDVTVLAYGP
FT                   MVKTCLEAAAAALEEGRSLEVIDLRSLNPLDIDALTASVQRTGRCVVVHEAPVFSGYGA
FT                   ELAARLTERCFYHLQAPVLRVGGFSTPYPPSRLEEHYLPDLDRVLDAVDRVMEW"
FT   gene            360736..362307
FT                   /locus_tag="Tcur_0330"
FT   CDS_pept        360736..362307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0330"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   scl:sce1569 dihydrolipoyllysine-residue acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95932"
FT                   /db_xref="GOA:D1A1L0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L0"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACY95932.1"
FT                   /translation="MPEIKTFKLPDVGEGLTEAEIVRWHVHPGDRVEVNQVIVEIETAK
FT                   AVVELPCPYEGTVAELLVEEGRTVEVGTPIISVSVPAGEAGESAPPPAPDGAAEPGPRQ
FT                   DPETGPSEPARQPVLVGYGVRPGATRRRPRKRPAAIRHARPAPAPHALAKPPVRKLARD
FT                   LGVDLSTVTGTGPHGTITREDVRQAAERAATSPAPPAVERPGFAEVPQAPVHEGRGPAE
FT                   MPQEAGGVPGGEAVRGLTEMPGGVLPGRQGRGPAEMPGGLAEVSAPGEARAVQEGAAGP
FT                   AVPSAGGREERVPVRGVRKSTAAAMVGSAFTAPQVTEFLQVDVTETMETVRRLRELPEF
FT                   AELKVTPLLLVAKALLTAVRRHPMINSSWADGGEAGDEIVVRHYVNLGIATATSRGLLV
FT                   PNVKDADRLTLPELAAALGRLVEEARAGRARPADLTGGTITITNIGVFGVDAGTPILTP
FT                   GEAAILAFGQIRDMPWVHQGELAVRKVTTLALTFDHRIVDGELGSAVLRDIGAMLENPL
FT                   RLLAWS"
FT   gene            362396..363025
FT                   /locus_tag="Tcur_0331"
FT   CDS_pept        362396..363025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0331"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5547
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95933"
FT                   /db_xref="GOA:D1A1L1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95933.1"
FT                   /translation="MNRRRGTSEGGREKILRAALGCFSRDGVAGTPLGRLLSESGVSAG
FT                   SFYHHFTGKEEVAAVLYAETLRGYQEGFLRELRRHADPQAAVAACVAFHIDWCRRHPDH
FT                   ARFLFTERPPGRQEPGGRELADYNRAFYTDVLAWWRQHEHHGALRPLDIVTAYVLWLGP
FT                   AQELCRQWLTGRAPEPSPDQIALLGEAAWQALRQPDSRPSQKGSRT"
FT   gene            363022..363858
FT                   /locus_tag="Tcur_0332"
FT   CDS_pept        363022..363858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0332"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   sil:SPO0740 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95934"
FT                   /db_xref="GOA:D1A1L2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L2"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACY95934.1"
FT                   /translation="MTAISYTKVMEEARGETRTLVNVERHGGYAVLTLADPGKLNVLSA
FT                   AMTLQLRQALAGLVADPQIRAVVLTGTDPGFCAGGDLRLMRQVTQGLADPADEDGATTP
FT                   WRFIRREFGGIVRLIAGGDTAVVAAVNGPAAGVGLALAFACDLIIASERAVLVPAFGRL
FT                   GLLPEVGTSWFITRRLGYQRAFEYYVSGEHIPARRALELGVVNEVVPHEELLERARLWC
FT                   ERMIALPEHALSMTKPLLRQAADTSWEQALTMEEYAEPSCFTTKPFARSVEGMLRR"
FT   gene            complement(363876..364388)
FT                   /locus_tag="Tcur_0333"
FT   CDS_pept        complement(363876..364388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0333"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: xcb:XC_2390
FT                   tryptophan-rich sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95935"
FT                   /db_xref="GOA:D1A1L3"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L3"
FT                   /inference="protein motif:PFAM:PF03073"
FT                   /protein_id="ACY95935.1"
FT                   /translation="MVRIMQRGVPRTGRRPGGTAATWGGLAVFAGVTALAAGVGALAVS
FT                   GAGQEYARLDRPDWAPPSWLFPPVWTVLYATIAVSGWLVWRRHGVHPALGVFGLQLVLN
FT                   AIWTPIFFGAGAYGWAVADIVALWLALGATIGWFWRLSRPAALLLVPYWAWVSYATALT
FT                   VAIWRAA"
FT   sig_peptide     complement(364278..364388)
FT                   /locus_tag="Tcur_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.795 at
FT                   residue 37"
FT   gene            364655..366877
FT                   /locus_tag="Tcur_0334"
FT   CDS_pept        364655..366877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0334"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   cvi:CV_0762 carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95936"
FT                   /db_xref="GOA:D1A1L4"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L4"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ACY95936.1"
FT                   /translation="MSTPTVTPPPTVPASRRTALRKIVIWSAVSLLGAVAWAMIALVRG
FT                   EEVSAAWLVFAALASYAIAYRFYARFIACKVLRVDDTRATPAERLDDGIDYHPTDRRVL
FT                   FGHHFAAIAGAGPLVGPVLAAQMGYLPGTIWIIVGVIFAGAVQDMVVLFFSMRRSGRSL
FT                   GQMARQEIGPVGGAAALVAVLAIMIILLAVLALVVVNALKDSPWGAFSIAMTVPIALFM
FT                   GCYLRYLRPGRVVEASAIGVALLLAAIGAGGWVAESSLAGAFTLSGETLVIALVVYGFV
FT                   ASVLPVWMLLAPRDYLSAFMKVGVVVLLAGAILAARPALRTEAFTEFAFTGQGPVFAGS
FT                   LFPFVFIIIACGALSGFHALVSSGTTPKMIMKESQVRLIGYGGMLTESFVAIMALVAAC
FT                   IIDPGLYFAMNMPAPALGPTLETASAAVANLGFVITPDQLAAAARSVEEATLAGRSGGA
FT                   PTLAIGISEIFSGVLGGDALKAFWYHFAIMFEALFILTTVDAGTRVGRFMLQDTVGNVW
FT                   KKAGDVGWRPGVYAASAVIVGAWGYFLWAGVRDPLGGINQLFPLFGIANQLLAAIALAV
FT                   CTTLLIKTGRAKWAWVTLIPLAWDAAVTLTASWQKVFSADPKIGFFAQREQYAQALQAG
FT                   QTSLGTATTREQMEQVVVNTTVDGVLAALFAVLVVVILIDASRVWIKALRAGRPLPTHE
FT                   DPYVKSELWAPSGLIATAEERRLMRRRPPAAATAGTGADTDAGAPA"
FT   sig_peptide     364655..364771
FT                   /locus_tag="Tcur_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.706 at
FT                   residue 39"
FT   gene            366874..367203
FT                   /locus_tag="Tcur_0335"
FT   CDS_pept        366874..367203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0335"
FT                   /product="protein of unknown function DUF466"
FT                   /note="PFAM: protein of unknown function DUF466; KEGG:
FT                   mca:MCA0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95937"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L5"
FT                   /inference="protein motif:PFAM:PF04328"
FT                   /protein_id="ACY95937.1"
FT                   /translation="MTRPPHLFQRVVSAGRLRRRRGLRRGRGLRGDREGSRPRLLGPRV
FT                   ARGSLPERLRSAWRLLREFAGERAYEIYLEHRRRHHPGEPVMSEREFWRRHFDSRGRNP
FT                   GTRCC"
FT   gene            367384..368184
FT                   /locus_tag="Tcur_0336"
FT   CDS_pept        367384..368184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0336"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95938"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L6"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACY95938.1"
FT                   /translation="MDEGVQNPAIDTTVPHSARIWNYWLGGKDNYEVDQEAARQTMEVL
FT                   PEIVDIARHSRAFLRRAVRYLVAEAGIRQFLDIGTGLPTADNTHQVAQSIAPECRVVYV
FT                   DNDPLVLVHARALLTSTPEGATDYIDADARDPDTIVREAARTLDFTRPVAIMMLGVLPF
FT                   IGDDDQVRTILRRLLEAVPPGSHLAITHSTSEVTGERVIEAVRRWNEVAPTPYTLRSPQ
FT                   TIASFFDGMELVEPGLVSCPRWRPDTHQIGDQPDMDEYCAIGRK"
FT   gene            368292..369491
FT                   /locus_tag="Tcur_0337"
FT   CDS_pept        368292..369491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0337"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95939"
FT                   /db_xref="GOA:D1A1L7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95939.1"
FT                   /translation="MAAGDTPERIGVRIARERKRRGLTQLGLAQRANYSRSHIAQVEAG
FT                   HKMATPAFIAAVAAALGVSPARLYGQPFYENSPVRGAVHTHIPEIRRVLALVDVPPDLE
FT                   GPPRRLTELDAELAMIRRLQVASRYSRIGERLPALLQELSWHAHHTEQARVWHMLFLAQ
FT                   EAAADLCRKLGYHDLAGTCLDRAAESARRAQDPHLPLLVVFRRSLLLLAVAQWRSALTL
FT                   LDRAVRAVDHSREDAAEVLGTAHLRAAIAAARAGDAATAWDHHGQAVEIRRRAGRAPGD
FT                   RHGITTGFVTGNVAIHGAAVAVELGDMDEAVRRDRRIHPRLLADLPPERRAHHEIDMSR
FT                   ALLETGDYGRALQRLEKAEQIAPQLTYFHPSARSAVAHLVDVRRTLPEPLRRLQSHMGV
FT                   "
FT   gene            369764..370957
FT                   /locus_tag="Tcur_0338"
FT   CDS_pept        369764..370957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0338"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bid:Bind_2413
FT                   helix-turn-helix domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95940"
FT                   /db_xref="GOA:D1A1L8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95940.1"
FT                   /translation="MVADAAPERIGIRIARERKRRGLTQLGLAQRANYSRSHIAQVEAR
FT                   HKAATPAFVAAVAEALEVDPALIYGQPYRGVGSDDKAHAAIPELRRILACVGAGPEPDR
FT                   PPRGLDELERQIRQARRLLLQVRLTRLGMMLPAVLEELTWHAYETDSPKAWGLLFRAYY
FT                   EAVSLTRRLGYTGDALALLERAADAARRSQDPHLPLLVSLPRALLLMSMNQNRTALRLL
FT                   NDALSRVEADRPDAGEVAGALELRAAVVAARTCDGVSEAWEHHGRAAELAEAGRVGDGR
FT                   HGMEFGMSNVAVHGAAIAVELGDLDEAVRRDRDIRQRQVLEGMAPERRAHHEIDMSRAL
FT                   LELGDYDQALARVENAERIASQMTYFHPSARSVVAHLVDVRRTLPEPLRRLQSRMGV"
FT   gene            371412..371693
FT                   /locus_tag="Tcur_0339"
FT   CDS_pept        371412..371693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95941"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95941.1"
FT                   /translation="MRTRRGASRSQVYDPRQRWIAASIERERAPRWVVWWGVASRRAVP
FT                   TWQGAAVAIVEGRDAGELWAAMNAVERRALGSADKIRGGGGGFGRDVR"
FT   gene            371690..371911
FT                   /locus_tag="Tcur_0340"
FT   CDS_pept        371690..371911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95942"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95942.1"
FT                   /translation="MTGEVYRVDVAPAGQVCEGAVHGPVLAPAAVVATADGSFWCALCW
FT                   WPIAVALLTDGHRVVYSATARDVLGIGV"
FT   gene            371972..372904
FT                   /locus_tag="Tcur_0341"
FT   CDS_pept        371972..372904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0341"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   spe:Spro_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95943"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY95943.1"
FT                   /translation="MRWPLGRPRMDAFAGLVGVPVAEGDGGVSGMFLGTSSVLLRDGDT
FT                   ALLTDGFFTRPGWLRVGLGRIAPDREVIDACLRRAGIGHAGSLAAVICVHSHYDHAMDA
FT                   PVIAERLGAKLVGSHSSANIGRGHGLPEEALRTVEDGETVRFGDFEVTFVVGVHCPGDL
FT                   APGAIDAPLSPPARARAYRTGEAYSVFFRHPLGTVLVHGSAGFVPGRLDGHRADIVYLG
FT                   IGQLGKQDDDYRRRYWAEIVRATGAEVVIPIHWDDFTTPLLTAPLRPFPYFADDVAVSM
FT                   RFLVEQSRRDGVRLVLPDLWRETTLLPVR"
FT   gene            complement(373020..374018)
FT                   /locus_tag="Tcur_0342"
FT   CDS_pept        complement(373020..374018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0342"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dal:Dalk_4058 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95944"
FT                   /db_xref="GOA:D1A2C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY95944.1"
FT                   /translation="MLSLRSLSVGYPGRRRRPARRVLEGLEAVARPGDLTVLIGPNGTG
FT                   KSTLLRTLAGLQPALEGQVLLDGSPITALDEVERARRIAVVLTERDLPALLTARELTGL
FT                   GRHPHTGFTGRLTAADQAVIDWALQVTGAAHLAHRPVTELSDGERQRVLTARALAQEPS
FT                   AILLDEPTAFLDVPSRVALMGLLRRLARERSLVVVVSTHDLELALRIADRIWLIDPAGA
FT                   LHCGTPEELTLNGTIGASFDGEELTFEAASGVFVLHGKGRGTARVTADGTRRPLLERAL
FT                   TRAGWHPSPEGPADLAVTWTGEAYEAVRDGTAHRFTSLADLTDWARHEANR"
FT   gene            complement(374023..375090)
FT                   /locus_tag="Tcur_0343"
FT   CDS_pept        complement(374023..375090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0343"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ppd:Ppro_1257 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95945"
FT                   /db_xref="GOA:D1A2C5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C5"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY95945.1"
FT                   /translation="MTEPAFAPAARRRTAVMAVLAAAVAVSFVLAVALGSTTIPLDQAV
FT                   AALLRLENADPGAQTIIWTVRLPRAITALLAGAALSVAGVQMQTLFRNPLAEPYILGVS
FT                   SGASLGVALVVTGWGGLASAFTGGVAGLGRAGIVVAASAGAAAVLGLVLALSRRVRSVV
FT                   TLLIIGVMVGSTTASLITLLLAYSDAQRAQQYLGWSLGSYSGTTWGDLALFTPVCTAAL
FT                   AAALMGVKPLNAMLLGENYARTMGVRVRRVRTATLLTASVLAGSVTAYCGPVAFLGLAV
FT                   PHMAKLLLGTADHRVLMPASVLLGGAVSLVCCIATQAPGSGAVLPLNAVTTVLGAPVVI
FT                   AVLLRSRAAQTGWAG"
FT   sig_peptide     complement(374995..375090)
FT                   /locus_tag="Tcur_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.647 at
FT                   residue 32"
FT   gene            complement(375087..376400)
FT                   /locus_tag="Tcur_0344"
FT   CDS_pept        complement(375087..376400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0344"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dal:Dalk_4056 ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95946"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C6"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACY95946.1"
FT                   /translation="MNLVHRAGRTPAERQPDPSLPHRPEAGRPAEGGSSRTFRTRRAWP
FT                   LATALVALSLVASACGGDGQGSQAAQDDRCVKEFDASKDYFPVKQTIRHATNFTLTYAK
FT                   NYQVVTVKQPAPGAKPQTYVLVRCGTPAPKAEGELKDAVVVETPVRTLFASSTTHLPFI
FT                   TDLGVLDRLKGVASAGLITSPQVRERVAAKQIIEYADITGQEIDTEKVIGARPDVLMTD
FT                   GNDVPAHQTLRNAGIKIVANAEWQETSALGRAEWIKFVAALTGTEAKATEVFDKVAAAY
FT                   QELAAKAKQAEPVSVLPGQMFQGQWAIPNGESFMAKLIADAGGTYAWADTKGTGSTNLD
FT                   LETVLSKARDAEVWLPQMNDWKSLEDVRKADPRYAEFAAFKSGKVWSMNKVLGPGGGND
FT                   FYERGVGRPDLILADLVAILHPELMPGHTFTFYQQLAR"
FT   misc_binding    complement(376536..376721)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 79.14"
FT   gene            376984..377970
FT                   /locus_tag="Tcur_0345"
FT   CDS_pept        376984..377970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0345"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574;
FT                   Methyltransferase type 12; KEGG: scl:sce6070 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95947"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C7"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACY95947.1"
FT                   /translation="MVSAELPFSGVRTDIPSPARGYGWMLGGKDNYEADRQFVRQMLKN
FT                   LPEALDAARENRLFLYRVVRHLAAEAGIRQFIDMGCGLPTDNNVHQVAQRFAPDSRVVY
FT                   VDIDPIVLAHGRALLADDDSTTVIRADIRQVEEILDHPETKRLIDFDEPVAVLFLSVGH
FT                   MLPDKDDPRRILQTVIDRIAPGGYIAFTQATSDDPAHRALMNSQLSAYGLTWQTRSPQE
FT                   VQALLAGLEPVAPGLVDVNDWRPDPDQPPLPPRPRRAEALRRRLQAQQGRLRVRRPAAQ
FT                   ARLITGPWQAHGGAGRAKARRRHRRLAERTRWMRFTAPDGRTSPEGG"
FT   gene            complement(377930..378520)
FT                   /locus_tag="Tcur_0346"
FT   CDS_pept        complement(377930..378520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0346"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_3256
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95948"
FT                   /db_xref="GOA:D1A2C8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95948.1"
FT                   /translation="MPRITAPTVAEHRARRYAELLEAARRIVLADGPEAVTPGAVGARI
FT                   GLARSSVYKYFPTSRDILVHLLEEIFQRWNARLGEVMAAQAGPAERVTAYIRTFLEFAG
FT                   SEEHRIADAIGFPSLPPQDAARIRVLHRRLTEPLCQALIELGDPSPQITMELMVGTLNA
FT                   ATRLIAQGHSKAQITAATLAFIRPPGTCGRPER"
FT   gene            complement(378542..379231)
FT                   /locus_tag="Tcur_0347"
FT   CDS_pept        complement(378542..379231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0347"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: dar:Daro_1671 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95949"
FT                   /db_xref="GOA:D1A2C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY95949.1"
FT                   /translation="MTATTATTTGLALEQVTLEYGTGDTLVTALDEVTLTVEPGEFVAV
FT                   VGPSGSGKSSLLAVAGALIHPTRGQVRIADVTVSGAKAAELARLRRTRIGYVFQSGNLL
FT                   ASLTARDQLLLVPHLSGRITAEDRARADELLEAVGLTAKADRRPHELSGGERQRVGLAR
FT                   ALMNRPAVLLADEPTAALDRRRAREIVALLAAQAHERKAATVMVTHDTDLLEAADRVVH
FT                   MRDGKLS"
FT   gene            complement(379228..380334)
FT                   /locus_tag="Tcur_0348"
FT   CDS_pept        complement(379228..380334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0348"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   scl:sce1111 lipoprotein releasing system transmembrane
FT                   protein LolC"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95950"
FT                   /db_xref="GOA:D1A2D0"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D0"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACY95950.1"
FT                   /translation="MFLALRDLRFARGRFALMGTVVGLIAVLAVLLTGLANGLVNDNVS
FT                   GLRSLPATHLAFQPGVDGNLFSRSTVDPALAQQWAKVPGVRAATPYGNTLTHAKEERSG
FT                   KDVDVAVFGVEPGSFMAPEPLTGDPLGSREDGVLISRKLVDEGLKIGDTLVVERSEVRL
FT                   PIIGTIGDVSYGHVAVAYAPLKTWQRIYYGLPGEPPQEAFKVATAIALDGEPGAGGPKA
FT                   EVLSREESYGQSPGYSAEQATMQMIQFFLYVISMFVVGAFFVVWTVQRKDEIALVRALG
FT                   GSAGYLVRDALAQVLVVLVAATAVGTAVGAGMIALLRRVAPGMPIAWAPGPIVTAMALL
FT                   VVLGVLGALAALRRITSVDPLLALGGNR"
FT   sig_peptide     complement(380218..380334)
FT                   /locus_tag="Tcur_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.596 at
FT                   residue 39"
FT   gene            380431..381477
FT                   /locus_tag="Tcur_0349"
FT   CDS_pept        380431..381477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95951"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D1"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_4664"
FT                   /protein_id="ACY95951.1"
FT                   /translation="MSTTEREITEPVELCLPDGRLNPAAAGWTRRPLHTCRLRGWGRTK
FT                   RWEYWCVTTPTHLLAVTVSDLDFLALNSVYFLEYGGFEFERTALVPFGRGVSLPPVIAG
FT                   TPGDPSTDVVVGPERPTGGQVRVEITALPGGTRLRARCLTPDRRPLEADLEVALPAGHE
FT                   TLGVVVPWSDRRFQYTAKHTARPATGTVRIGSSTYEFGEDAWGVLDHGRGRWPHSITWN
FT                   WGAASGRSGGHVVGLQLGGKWTEGTGATENALCVDGRLTKIGQELQWRYDPGDFLAPWT
FT                   IRTPDGEQVDLTFTPFHDRVVRTNAVLLANRTDQCFGRYHGRVRTDDGRDVPIDGLLGW
FT                   AEEVRMRW"
FT   gene            381765..383153
FT                   /locus_tag="Tcur_0350"
FT   CDS_pept        381765..383153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0350"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: gme:Gmet_1930 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95952"
FT                   /db_xref="GOA:D1A2D2"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D2"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACY95952.1"
FT                   /translation="MNALDLARWQFGITTVYHFIFVPLSIGLAALVAVMQTIWYRRKDP
FT                   RYLRMTKFFGKLLLINFAVGVVTGIVQEFQFGMNWSDYSRFVGDVFGAPLAMEGLLAFF
FT                   LESTFLGLWIFGWDKLKPAVHLATIWLFAIGTALSAYFIIAANSWMQHPVGYRINPDTK
FT                   RAELTSIWEVLTNPTTLAAYPHVIFASLITAGMLIAGVAAWYLYKHRDTDVFRPALRLG
FT                   LIVSLVASIGVFISGDIQARVMTEQQPMKMAAAEALYETSAPASFSLFTIGSLDGREEL
FT                   WSLRIPHLLSFMATGDPNGQVEGINDVQRAYEALYGPGSYIPVVPITYWNFRLMIGFGA
FT                   LAAAIALWGLWLTRDGRTPRSRWFTRAALIGIALPYLANTTGWIFTEMGRQPWVVHGML
FT                   RTADGVSPTVGGAEVIVSLAVFTVLYGVLAVVAGVLMTRFAKQGPPKEEELPKEDEPMP
FT                   SFTY"
FT   gene            383172..384263
FT                   /locus_tag="Tcur_0351"
FT   CDS_pept        383172..384263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0351"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   gme:Gmet_1929 cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95953"
FT                   /db_xref="GOA:D1A2D3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D3"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ACY95953.1"
FT                   /translation="MELTTVWFLLIAVLWAGYFLLEGFDFGVGVLMPVLAPRKAAHSDT
FT                   DRRVMINTIGPVWDGNEVWLLVAGGATFAAFPEWYASLFSGFYLALLLILAALIVRGVA
FT                   FEYRGKVDSDRWRRNWDLAIFWGSAVPALLWGVAFANILQGVPLDAQHHYTGTLLTLLN
FT                   PYALLGGLTTLTVFTLHGAVFLALKTRGHVRDQARRAVRYLAAPTVAIAAAFLVITGVR
FT                   FGVPWTWATTAVAALALAGGVAAALRGRDGWAFTGTAVAIVATVATMFGDLWPAVLPST
FT                   IDPAYSLTVENAASTPYTLKVMTWVAVIFTPIVLAYQAWTYWVFRKRLTREAIVPPAPS
FT                   GDGAPARPAKAHEPEHAVERSRA"
FT   gene            384260..385921
FT                   /locus_tag="Tcur_0352"
FT   CDS_pept        384260..385921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0352"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: afr:AFE_1388 ABC transporter, CydDC cysteine
FT                   exporter (CydDC-E) family, permease/ATP-binding protein
FT                   CydD; TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95954"
FT                   /db_xref="GOA:D1A2D4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D4"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ACY95954.1"
FT                   /translation="MKPLDPRLLRHARPARIFLALTVVLGAVTTGLVLAQAALLAHALA
FT                   GAFHGRGPGELRWTLGALLAVVVARAAVHGLGEAAALHYAGTVRSLLRRRLIAHALGLG
FT                   PQWTAGKRAGEVATVATRGLDALDVYFARYLPQLALACITPVAVLAVVAGADLLSAMVI
FT                   AVTLPLIPVFMVLVGLHTKARTERQWRLLQRLGGHFLDVVEGLPTLKLFNRADAQAQVI
FT                   AEVTGAHRRITMRVLRVAFLSALVLELLSTLAVALVAVQVGLRLLNGDVPYETALLVLI
FT                   LAPEAYLPLRAVGAQFHAGMEGVAAAERAFEVLDTPLPRRPAGGGAAADLRRDRIVLDE
FT                   VTVRYPDRDRPALEKASLTIEPGERIVVVGPSGAGKSTLLSLLLRFTEPASGTVSFADV
FT                   PVESWREQISWVPQHPHLFDGTIADNIRLGRPGASPADVRRAAAQAGLAEFIEALPDGY
FT                   DTHVGERGARLSSGQRQRVALARAFLRDAPLVLLDEPTAHLDPLTAHGVQEAVHRLAAG
FT                   RTVVLVTHDPTWTHFADRVVHIEAGRLRESRSLAVA"
FT   sig_peptide     384260..384367
FT                   /locus_tag="Tcur_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.809 at
FT                   residue 36"
FT   gene            386022..386237
FT                   /locus_tag="Tcur_0353"
FT   CDS_pept        386022..386237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95955"
FT                   /db_xref="GOA:D1A2D5"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95955.1"
FT                   /translation="MIDLVRSGGRLLSATGHAATSGVVRLAGLSSFGVGVAIAAVPVLV
FT                   LHGRGLRRPVAAPAAGSGLPAREPVP"
FT   gene            386355..388130
FT                   /locus_tag="Tcur_0354"
FT   CDS_pept        386355..388130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0354"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="KEGG: ppd:Ppro_3547 ABC transporter related;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydC; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95956"
FT                   /db_xref="GOA:D1A2D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D6"
FT                   /inference="protein motif:TFAM:TIGR02868"
FT                   /protein_id="ACY95956.1"
FT                   /translation="MTALASTSVRRRRPLMWLLAAAGPVRGRLVLAAVLGAATTAAGIG
FT                   LLGASGFLIARAAEHPGVTALTIAVVMVRALGVSRGVFRYLERLTAHDVAFRVLGDVRV
FT                   RIYRRLARLAPAGLRPLRSGDLLSRLVSDVDSTQDLFVRGVVPVAAAALAGGGAVAACA
FT                   FLLAPAAGMLAVGLLVAGALLPALSAARARAAGRRTARARGAVSARVVDALAGAAELHA
FT                   FGAQDRALAAVAEADAELTAQSRRGALVQAAGAALASLAAGLTVWAVLLLGVAAVEDGT
FT                   LGRVPLAVLALTALAAFEATSALPAAAAQLAETRAGAARILDVLDAPDPVAEPPSPAPP
FT                   PEPPLTVRMRGVRARYTPGGPLVLDGLDLDLTPGKRVALVGPSGAGKSTVAALLLRFLD
FT                   PAGGTITLNGTDLTAFASDQVRRLIGGCPQDPHIFDATVRDNLKLARPQASDAELADAA
FT                   ARARLLPWIESLPDGWDTHVGARGARMSGGERRRLALARALLADPALMILDEPTAHLDR
FT                   PTAAALTADLLRATQGRTTLLITHDLTGLEEIDEIVVLDAGHVVQRGTHAELLARPGLY
FT                   RTLWRCSAPDACAVP"
FT   sig_peptide     386355..386453
FT                   /locus_tag="Tcur_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.536 at
FT                   residue 33"
FT   gene            complement(388249..388815)
FT                   /locus_tag="Tcur_0355"
FT   CDS_pept        complement(388249..388815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_04340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95957"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D7"
FT                   /inference="similar to AA sequence:KEGG:HCH_04340"
FT                   /protein_id="ACY95957.1"
FT                   /translation="MAIHVANRRRARASIEAAHPGALILDVTSRAERPWARFSPFYPHG
FT                   GIPVPFSPGVTAQSVEGIWQALKVFANADVDPAKLEITTMKGLKRTVRKHGPVRGHRAG
FT                   LTGEVLLPYEQARRQIYLPSYRWVLEHRVADLMDRLKELSSRGDIVLLDYTTNGDVTDL
FT                   SAPLSHAALIRCHIEDRWPASPAAP"
FT   gene            389045..390106
FT                   /locus_tag="Tcur_0356"
FT   CDS_pept        389045..390106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0356"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_pAT_449 ferric enterobactin transport protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95958"
FT                   /db_xref="GOA:D1A2D8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY95958.1"
FT                   /translation="MLTPVREAPLRDDPPQPAVAGALRRGRVAGLFLLAGLLVLIVMAS
FT                   FAIGAERVPLSRVLPGIFEPDGSQSALIIQEMRLPRTLLGLAVGASLGLAGALMQALTR
FT                   NPLAEPGVLGVNGGAALAVVLLIWLADVDQVLVYVWAAFAGAAGAVLLVYMIGSYGRAG
FT                   ATPGRLVLAGAALNAVFSALTNGVMLLDPHGFNSFRFWQVGSLAGRDLATLAQVGPFMA
FT                   AGVLLALSLARSLNVLALGEEAGRALGGSLGRTRALGALAVVLLSGAATAAVGPIAFLG
FT                   LAVPFIVRALVGPDQRWVLPYSLLLAPVLLLGADIVGRVVAPPAELETGIVTAFLGAPI
FT                   FIMLVRRGRMPKL"
FT   gene            390103..391128
FT                   /locus_tag="Tcur_0357"
FT   CDS_pept        390103..391128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0357"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pag:PLES_07661 ferric enterobactin transport protein FepG"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95959"
FT                   /db_xref="GOA:D1A2D9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D9"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY95959.1"
FT                   /translation="MSRVVRAGTLSVRWQPRSALVGAGVLAVALAASVLVIGTGEFQIA
FT                   PGEVVLTLLGRGDRASEFIITELRLPRAVTALLAGLALGMSGAIFQSMSRNPLGSPDLI
FT                   GFTAGASTGALLQILVLGGGTAAIVAGSVTGAVGTAAAVYLLSYRGGGVSGQRLVLVGV
FT                   GAAAMLQALNSYLITRAELREAYEAAFWLTGSLNGRGWEHVVPLGCALAVLVPLALSQS
FT                   GRLRMGELGDDAARALGVPVQRSRAVLVVAGVGLVAAATTAVGPIPFVALAAAPLARAL
FT                   TRCTGPHLLSAGLMGAALLAVGDLISLKLPVPVPVGVVTGVLGGLYLAWLLARTGRRGA
FT                   I"
FT   sig_peptide     390103..390198
FT                   /locus_tag="Tcur_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.518 at
FT                   residue 32"
FT   gene            391200..392003
FT                   /locus_tag="Tcur_0358"
FT   CDS_pept        391200..392003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0358"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: atc:AGR_pAT_452 probable iron-siderophore uptake
FT                   system ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95960"
FT                   /db_xref="GOA:D1A2E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY95960.1"
FT                   /translation="MSRLRAQDLTLAYEQRVIAEHLGVEIPDGSFTVIVGPNACGKSTL
FT                   LRALSRLLRPRAGAVYLDGEQITALPAKQVARRLGLLPQQPLTPDGITVADLVARGRYP
FT                   YQRLLRQWSREDERAVAEAMAAVGVSDLADRVVDELSGGQRQRVWLALVLAQQTPILLL
FT                   DEPTTFLDIAHQIEVLDLCARLHEEGRTLVAVLHDLNQACRYATHLIAMRDGRIVAQGR
FT                   PAEIVTAELVERVFGLPCQIIECPQTGAPLVVPMDRRRALTPETL"
FT   gene            392042..395437
FT                   /locus_tag="Tcur_0359"
FT   CDS_pept        392042..395437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0359"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; Non- ribosomal
FT                   peptide synthetase; phosphopantetheine-binding;
FT                   condensation domain protein; KEGG: pfl:PFL_3493 pyochelin
FT                   synthetase E"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95961"
FT                   /db_xref="GOA:D1A2E1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E1"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY95961.1"
FT                   /translation="MLTREELHQSLTQVLGEQVDPHDNLIELGMDSIRLMSLTGRLRKR
FT                   GIEITFAELAERPTLAQWWELLAERGALAPAAEPETPQEPAADAQEPDGPFPLALMQHA
FT                   YWIGRDSEQELGSVAAHLYVELDGRDIDPGRLEKAVRTLVERHPMLRVAICDDGTQRVL
FT                   PERPGPAITVLDLRRAADPQAELERVRREMSTQRLPIDTGKVFDLRLSLLPSGTARLHL
FT                   DVDMVAADAMSYRTMLADLAALYEGETLPPLRYSYARYLAADPRAQARERDRAWWAQRL
FT                   ADLPGPPELPVVPKPGHRVVRKHHWLSPEGKRQLITRAHREGVTPAMALATIFAEVIGA
FT                   WSATPRFILNLPLFHREPVHPDVDKLVGDFTGSILLEIDLTEELPFVERARAVQAKLHT
FT                   AGTHSDYSGLEVLRDLSRQRGEQVLAPIVYTSALNLGELFDERVRALFGEPVWIISQGP
FT                   QVLLDAQVTEVSGGLLLNWDVREPAFPEGVADAMFAAYTDAVTRLGAPDADWSRPLRIQ
FT                   APPEQLEIRKRLNARPAPPSRTLIEGFFANARHNPQAPAVHWDDDGTLTYGELADRALR
FT                   VAGHLVAQGVRPGDRVAIELPKGPDQAVAVLGVLAAGAAYVPIGVEQPPARREKITKTA
FT                   QIALSLTPAALTWALAQAQPLAEPVPITPGQVAYVLFTSGSTGEPKGVEVSHRAAMNTI
FT                   GDLIERFSLGPRDVSLGISALDFDLSVFDLFALWTAGGAVVIPAEEERKDAARWAELVA
FT                   RRSVTVLNCVPSVLEMLLQTGGDVRSLRVVLLGGDWVGVHLPGMLAERAPGCRFVALGG
FT                   TTETAIHSTVQEVSGPVPEDWHAVPYGVPLRGVACRVVDEQGRDRPDWVPGELWIGGGG
FT                   VAEGYCGDPERTADRFVTHEGVRWYRTGDMARYRPDGTLEFLGRRDHQVKVRGFRIELG
FT                   EIEAALESHPRVRRAVALLAGSRLAAAIVPASGEVDRQELQDHVRDLLPPHMVPELLVR
FT                   VEELPLTANGKIDRKALTALAAAEAGEAAATYVEPTTALEKVIARTIGEVLGIERVGAE
FT                   DDFFALGGDSVLATTVVARLREALDTTSLPVRVIFAQRTVSRIARRFTELEETPGRLEA
FT                   VADIWLTVADMTDEEVEAHLSGSA"
FT   gene            395863..396531
FT                   /locus_tag="Tcur_0360"
FT   CDS_pept        395863..396531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95962"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95962.1"
FT                   /translation="MPTDRFELAGDYVPDPEREITALLDGFFGFFAAHGISAELIGAMR
FT                   ARHEELQQTNAHLIVDEPARHNLRITLAVTAAYRTLRSHLGRPAAIEAVRRALAEPLGA
FT                   AIREGTRAMLDAAPDPFAAMVALCKTREEHAFGKGFTFHRAADDDRHYLLEVRRCFYHE
FT                   VLVANSAPELTPVLCAFDANWIEAIDPARDGFRFERTTTIGLGGTHCPFHFIRTGDTDS
FT                   "
FT   gene            396993..397799
FT                   /locus_tag="Tcur_0361"
FT   CDS_pept        396993..397799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0361"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   ISC; inositol phosphophingolipids phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95963"
FT                   /db_xref="GOA:D1A2E3"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR038772"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E3"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACY95963.1"
FT                   /translation="MSRQAGRGVTVASFNTRGLPLFGSNLAERYRAIAAFFESSDIDVV
FT                   NFQEVFTHRHLRLLSAGMPSFRHLAYRRALVGPAGGLVTLSRLPTGKSGYRRFPLLPSS
FT                   PGLPRTVRFKAALKGALITPLRDQGVCVINTHPVANGDGDWSDANRFRPLQQGQLTALA
FT                   RLVQEIEDPVVVCGDFNVARDSTLHRDFLATTGLVDAFAGSCPPTFHSAYLKPGQRPHC
FT                   IDFILVAKSIGVESTGTLFTDREPLAGGPSYLSDHIGLYARLCPKR"
FT   gene            complement(398397..398810)
FT                   /locus_tag="Tcur_0362"
FT   CDS_pept        complement(398397..398810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0362"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SM_b20217 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95964"
FT                   /db_xref="GOA:D1A2E4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACY95964.1"
FT                   /translation="MNWTLEVVLVPVSDVDKAKDFYADKVGFNVDHDINGFDGKRIVQL
FT                   TPPGSGCSIVIGEGLTEMAPGSLKGLQLVVNDVRAARARLAERGVEVSEVQVVSPTGAR
FT                   PAREDDDLDNVGFIHFTDPDGNAWAVQQITSRP"
FT   gene            complement(398919..400286)
FT                   /locus_tag="Tcur_0363"
FT   CDS_pept        complement(398919..400286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0363"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cvi:CV_2237 enterobactin exporter EntS"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95965"
FT                   /db_xref="GOA:D1A2E5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95965.1"
FT                   /translation="MLRRLALDVSPLRTSRPFRNVFIARTVSVFGIGMLMVALPVQVHQ
FT                   MTGSTLHVGAVSGTGGLALLAGLLWGGVMADRNDRRTLMLRGRIAAGIGFALLALNAFL
FT                   PSPSLAALYVLAAWDGVTTGISLTALLAATPALVGPDKLVAAGALNALTVRLGSMLSPA
FT                   LGGVVISAFGVGWNYTAAAAGTFGTLGLLTALPPLKPGGPPVVAGAGESGALGKTAETA
FT                   EAAAGSGGAVPAAQNTEADEETGGAEAAHPLRAIGAGLRFVAGHRVVGGLMLLGLLFMV
FT                   AGGIPVLMPAFATEQLGGGPTTVGLLYAAPACGAVLASVTSGWTSALRAPGRVLLIASV
FT                   AGFVILACLGLARHPALAVAVLFGYGFVASIEEILRYGLIQTHTPDGYLGRVNALWSAQ
FT                   DTAGEAVGSVSAGALGRYLAPGDAIVVYGAVSAVLALILAVFLTGLRTATLRPETA"
FT   sig_peptide     complement(400155..400286)
FT                   /locus_tag="Tcur_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.495 at
FT                   residue 44"
FT   gene            400364..400771
FT                   /locus_tag="Tcur_0364"
FT   CDS_pept        400364..400771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0364"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: mxa:MXAN_6830 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95966"
FT                   /db_xref="GOA:D1A2E6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E6"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACY95966.1"
FT                   /translation="MRRTLMNGKIHRATVTQANLHYVGSLTIDADLMAAADIVEGEQVQ
FT                   VVDVTNGARLVTYAITGEAGSGVIGINGAAAHLVKPGDMVIIISYVALTEEERRSHRPK
FT                   VVHVDEHNRIVALGDDAAEPVPGVPAQLAGR"
FT   gene            400775..402349
FT                   /locus_tag="Tcur_0365"
FT   CDS_pept        400775..402349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0365"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   scl:sce3880 (2,3-dihydroxybenzoyl)adenylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95967"
FT                   /db_xref="GOA:D1A2E7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY95967.1"
FT                   /translation="MEGFTPWPEELAARYIAEGYWGDHVLGEVPQGDPDRVALVAGDER
FT                   LTYAELERRIDRTAAGLHRLGIRRGDRVVLQLPNTASFVIVFLALMRLGAPPVLALPAH
FT                   RHSEIGYLCELAEAKAYIIPDRHAGYDYRELARSLGGVEHVIVDGEAAEFTPLAELDAD
FT                   PIPLERPDPADVGLFLLSGGTTGLPKLIPRTHRDYVYNLTASAEVCGFTSGTVYLVVLP
FT                   AAHNFALACPGLLGTLSVGGTVVLAPSGSPDAAFPLIERERATVCAVVPPIALLWLDAA
FT                   TWSEEDLSSLQLLQVGGAKLATEPASKIPGVLGCKLQQVFGMAEGLLNYTRLDDPPELI
FT                   ETTQGRPLSPADEIRVVDPDTGEDVPEGEVGELLTRGPYTLRGYYKAPEHNARSFTADG
FT                   FYRTGDLVRRLPSGHLVVEGRHKDQINRGGEKIAAEELEGHLIAHPAVHDAAVVGVPDP
FT                   VMGERTCAFLVARGTPPTLREVKEFLRDRGVADYKWPDRIEVVDAFPRTPVGKISKKAL
FT                   LAMLDKA"
FT   gene            402480..403217
FT                   /locus_tag="Tcur_0366"
FT   CDS_pept        402480..403217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL3033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95968"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95968.1"
FT                   /translation="MATRLVQIHMKAHDDSALGRFWAQALGWSLSSEGPGVTSLEPEGF
FT                   TYPDPTAVCIGIVADPSPKTVKNRVHLDLATTSAAHQADLVARLENLGATPVDIGQGDV
FT                   PWTVLADPEGNEFCVLEPRPVYRDTGPVAAVVVDCTDPRAMARFWGEAMDWTVHVVTDE
FT                   CAVLRSAKGVGPYLEFLRTPDAKTARNRIHLDLRPYPGDDQAAEVDRLRALGAVDIDIG
FT                   QGDVPWTVLADPEGNEFCVLTPM"
FT   gene            403786..404337
FT                   /locus_tag="Tcur_0367"
FT   CDS_pept        403786..404337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95969"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95969.1"
FT                   /translation="MRQEPDPGEDFLDALAGRLTGMPGRPVAVDLSAEDAWELVTRLDS
FT                   ALDADGVQTRMVLGAACPTTTEAIAQFVTAMQLPYRASRSWEDFLGELGERPVSQRQCL
FT                   VVTDACALLRHESFDRWRELVGGVCGGPYCMGGGWTTLVLADREPAWREWVFRPAADTA
FT                   RRSGWELPMLRGSAGASGFP"
FT   gene            404551..405279
FT                   /locus_tag="Tcur_0368"
FT   CDS_pept        404551..405279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95970"
FT                   /db_xref="GOA:D1A2F0"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95970.1"
FT                   /translation="MAAERVSGAGVTVVGRARWERALIWGGFPVAGAVLGGLVWLVAGW
FT                   VVALRWVPMRGPFELVDSLPDLPAALGCMGLGAVAGLVLAFVAEREYVTVAVGDDRVVC
FT                   VRDGAERSVPRASVGAVFVDEGRLVLLDRRGRELLVYSAREGADLPGTERLARAFKAHG
FT                   YPWSPGGDPHRDEYRRWVPDMPGLPSGANALLRARAKALDSGDGEEAAQLREELGRLGV
FT                   VVREDGKKRQFWRCVPPPLG"
FT   gene            complement(405360..406685)
FT                   /locus_tag="Tcur_0369"
FT   CDS_pept        complement(405360..406685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0369"
FT                   /product="Chorismate binding-like protein"
FT                   /note="PFAM: Chorismate binding-like; KEGG: pau:PA14_54940
FT                   putative siderophore biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95971"
FT                   /db_xref="GOA:D1A2F1"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019996"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F1"
FT                   /inference="protein motif:PFAM:PF00425"
FT                   /protein_id="ACY95971.1"
FT                   /translation="MSFGVRTDEIGLEAAELTVEVTSDPPQLMAQLAESGLFRDFVVYE
FT                   RPGEWTFAGGALGEVALESQTVRTRWAGRPETVRPWSGRPAAALQEAFAEAPWPAWNAY
FT                   GWVAFEFSCPQALRSQTRLAHLIVPRLQVRATAGRAVVTGADAAEVEQVGRLLADPAPR
FT                   PAPVPSPVDVRTGDDYRERVAKALEEIGAGLYQKVIVSRRLPIGFPVDVVGTFLAGRAA
FT                   NTPARSFLLDLDGFQATGFSPEVVAQTSADGTVMTQPLAGTRAFGLDADTDAARRRELE
FT                   NDPKEIFEHAVSVRTSQQELYRVCTPATVQVTGFMTVKERGSVQHLGSSVHGRLAPGRT
FT                   CWDAFEALFPAVTASGIPKPEAIEAITRLDEPRGLYSGAVLAVSHDGALDAALVLRALY
FT                   QQGGRAWLRAGAGIVTGSTPDREYEETCEKLSSVAPYVVPLR"
FT   gene            406863..419135
FT                   /locus_tag="Tcur_0370"
FT   CDS_pept        406863..419135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0370"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: bpl:BURPS1106A_A2212 non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95972"
FT                   /db_xref="GOA:D1A2F2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F2"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY95972.1"
FT                   /translation="MRRLMAERGIGRDTSRIAPRTSDGPAPLSYAQQSMWLHHRAFPDS
FT                   PAYNVCLLVRMSGDLDISALHAALRGVVRRHAILRTTYDDGPVQHIHDDDSLDLPVRDY
FT                   PGTGADAEAWARAQAGRIAARPFDLRTERPIRVELLRLAPREHGLVVVIHHIACDGTVW
FT                   GTMSGELAALYRAALTGEPDGLAPLPIQYADYAAWEQRRPLSREDLEYWRRRLDPAPEP
FT                   LDLPTDRPRTATVSETGGHRVRRFDDAVTAGIRDLAARENATPFMVMLAGYAALLHRYT
FT                   GATDIPVGSLVQSREHAETQPLIGHFGNTLVLRTDLSGNPTFRELLARVRQNCTEDFAH
FT                   QALPYDKIVEELRPARPRGRSPYFDTMFMYLAHEIGELDLPGITSWWTHIPSGAVHFDL
FT                   SLEAFARSHGLEVEATFRRELFDDERIDALLAHLETLLRSAVTDPGRRITDLELLSESE
FT                   RRQLAEWNATDRPVPATTVVELFEQQAARTPDAIAVESETGTLTYAELDRRASGLAALL
FT                   RARGAGPGKVVALALPRTGDLVAAVLAVLKSGAAYLPLDLDHPADRLAYMLQDAAPLCT
FT                   LATEQTRAVLPDDAEVLVLGDRTPAPAPSRPVTGDDLAYVIYTSGSTGRPKGVAVPHAA
FT                   LTNFLLMQREELALRPGDRLVAVTTIAFDIAALELYVPLISGATVVLASRNAVRDPAAL
FT                   AELLADATIVQATPSLLGSLDPAALQGLRVLVGGEALPAALADTLTRVASRATNVYGPT
FT                   EATIWATSAELPSTGIGRPFWNTRAYVLDASLRPVPPGVPGELYLAGAQLAHGYIGRPD
FT                   LTAERFVADPFGPPGTRMYRTGDLARWRRDGTLEYLGRTDDQVKIRGFRIEPGEVQAVL
FT                   AAQPGVAQAAVIVREDRPGDKRLVGYLVPGPEGLDETAVRAAAARALPEYMLPSALVVL
FT                   DALPRTVNGKLDRRALPAPHLETGGRRPRDARETALCELFAEALGVDEVGIDDDFFALG
FT                   GHSLLAARLAGRIRAALGAELTIADVFEAPTVAQLAPRLVEGTRTRVRDVTRPEVVPAS
FT                   AAQRGLWLEERMHGPSVSYTVPLGARLRGPLDVAALRAAFGDVVARHEALRTLLVEGPD
FT                   GLPIQRVLPPGGELFEVRDLRGLPADQVAEAEAQAARHRFRLGVDLPIRATLLRVDDEA
FT                   WTLILLQHHAAADEWSFTPLLADLSRAYAARAQGREPDWAPLPVQYADYTVWDAAQDHT
FT                   HQLDHWERALAGLPEETTLPPDRPRPAEAGHRGDQVTFQLPLDGVRELARSTGTSVFMV
FT                   LHAAMAAVLQRAGAGDDIALGTPIAARPDEDLADLVGVFVNLLVLRTDLSGDPTFTELL
FT                   QRVRTADLDAFAHADVPFEQVVERLAPERSLARSPLFQVMIVHQRLADARLKLPGVEAE
FT                   PFLPKTGGVKFDLDVYFAEGDDRIEGVAAYATDLYDRETVTALFDRLAALLTRAVRHPG
FT                   RRLSQLLPPFDHPDTARDFGGRTVADLFAEQAARTPDAPALILPGGSGQAAATAENDPA
FT                   GRSPQDVVISYAELDRRAEELADRLAAAGAGPEQVVAIALPRSAEFVTALLAVIKTGAA
FT                   YLPIDVTYPQARIDHMLQAARPLLVLGRDEPPADAPPRERVEILPDHPAYVIFTSGSTG
FT                   TPKAVVGTQRALANRLAWGLDLVEPGMRVAKSSPAFIDGTTELLGGLLAGDPVLIADDA
FT                   TATDPVALAELIDRYRARTVTVVPSLLAALLEAGDLGSVTTWISSGEALPAGLADRIGA
FT                   RLINLYGCSEAAGDSLIAEGTATLHPIANTTAYVLDDALREVEVGELYLAGDGLARGYL
FT                   NDPARTAERFVANPFGPPGSRLYRTGDRVRRRRDGGLEFLGRADDQIKIRGFRIEPGEI
FT                   EAVLAAQPGVRRAAVTAHSGRLVGYLVGDADTSALHDRLRELLPDYLVPSDLVVLDELP
FT                   LNPNGKIDRRALPEPGRTGRGRAPRTEAERTLAALVTELLGRDGIGADDDFFRIGGDSI
FT                   SAALLVARARRTGLTFTVRDVFRLRTIAALAEAAQPVETAPSTGAQPEPGTAATSAGAD
FT                   GAAAAPTGASAAGTGGPPAGPAETGSGAGAAPGGRGAVSAGVLGAGAGGLSAGTGDGAG
FT                   AASGGRDVAAAGAFGAGMGRAAAGASADPVGEVELPLSPLQEGLLFHLLMAGEGRDIYV
FT                   QQAVVTLSGPLQPERMADAARRVLEKFPNLRAGFRTDGARTVQFIPEHFDVPWTYAEVR
FT                   TPEELEAFIEEQRARPFTPDRPPLIRFGLARVGEGDYRLVLTSELILLDGWSGGLLIGS
FT                   LMEFYTDPAAEHARPVTPFTAYLDWVGGRDRQAALEAWRHALSGFDTPALLKPELLDRP
FT                   ADLADAGEIHRPLPPGLIDRLEALARDRGITLGTVYQTAWGLLLMALTGRDDVVFGVSV
FT                   SGRHPEVDGVESIVGLLFNTVPVRVQAGPADPLATVLERVQNAHADLFDHFHVTLTDIQ
FT                   QATGLGTMFDTLFVFQNFPGIPTDRAFGPGRDVRLVERQVRDATHYPITMVAEPDAHLR
FT                   VMYRGDAFTEPEVHRLTDRYVQILQAIAENPDTPCHRLDALLPDEHEQIRRTWAEAEHP
FT                   VPDLTIAELLAERARQIPDEIALVSQPDVRLTYAELIGEVNRLARLLKQHGAGPEKVVA
FT                   LALPRSAQMVIALFAVLRTGAAYLPLELDYPAERLNYMIADAGPSCLVSHRDIAAGLDY
FT                   DGPAILLDDPHTRNRLAALPGTDLTDEELPGFTRTTPGRLEHPAYVIYTSGSTGRPKGV
FT                   ITPYRGLTNMQYNHRANIFDPVVSAAGRRLKIAHTVSFSFDMSWEELLWLIEGHEVHVC
FT                   DEDLRRDAEALTAYLQEHKIDVINVTPTYAQQLLEEGLLDGAHRPPLVLLGGEAVPVAV
FT                   WERLAQADGVLGYNLYGPTEYTINTLGGGTEDSATPTVGKPIWNTRGYVLDPWLRPVPP
FT                   GTPGELYIAGAGLARGYLGRPDLTAERFVADPFGPPGGRMYRTGDLVRVREDGNIDFLG
FT                   RTDDQVKIRGYRVELEEVEAALAAEPGVGQAAVVTADTDVPGVKRLIGYIVPDGQARPG
FT                   AAEEQLTEWRQIYDDEYTQVGTAVHVEEFAGWTSSYDGRPIPLEHMREWRDATVARIRA
FT                   LQPRRILEIGCGTGLLLSKLAPEAESYWATDFAGPVIAKLHKDVDPSWPVTLRCQAAHD
FT                   FTGLPKDFFDTIVINSVAQYFPTADYLADVITRSLDLLVPGGRLFLGDIRDLRTLRAFH
FT                   AAIQLGRGGGDLPAIDRAVRMEKELLLDPAFFTSLNLPARVEIRTKRGVHHNELTRHRY
FT                   DVIVHKPPFDGPSGDTPVIEWNGLEDLKKRLPGRLRVRGIPDPRLSGEIAALRALENGA
FT                   PPDEARTLLQAPPQGVEPETLYKLDPEVIITPSEQIGHYDAVFGGGEACLPAVPGRTYA
FT                   NNPAAARDHGALAGRVREGLKAKLPGYMVPSVIMTLDALPLTVNGKLDRRALPTPDAGS
FT                   GPRGTGRPPRTPVERLLCSLFAEVLQVKEVGIDDNFFDLGGHSLLATRLIGRARTVLRG
FT                   ELAIRDLFEAPTVAELAERIHSRADATEERPALTPRPRPEHIPLSFAQHRLWLLDQLLR
FT                   EDDGPRSAYHLPLGVYLRGELDLEALEAAIWDVIARHETLRTVFADHDGTPYQRILPPD
FT                   QARPPLEIDPCTPQEFIERPFDLARDIPLRAAAFRTGDREHLLLAVFHHIAFDEGSFGP
FT                   FSREVVEAYTARRQGKAPDWEPPAVQYADYTLWQRELLGDPLDPGSLHARQLAYWAQAL
FT                   SGIPEEIPLPVDRPRPGTVGQRGGTVIRDLPPSLVKAVRRLAREGGATVFMVGQAAVAA
FT                   LLHRMGAGDDIPLGSPVAGRTDEALGNLVGFFVNTLVLRADCSGNPTFAELLSRIREAD
FT                   LAGLANQDLPFEALVEALRPRRVPGRNPLFQVMVGYENQAGSEVRFPDLEQRNALVGPS
FT                   AAKFDLDFIFREEPNGGLRLVLDYSADLFDESTADTMASGLLDLLEKVTTDSTIPLSAL
FT                   PSPLTARTVTGPDRQTTTDHHDDRQATFCRIFAEVLGVDAVGPDDDFFDLGGHSLLAMK
FT                   LVRRLRQEPGCEHLKVATLMTAPSVNALLSRLS"
FT   gene            complement(419530..419780)
FT                   /pseudo
FT                   /locus_tag="Tcur_0371"
FT   repeat_region   420101..421226
FT                   /rpt_unit_range=420101..420130
FT                   /note="CRISPRs"
FT   gene            complement(421434..421640)
FT                   /locus_tag="Tcur_0372"
FT   CDS_pept        complement(421434..421640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0372"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95973"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F3"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY95973.1"
FT                   /translation="MAHYSVHDATWRRSSHSGSSGGECVEVAHLDSTTAIRDSKNPGAG
FT                   FLAMKREAWGRLLAEIKQGTYDF"
FT   gene            complement(421656..422519)
FT                   /locus_tag="Tcur_0373"
FT   CDS_pept        complement(421656..422519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0373"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95974"
FT                   /db_xref="GOA:D1A2F4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95974.1"
FT                   /translation="MPRPESPTVRRIMLGIRLRELRTRAGISADDAARHIARTDSTISR
FT                   METGQSSVSTRVLERLIELYQATPEEARQLTELAKAARQRGWWQRYGEVLHPGFELYLG
FT                   LEAEATEIHVYASEWVPGLLQTPDYARAILSAEPRPPAEEEIQQRVEARLARQVILGGE
FT                   DPVQYWAVLNEAVLRRIVGSPKIMRAQLEALAARARQRNIKLQVLPFTTGAHPAVGGPF
FT                   TLLSLDLGKAALAEYVYVENRAGSLVMDREAEIAIHRLTFDTFRADALSPEESVALIEK
FT                   TAAELA"
FT   gene            422747..423493
FT                   /locus_tag="Tcur_0374"
FT   CDS_pept        422747..423493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0374"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95975"
FT                   /db_xref="GOA:D1A2F5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95975.1"
FT                   /translation="MGHDQPPTLVTGGAHAWRLPPDERGPAMARSLLAQAMAALGLDQE
FT                   VIEDGRLAVSEIATNALRHARPAPGAAPVVPPELWVWARTVPAPQLVVSVFDGARSLPP
FT                   RPGRGGLLEESGKGLALVAEVAADWGYGPSRSLLADPPVPGKAVWFALPLPPDWPGRTV
FT                   TVHPDAAARCLMRVLARRGLHGRHSGTGALSVLELPGLNVWVLPGCFSWQPRPDRLIRH
FT                   PLIDLQETAERIIRHLDGSSSSMPAS"
FT   gene            424007..424669
FT                   /locus_tag="Tcur_0375"
FT   CDS_pept        424007..424669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95976"
FT                   /db_xref="GOA:D1A2F6"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F6"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3154"
FT                   /protein_id="ACY95976.1"
FT                   /translation="MTGMAGGVPASRAVGRVFFTDAASGRRSSCSASVVASDSGNLLLT
FT                   AGHCVYSRGWHRDWIFVPSYDQGKRPFGVWRAEWFVTPSRWITHGRPEDDVAFVKVASS
FT                   GGVRILDRVGGNGIRPGAATGRRRTVLGYPFLPPYRGDRQHYCEGVTRSEGRRMRMACR
FT                   LTTGASGGPWLDSYDRSTGFGYIGGVTTNTDLANTTLWSPLLGGDVWTLYRYADQLR"
FT   gene            complement(424733..427330)
FT                   /locus_tag="Tcur_0376"
FT   CDS_pept        complement(424733..427330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0376"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Lanthionine synthetase C family protein;
FT                   SMART: serine/threonine protein kinase; KEGG: smt:Smal_2130
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95977"
FT                   /db_xref="GOA:D1A2F7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F7"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ACY95977.1"
FT                   /translation="MSHAPATPTEQELRAELTGPVTGAGRQIHARGVWLAVDDPAFHLP
FT                   RQGWKIHLSARPATLQETIRRMLPAVLAVPCHFKVVRSGRHLQDLNSANNHPGSIGKAV
FT                   TIYPSPEDVAPLARRLAEDLAGMAGPRICSDRRVRPDAPVYYRYGPFHPCYDINDDGDL
FT                   ELVVTDPQGNTHPGAADDSFWQPHWSPDPLTGATPHPAPSDGPAAPVLLGGRYRVVRGL
FT                   TRNGKGCVYRAIDTTDNRPVIIKEARAHVNEDTLGRDSRLRLRNERYVLHLLRDLDDVP
FT                   KVIDHFRHEDREYLAITDLGALALGQDVAENGLYVADPAPPGRSLRALATALLELLDHV
FT                   HRRGVLVRDLTPTNVVLDDATGRPRLVDFEISHAEDPQLYGWTPGYSPPEQERDEPATV
FT                   EADYYSLGATLFYAATGLPPTWMTGDPGNHDPRRAAEVLAGRGGMSGTILGLLDPDPAR
FT                   RRAAADDIRAGRFTDAPPPPPPSARQRARRLAAAIAHSLTELSRHAADLMSGKDFTGGL
FT                   VGSPINLYRGAAGMGMELLRHDEPSRALARGLAYWTGGFRALRNGRPGLYTGDTGIAVF
FT                   IAEAGATLGDETLLKIAEPLARPVLSRITATDQHTGLAGIGTGQLLLWRLTKDAGRLEL
FT                   ADACARRLLARDLTAELQENPPDYADCGAVSRTLGFAHGLAGIVHFLRDHHAATGETAT
FT                   EAALHKGCDTLLEHLPPLLEAARAVSAKPMHASFCQGLAGIGAALARTGRDLGADDHLQ
FT                   AAREAAAACLELAPRMYALTQCCGLAGIGELFLDLCQITGDRTYAQWADRIADLILARA
FT                   GGSPEAPVFPDTSLHGSSGGWSIGTSGVVSFLRRLGDPAAPRLWLDPPAGTAR"
FT   gene            complement(427453..427608)
FT                   /locus_tag="Tcur_0377"
FT   CDS_pept        complement(427453..427608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95978"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95978.1"
FT                   /translation="MSALLEPRDAGTTNLDALATVPSEAPAFQAGSCTVCHWGRTVLCD
FT                   DFSTQA"
FT   gene            complement(427997..428152)
FT                   /locus_tag="Tcur_0378"
FT   CDS_pept        complement(427997..428152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95979"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95979.1"
FT                   /translation="MSALLEPRDAGATNLDALAAVPSEAPAHQAGTCTVCHWGYTILCD
FT                   DFSTRS"
FT   gene            428327..429292
FT                   /locus_tag="Tcur_0379"
FT   CDS_pept        428327..429292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0379"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mxa:MXAN_5317 putative daunorubicin resistance
FT                   ABC transporter, ATP-binding subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95980"
FT                   /db_xref="GOA:D1A2G0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G0"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ACY95980.1"
FT                   /translation="MTAGDTASDTPAAPVIHARALAKSYPGGPAVRGVDLSVAAGETFG
FT                   FLGPNGAGKTTTIAMLCTLTAPSGGRAEIAGHDVVTEAHQVRRHIGLVFQDTTLDLGLT
FT                   AWENLRFHARLYGVPAAAARERARMLLDLVGLGGRRDDLVGTFSGGMKRRLEVVRALMH
FT                   RPRVLFLDEPTIGLDPHTRAQIWEHLRLLRERERITVFLTTHYLDEAEHCDRIAIIDDG
FT                   RIIAEGTPAELKTVVGADRIELRSSDDRAAAAQLRDLFGLEATVTERGLSVRVADGAAF
FT                   VPRMCAALTVPIESVTVVRPSLDDVFFHYTGRTIREEGGR"
FT   gene            429289..430131
FT                   /locus_tag="Tcur_0380"
FT   CDS_pept        429289..430131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0380"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sat:SYN_01665
FT                   ABC-type multidrug transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95981"
FT                   /db_xref="GOA:D1A2G1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G1"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACY95981.1"
FT                   /translation="MTAPATAPRASRYADELAALGVVWQRDMLHYVRDRLKIVVTVLQP
FT                   VLMLLALGAGLAALLPASPGGADYRTFLFPGMLVMTVQAPAISAGVALVTDRQAGFLRE
FT                   MIVAPVRRETLLVGRCLGGATIAACQGALLLPLAGIAHLPYDPVLLALLLGELAVVALA
FT                   MTALGVLLAVTITRTESFYAVLSVLTMPLIFLSGAMFPVQGLPGWLSWAVLINPVSYAV
FT                   DALRRTITGYLPGPVPPQLFDGPRWGGWSPPVALELAGIAVLGAVMLVWASRRFGRLG"
FT   gene            430796..431884
FT                   /locus_tag="Tcur_0381"
FT   CDS_pept        430796..431884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC686385"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95982.1"
FT                   /translation="MISARQAITMGTSVAAVTAVLSALPTASAASIGRPADCHLRGQNY
FT                   AEGAVFYPRENGTGWVCRNGQWVRLLPSKQRPQMQHSQGVLSPQQGQQVQRPRVVLSPQ
FT                   QADQARRAFYEQWAYKLPHVQQSRQIWQVQQPQQGRHEIQQPAQMRQPLQVQQPQAVLL
FT                   PQQMERAGQIFQRQGTHELAHMQQPQQARQGQQARQERQARQEQQAQLAQQAQRPRMVM
FT                   SPQQADQARRAFYEQWAYKLPHVQQSQQAQQAWQALQAQQAQQAPQSQQSQQIQQAQEA
FT                   QQAQEGRSAQRGRQAQQNRQAQQNQQAQQNRQAQQNRQAQAQQNQQAQQARAQQNKQSQ
FT                   QAQQPQQIQRADQEVQQEQQAR"
FT   sig_peptide     430796..430885
FT                   /locus_tag="Tcur_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.776 at
FT                   residue 30"
FT   gene            complement(432323..434074)
FT                   /locus_tag="Tcur_0382"
FT   CDS_pept        complement(432323..434074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0382"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_3450 WD-40
FT                   repeat-containing serine/threonin protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95983"
FT                   /db_xref="GOA:D1A2G3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95983.1"
FT                   /translation="MKQTWSLTEFTETRELGRGAQGRVVLARHRKSGALVAIKYLERAA
FT                   PEALAGLRAEAQMLGRLRSPHVVRLYQFVETPQGAAIVMEAVNGVSLRAILDKHGALAP
FT                   EAALTVLKGSLLGLAAAHSVGVVHRDYKPANVVVREDGLSKLVDFGVAALAGQGSSSGT
FT                   PAYMAPEQWRGEPASPATDVYAATGVFLECVTGRRPFAGVEAAALMHHHLNVPVPLNDV
FT                   PEPLRPLIARGMAKDPGQRPPGAAAFVAELEATARAAYGPDWERRGIGALAGAAVALAS
FT                   LFPLTALAVTPAGAAVAGGSVASSVGQGLLATAAGKVTIAVAGTAVVAASAGTVTYATR
FT                   DASPAPRPSPAAVVTTATESWTSANPRVVLQNAQYVRVSGLRDAALQQRINRALRAPLD
FT                   RLIKMGREHAVRSRTACEGRPTQIYSTVRLGVRGPALVSVRYRLWSDWCQAADGMPAGE
FT                   VVTIDLRTGRRLTATDVFRPQTLTPTGLSRLQSLVVQREPDPPWSNCAPEGRFTRKHFG
FT                   DWTAPAGDREPPMLSAFFTPSAFELAWHVSGSDGCQTLTFTAPYAKVRDLLQPSVLSLL
FT                   NPSPTPS"
FT   gene            complement(434413..435402)
FT                   /locus_tag="Tcur_0383"
FT   CDS_pept        complement(434413..435402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95984"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G4"
FT                   /inference="similar to AA sequence:KEGG:Swoo_2011"
FT                   /protein_id="ACY95984.1"
FT                   /translation="MTTLIDIDARGMQHCETTALGVLLRHQGLDLSEPMLFGLGSGLSF
FT                   IYWDGKNLDFPFLGGRVKPFELTKNLAARLGLELAVHETSSPRKAWENVASAIDAGRPV
FT                   GLQLDSHHLDYFTPKVHFAGHIVAMYGYDDRTAYLVDTDSQGGAVTTSLDGLAQARAAR
FT                   GPMAAKHRSFTLTVPKDAPSPQSRIVPAITACADAFLNPPIANLGYRGIEKAGKLVRTW
FT                   LQRAGDPRRDLPQAAFLMEKGGTGGALFRNLYRDFLAECAQSIDSDHLRTGHRLYAEAA
FT                   TLWTETATLIAKAGESGDAQCLDQAGDLLGDLSRLEREAMQTLRRLAE"
FT   gene            436058..436963
FT                   /locus_tag="Tcur_0384"
FT   CDS_pept        436058..436963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0384"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mxa:MXAN_5113
FT                   universal stress family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95985"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G5"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACY95985.1"
FT                   /translation="MAHPSQTSTAPVVVGTDGSAGAEHAVAWAADEAMLRGRPLRIVHA
FT                   VQPWGMGTAVVVGSADLMVSLEGSGRLVLEEAERLARRRHPELEVGTELVMGSPEQALQ
FT                   GQADTAFEIVVGSHGTGGFAGLLLGSTGLHVAGHTPGPVVIVRGEAGGPAHGEVVAGID
FT                   PSVESRGVLEYAFEAASLRKARLRAVHGWRLPARIADGVDAEQTARSLRRSIEEAIAPL
FT                   RDRYPELETVVDVVRDHPVHALTVASQRADLVAVGAHDRRGLRALRLGSVSHGIVHHAR
FT                   CPVAIVRPGVVSHTSGDPAS"
FT   gene            437046..438143
FT                   /locus_tag="Tcur_0385"
FT   CDS_pept        437046..438143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0385"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mmw:Mmwyl1_3636 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95986"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G6"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACY95986.1"
FT                   /translation="MNLASLGKPYLNNLPYAVTAIHKEGHASPMRTMMRRLAATSALVL
FT                   SLGLVAACGGDSEDEPAASGTGQGAFPVTLTHKLGTTTIKEPPKRIVALGEVDQDTLLA
FT                   LGVQPVGMAELTGVQKDGLAPWTAPKVKDPKPKMLRATDSGFNLDEIAALKPDLILAGG
FT                   DYYIDKAYDKLSKLAPTTAYQTGPYEDSWQMIARQVAQAIGRPADGEKLVAEVEAKLNE
FT                   VKDKYPQLQGKEFAFTSTFPNGNLGVMKSTEDISVKTLNGFGMVLPEQIKNLPGDSFAV
FT                   ELSTEKLGVLDVDVLISHYNNDTALQRKFEQNKLFSSLDVVKRGSYVALDLQSFWPLRT
FT                   PTPLSAPYVVDNVVPKIAEAAAKAD"
FT   gene            438229..438435
FT                   /locus_tag="Tcur_0386"
FT   CDS_pept        438229..438435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0386"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: bbt:BBta_4111
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95987"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G7"
FT                   /inference="protein motif:PFAM:PF03621"
FT                   /protein_id="ACY95987.1"
FT                   /translation="MTNPFEDPEADYLVLVNAEGRHSLWPVFAAVPAGWSTAFGPDRRE
FT                   ACLEYVRTHWTDLRPRSLIEAHQ"
FT   gene            438432..439175
FT                   /locus_tag="Tcur_0387"
FT   CDS_pept        438432..439175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0387"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: scl:sce3882
FT                   iron utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95988"
FT                   /db_xref="GOA:D1A2G8"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G8"
FT                   /inference="protein motif:PFAM:PF04954"
FT                   /protein_id="ACY95988.1"
FT                   /translation="MSYRHFSAQVTRVTPLTPHMTRITLGGLEDFPGAGLDHRVKVFFP
FT                   LPGEDRPVYPTGDDWWERWQREPVRAVFRTYTIRRHRPELGEVDIDFVLHGDEGPGSRW
FT                   ASNARPGDHVGLWGPRAEYAPPPGTDWVLLAGDETALPAIGAILESLPRDATARVFVEV
FT                   ASPEERQHLDAPKGAEVRWVHRSDGESLLAAVREAGLPPGRPYAWVAAESSAVKQIRRH
FT                   LVDDRGIDREAIYFSGYWKRGAAQE"
FT   gene            complement(439568..440836)
FT                   /locus_tag="Tcur_0388"
FT   CDS_pept        complement(439568..440836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0388"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: secretory lipase; KEGG: reh:H16_A0876
FT                   secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95989"
FT                   /db_xref="GOA:D1A2G9"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G9"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ACY95989.1"
FT                   /translation="MRLARLLTCMLTGAAVAGTALVAPPAAAAAPSLCQSSDEDIYTAP
FT                   QTITGDPGDLLACRQTSLPLIPGVKMKAWKIKYVSTDVRGDKIAVSGFVAIPDKAWTRG
FT                   GSRPTVAFSPGTLGSGSQCALSKQMAGAQVDSYEAGNLRKFLEAGFAIAASDGVGYMNG
FT                   QVHTYTVGLNAGHAILDAVRAARQIPGGSLTADGKVGLAGYSEGGFNTLWAAQLASSYA
FT                   PELNVVGAAAGGVPGDLKLVAERLNGGPFAGFLADAVVGLSAAYPQMPFDELLNDRGRR
FT                   AVQEVKSNCLFGTLGAFAFRKLEDFTTDRLTLPRIYALAGPDGTTWGEIIDAQKLGVGI
FT                   GTPASGAPYKIGFPVLQYRGLLEEIIPHEAEDGTRRRYCQAGITTQWRLYVGEHLTTDW
FT                   LAAGDVTDWLGDRFAGKRATGNC"
FT   sig_peptide     complement(440750..440836)
FT                   /locus_tag="Tcur_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.608 at
FT                   residue 29"
FT   gene            complement(441351..441773)
FT                   /locus_tag="Tcur_0389"
FT   CDS_pept        complement(441351..441773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95990.1"
FT                   /translation="MTHATGPSGQPDDATIEAVGKLSEALETVERARGHLYSFHQLIGG
FT                   ADFAVEDAADLLARAGHRQLAEELRRQIMGRNVLPGRWTFQVVEEFDDTYYEPFRAFER
FT                   RVRDELTGGRRHLHEARMKEERRTHGLPGHEATPEG"
FT   gene            442177..443055
FT                   /locus_tag="Tcur_0390"
FT   CDS_pept        442177..443055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0390"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: atu:Atu2436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95991"
FT                   /db_xref="GOA:D1A2H1"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H1"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ACY95991.1"
FT                   /translation="MKRTLKRALSLLPAAALAASALVAASPAQAAANPYQRGPNPTEAS
FT                   ITAARGPFNTAEITVSRLSVSGFGGGKIYYPTTTSEGTFGAIAISPGFTAYWSSLEWLG
FT                   HRLASQGFVVIGIETNTTLDQPDQRGQQLLAALDYLTQRSAVRDRVDASRLAVAGHSMG
FT                   GGGSLEAAKARTSLKAAIPLAPWNLDKTWPEVRTPTLIIGGELDAVAPVATHSIPFYNS
FT                   LSNAPEKAYLELDNASHFFPNITNTQMAKYMIAWMKRFIDDDTRYTQFLCPPPSTGLLS
FT                   DFSDARFTCPM"
FT   sig_peptide     442177..442269
FT                   /locus_tag="Tcur_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 31"
FT   gene            443344..443808
FT                   /locus_tag="Tcur_0391"
FT   CDS_pept        443344..443808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0391"
FT                   /product="putative transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein; KEGG: sme:SM_b21641
FT                   putative regulator of phenylacetic acid degradation, ArsR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95992"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H2"
FT                   /inference="protein motif:PFAM:PF07848"
FT                   /protein_id="ACY95992.1"
FT                   /translation="MTSAPAGERQVGLPRPRCGAKPRHLLVTLLGDYWSGRPEHLPSAA
FT                   LVALLGEFGISPAAARAALHRAGRGVVGAAEALRARTELMYDRLHFPGLDPKPPEELLP
FT                   DDWPRRRAHEVFGELYDAFGPPAEIRVRQTVARSAPELAPLVRHHTHRDS"
FT   gene            complement(443954..444546)
FT                   /pseudo
FT                   /locus_tag="Tcur_0392"
FT   gene            444726..446651
FT                   /locus_tag="Tcur_0393"
FT   CDS_pept        444726..446651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0393"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="SMART: PBS lyase HEAT domain protein repeat-
FT                   containing protein; KEGG: afw:Anae109_2123 heat
FT                   repeat-containing PBS lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95993"
FT                   /db_xref="GOA:D1A2H3"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H3"
FT                   /inference="protein motif:SMART:SM00567"
FT                   /protein_id="ACY95993.1"
FT                   /translation="MNLDGIDWRRLKHAYGRATAIPRLLREAASDDAGQAGEAVERLES
FT                   VLWETEEAMVYSASPTVVPFLAELAAAPRTHHRPRLLRLMFDIADAVWELEEIAALGGD
FT                   SDLLNFPAQLEWARAARTAVQAQAPTLARLLEDGDPEVRAEAARILARFPGHGSDPLPA
FT                   LQDRAAREEDVGTAASMILSVGELARRRRQRPVAWLRERLRAARAREVRVAAGVALARC
FT                   GAGLDDAACEAIGAELRAERSALDDQPWTSSQGRAEFLLSALSDDADTHLAVAVQALRT
FT                   TDSAERLKALPLAGEVMLTWRAGPQTLLPSLVELCADPEASVRIAATRQIVQGGPRIAD
FT                   VADRLAELLDDPEAEVSGNAAWALSLVGDARAIPTVTAELAEPRLPIPIGRALEGLRGA
FT                   AQELIPHVAAYLRAPRQNPQLPGDTLIGVLIGLRSWGPRALPLLPELIGVLERGTAVPA
FT                   CAWTLGTLGSAAAAAVPHLRGLLEPDADPIARDAAAWALWQITGDAEEPLRVLGEGLKG
FT                   GLSDHAVELLCGLGDRAAPVVKLIRRHLKSSLYGTGAACALYRITGDAERTLPRLIEGV
FT                   EATPVGMLAVQCLGDIGPAAAPALAAIEEIATSPRVLATRIEKDLIATDLAYRDMAVAA
FT                   AERIRR"
FT   gene            446806..447039
FT                   /locus_tag="Tcur_0394"
FT   CDS_pept        446806..447039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95994"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95994.1"
FT                   /translation="MWRFLDRLREPLDRNRWRRLSHAYGSAADLPDRLRALASDDPQVA
FT                   EKALFDLNGALHRPSFTRRRGPGAPGRRRPVA"
FT   gene            complement(447075..447491)
FT                   /locus_tag="Tcur_0395"
FT   CDS_pept        complement(447075..447491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0395"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: dvm:DvMF_3179 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95995"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H5"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACY95995.1"
FT                   /translation="MDEITVLHQEGDEFAILVRDHVIRVDQPYRSGGRDAGPTPVELFV
FT                   ASLAACAAHYGRRYLARHGLRSEGLEVTADYTMSMARPARIPRVRLQVRCPTDLPATHL
FT                   EGLKRAMEGCTVHNTLHRPPAVRLEIEQPASKAA"
FT   gene            complement(447603..448946)
FT                   /locus_tag="Tcur_0396"
FT   CDS_pept        complement(447603..448946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0396"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: ank:AnaeK_3118
FT                   glutamate dehydrogenase (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95996"
FT                   /db_xref="GOA:D1A2H6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H6"
FT                   /inference="protein motif:PRIAM:1.4.1.4"
FT                   /protein_id="ACY95996.1"
FT                   /translation="MHERLEPIFEEVVRRNPGELEFHQAVREVFESVGPVIAKHPEFTE
FT                   AKIIERICEPERQIIFRVPWTDDKGEVHVNRGFRVEFNSALGPYKGGLRFHPSVNLGIV
FT                   KFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGRSDAEIMRFCQSFMTELYRYLGEHTDVP
FT                   AGDIGVGSREVGYLFGQYKRITNRYESGVLTGKPLLVGGAQVRPEATGYGLAFFVDEML
FT                   KARGASFDGRRVVVSGSGNVAIYAIEKVTQLGGVVVACSDSSGYVLDEKGIDLPLLKEI
FT                   KEVRRQRISEYAKARAGSGAVFVPGRSVWEVPCEVALPSATQNEITGADARTMVGNGCI
FT                   AVGEGANMPTMPEAIRIFREAGVAFGPGKAANAGGVATSALEMQQNASRDSWSFEYSEN
FT                   RLRQIMQDIHTRCLETADAYGMPGDYVAGANIDGFTRVAEAMLTLGLI"
FT   gene            449638..449868
FT                   /locus_tag="Tcur_0397"
FT   CDS_pept        449638..449868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95997"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95997.1"
FT                   /translation="MVKASYRAALVGTVAAGCLAFGAAAAHADFGTSAEFRDNAFNVKV
FT                   DRQRVPDRTTDGNPVTALLGGLLGGNLPVLN"
FT   sig_peptide     449638..449724
FT                   /locus_tag="Tcur_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.740 at
FT                   residue 29"
FT   gene            450432..451487
FT                   /locus_tag="Tcur_0398"
FT   CDS_pept        450432..451487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95998"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95998.1"
FT                   /translation="MGRHPIVVVDIKEFGRRPDGAQKQLRKRLYRVMWNALDAAGIVRE
FT                   DVHPPQDRGDGAFWILPTWVSPAELTGPLVRQLHRELQQDADSDPEGAMRVRVALHIGK
FT                   VSKDSNGWVGTDLNTACRLVDADELRRVLELGARPLMALILSRQWREEVRHRHIEGLDL
FT                   KSGWPVRIAVKEVADTAWIHLPGHEDLTVRLWRIQKRWEELLALEEQVRTRRDEIAERL
FT                   TSVPDMPDPPPELRRGRDLLPLWELVELDAEVFQQATERWWKRITKLGRRVEKMKAERD
FT                   ELRKTIEAFQARQNQSGLAEDLHLSAAYRRARDLLWHAPCDLPRAKAAVDDYIQEIWRK
FT                   LHHDLNAGGRA"
FT   gene            451484..453607
FT                   /locus_tag="Tcur_0399"
FT   CDS_pept        451484..453607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0399"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; Tetratricopeptide TPR_4; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: afw:Anae109_1549 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95999"
FT                   /db_xref="GOA:D1A2H9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95999.1"
FT                   /translation="MTACAQPGCSGYIDQGGFCNVCGCAPPGRPWWPVSDTLLGGTVVR
FT                   RSVLVGPGRAHIDEAAVLPTVSARDPLELTRPPRPSQESSSEPTLREDELVGDQYRITG
FT                   TLARGGLGWVYLAKDERVGDLVAVKGLIDPHTDRARELVDAERKALVELDHPNIVRIRN
FT                   FVRHPDPRSGELIDYIVMEYVVGQSLQEIEGEARRGGHPLGGPLRAEHVASYGLEILDA
FT                   LDYLHGRGLLYCDMKPANVIHSGDQIKLIDLGGVRRIEDRSSPVVGTPGFQVPIQEITE
FT                   QGLTVRSDLYALGKTLQALLDVAENGSAEETESLRQVIARAAHSDPEARFGSAAEMAEQ
FT                   LGGALREILSLYDGRERPEPSAFFATSPMPLDGGLGTAPPLRWWTAGPAPRLDELAKNT
FT                   PPSAPAIATGLPALRVDPADPAAGFLETVGADDLGMLLSKLAQFDRDSAAIELLSCRAR
FT                   LHLGDLQAAERHLAKAEELVEPGGRMAWTVPWHRGLLELARRDVAAAHACFTRVYAALP
FT                   GEGAPKLALALCAEHLGRLDQAERLYRAVWLPDRSQVGAAFGLARLRLAAGRRGAAVQI
FT                   LDEVPESSRHYDAARLAAIRVLLGHLPAPPDGKAPPTVDDFRKVLDRLPGLYLDDQSRD
FT                   RLVAAVREAALAHASELEGMDGGAVLGAQVTERGLRLLLERSLRTIARQARDRREHDAL
FT                   IDRANAIRPWTVD"
FT   gene            453629..455059
FT                   /locus_tag="Tcur_0400"
FT   CDS_pept        453629..455059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0400"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: scl:sce8131 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96000"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I0"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACY96000.1"
FT                   /translation="MEARNGFTVQVSHKPFLPVDDDEIQAVLTVTARGTAPPAGPPRHA
FT                   EVIVVDCSGSMGVPATKISAARRATVAALRDLPDGTLFAVVQGAERARMVYPAHKRLAE
FT                   ASPRTRAEAIAAVQHLDSSGGTAMHTWLARARRLLAGSTADIRHVILLTDGHNRAAQTA
FT                   LEEEVERCVGVFSCDPTGIGEDWEPRDLLMIARRLGGRARAHADGGAAELEADFTAVTR
FT                   AVMAKRVPAVRLVVRTLAHVEVGFLRQMFPTRVELTPERISPDGCTVEYNLGAWGEELR
FT                   EYLISLRFPKTGMPGRSAGIRQRLARVDLWAGRSAGESPDVSAPIAVEWTDDPRRSTVI
FT                   NPQVSHHVTQLELNALVEIGYAAYRDGDKGNAARYWARALKLAAEVGNAELRRRLQEAL
FT                   YFDGDVPRLRENVRLIDSKLLNVASNVFIPSSSAASTPGRPAPPPARRCPECGRPVAAD
FT                   ARRCTGCETRLDDDPESV"
FT   gene            455071..456228
FT                   /locus_tag="Tcur_0401"
FT   CDS_pept        455071..456228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96001"
FT                   /db_xref="GOA:D1A2I1"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96001.1"
FT                   /translation="MAQTTDAAAPASTAPPRRTPASATLRTLLVQRACLVIVTLVMLVT
FT                   SLVTLREMERGVAEMRTRTAPAALEIGEARRALAAADRAALAGFAEGESRLTGFRPGEE
FT                   YQYQLDIANQSLAQAAEDNSVGEEGGRILQMVEGLLVSYTGAIGRAGAHFQQGHTVLAA
FT                   SDLWNATRLMHSENGILAQLADLQAKEHARFRAEASAQWWTGWAALLWAGPLAVLLPLL
FT                   LASQVYLARRFRRVLNLPLVLATAIVVIGAPLVVVHAADSRSELAAARRSLVQITEAGD
FT                   AAVERAGTRGRHLMAGLLEDECPDGCGPTVDEFIERHRQSLPPERDQDSSDRSIADSRR
FT                   IDAAIAKAQLSTLTAPGVSAAALAVLALIVWGFHPRIGEYRFEAR"
FT   gene            456236..457579
FT                   /locus_tag="Tcur_0402"
FT   CDS_pept        456236..457579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0402"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_CH00696 alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96002"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACY96002.1"
FT                   /translation="MAHKAFPRSRRLLALLTALVTAVSAAGACSVAADRSVTVLGPWSG
FT                   EEGQAFREVLDRFTARTGITAAYQGTSAVNEVLRSKVREADPPDVAISWSPSELSRYVR
FT                   SGHLRPLTNVVDRRQQQAYRRHWLLPQGDDIYAIPIKANLKNLIWYRVDDLDRRPGTWA
FT                   ELMEVGERSRERAPWCLALNDSPAAGWPGTDWIENILLHQSPDHYRRWATGDLKWASPQ
FT                   VTRAWETWGQIVTGEGLVQGGVNRALLADFRDAGRSMFARPPGCMMVHAPSFAVDSFRE
FT                   GGDPGGRPLTPGRDFDFFPFPSFADSGAGSGDRPANVSADLAAMFRDTPEARRLMAFLA
FT                   SPEAQRIWPSRPHSSAFSLNTQVPETVYGRDEVRRRIARLLHASGDAMCFDASDAFPPT
FT                   MRSAFNQAVLEYVNDPRRLSKLLEELDRVRAAVDPQEWVVAACADDRN"
FT   sig_peptide     456236..456334
FT                   /locus_tag="Tcur_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.447 at
FT                   residue 33"
FT   gene            457689..458948
FT                   /locus_tag="Tcur_0403"
FT   CDS_pept        457689..458948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0403"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipinsynthase-like protein"
FT                   /note="KEGG: sat:SYN_00794
FT                   phosphatidylserine/phosphatidylglycerophosphate related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96003"
FT                   /db_xref="GOA:D1A2I3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I3"
FT                   /inference="protein motif:COG:COG1502"
FT                   /protein_id="ACY96003.1"
FT                   /translation="MVYGAERRLAVLLSAVIVLTAGIGYFGSGRANAKPKFTPRPGPVF
FT                   NNPGGTTAQQYAIMRQIERNIDASPRGSVIRIAIYSITLDRFAAKLIAAHRRGVHVKVL
FT                   MDEHAVNGLWKRLRSALGGTATTKSKGSFAALCPAGCMAPHYHRENPSSLHSKYYLFSG
FT                   GGKSKRTVTVSSANPTRRQAEAAWNNSYTVVGNPGLYNAYVKNFNDMVKASKGAHKKNY
FT                   YWTHGKNPKAYFWPKARSGSDTILNMLKLVSCSRRHPSRVRVAMFQWTDGRIALARRLA
FT                   RMADKGCQVTVLYTRSAISSSVRKTLADSKVTVRDSTYKTRADGYAKHYTHNKYVLIDG
FT                   RYNGVSNRKIVLTGSANFTINGLYHNDEANLRIISSSAYRAYLKNFQDQLAAVPAAAAR
FT                   ARAEGRLPEIPLHPDDLRDS"
FT   sig_peptide     457689..457790
FT                   /locus_tag="Tcur_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.969 at
FT                   residue 34"
FT   gene            459073..460215
FT                   /locus_tag="Tcur_0404"
FT   CDS_pept        459073..460215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0404"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   mlo:mll8328 metal-activated pyridoxal enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96004"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I4"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACY96004.1"
FT                   /translation="MTDRAGTETEGKATEGGLTGWEAACADRTRQTPFLALHGPRLLAN
FT                   VQDMAARVASRGGRSTPHLKSHKCLEVARAQRAAGATRATVATVAEAEVALAAGFESVL
FT                   VAYPPLPGEHTRALADLAGRCHVTVTCCRPEHIAALAATGAPFDVYWEVDSGTRRLGTP
FT                   PGPQTAQAVAAAPFDARVRLRGLMTFAGHAYGATGEAALAAVRDQQDRALEETRRALAE
FT                   RGLAAPVLSVGVTPLARLDTDLADEYRYGNYVFYDATQVALGGPDSSACSLAVISTVVD
FT                   VPAADRLVLDAGSKSLPAERMTELTLGFGLVAGRPGLVIEKLYEEHGLVRSAGPHGLKP
FT                   GDRVAVIPNHACTTVNLFSRYVVYDGESFTDTWPIRARRR"
FT   gene            complement(460221..461273)
FT                   /locus_tag="Tcur_0405"
FT   CDS_pept        complement(460221..461273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0405"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; KEGG: bam:Bamb_4089 oxidoreductase FAD/NAD(P)-
FT                   binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96005"
FT                   /db_xref="GOA:D1A2I5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I5"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACY96005.1"
FT                   /translation="MTTAEATEVRPVTLVTSDGERLEFGCAPGRSVLEAAAEAGAALPA
FT                   SCKQGTCGSCHASVAEGDYELGAHSPAALPPERRAAGEVLLCRTFPRGPLSVTLPYDGS
FT                   RILRGGIPRRQAVIVALETVACETVRLELRAEPTEDGGTDCQFDPGQFVELQVPGHDAK
FT                   RAYSLANTGNWEGRMEFYIRLRPGGLFSTYLRERARPGQTLTAFGPQGAFGLRETGLRP
FT                   RWFVAGGTGLAPLLSMVRHMAEWQEPQPARLLLGVNTEEEVFGTAELDAVAAELPGFSH
FT                   RVCVWRPGPSWQGPVGTPADLLAADLAEAPAAPDIYVCGPPPMVDAVVQVAARAGVPAE
FT                   HVFYERFLPT"
FT   gene            complement(461270..462934)
FT                   /locus_tag="Tcur_0406"
FT   CDS_pept        complement(461270..462934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0406"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: bvi:Bcep1808_5223 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96006"
FT                   /db_xref="GOA:D1A2I6"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I6"
FT                   /inference="protein motif:TFAM:TIGR01703"
FT                   /protein_id="ACY96006.1"
FT                   /translation="MFCYQCEQTDRSGAVVGCAGPLGNCGKDEVTADLQDLLIHAVKGI
FT                   AQYAVQARALGAADDEAAEFILYAVFTTLTNVNFNPTRFNALLKEAADVRDRVKARYEE
FT                   AARARGLQPVTPAGPAAWQPASDMDGLLKQASGVGVRAGIDTAGPDVVGLRSLHLYVLK
FT                   GICAYAHHAAALGHRSAEVFSGVEEALAYLAGEPTDVAELLERALDLGRLNHKVIELLD
FT                   AANTGTYGAQQPTAVRVTPVVGKAILVSGHDLRDLAALLEQTEGTGINVYTHGEMLPAH
FT                   AYPRLKAHGHLVGNFGGAWQDQQQDFAAFPGPILMTSNCIIEPHVSYRRRIFTAGPVGW
FT                   PGVRHIADRNFAPLIQAAKALPGFPEDGPEQFITVGFGRDAVLSVADKVVEAVKQGAIR
FT                   HFFLIGGCDGPTPGHDYYTELALSAPPDTVILTLGCAKYRFNKHDFGEVAGIPRLLDVG
FT                   QCNDSYSAIKIALALADAFECDVNELPLTLALSWMEQKAAAVLMTLLALGVRNIHLGPT
FT                   LPGYLTPGLIETFVKRFGLRTTGRAEDDLAAALGRAS"
FT   gene            complement(463011..463742)
FT                   /locus_tag="Tcur_0407"
FT   CDS_pept        complement(463011..463742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0407"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; regulatory protein Crp; KEGG:
FT                   eba:ebA5141 transcriptional regulator Dnr/Nnr type"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96007"
FT                   /db_xref="GOA:D1A2I7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I7"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACY96007.1"
FT                   /translation="MTDPPLTELLPRLPLFSGLTRQQLEIIRAGSFPVSLERGEILFHQ
FT                   GDPVRGFYYVLRGQMQLTVSAADGTQKVVELVTSGESFGEAVVFAGQRYPVTAGALVAT
FT                   RLLGISSGAVLDLLDRDPSFARRMLANMAVRLRRLIRDVEAYSLQSGIQRVIGFLLHEA
FT                   RGESGPAHECTVTLPTRKHVLASRLNIAPETLSRILRDLSAAGLISVQGRRITLHDVPA
FT                   LEARLEMTVTSATVHPLDAAS"
FT   gene            463849..464220
FT                   /locus_tag="Tcur_0408"
FT   CDS_pept        463849..464220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0408"
FT                   /product="protein of unknown function DUF1622"
FT                   /note="PFAM: protein of unknown function DUF1622; KEGG:
FT                   bja:bll4818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96008"
FT                   /db_xref="GOA:D1A2I8"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I8"
FT                   /inference="protein motif:PFAM:PF07784"
FT                   /protein_id="ACY96008.1"
FT                   /translation="MELESAIETTGKAIDAAGVAVIVVGAVAATGVFTHRLLRGRDGLP
FT                   AAYRLYRQSLGRAILLGLEFLVAADIIRTVAVSPTFTSVGILAAIVGVRTFLSFSLQVE
FT                   LEGRWPWQRRGLTGDERGT"
FT   gene            464323..465009
FT                   /locus_tag="Tcur_0409"
FT   CDS_pept        464323..465009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0409"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: cvi:CV_0459
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96009"
FT                   /db_xref="GOA:D1A2I9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I9"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACY96009.1"
FT                   /translation="MGGEADISVPARLIAEPARARMLTGLIGGLSLPAGELARLAGVSA
FT                   STASEPLKALVAGGFVTVHRSGRHRYYTLANADIAHALEALQAIAPSRPVNSLRAHRAS
FT                   ADLRAGRRCYDHMAGDLGLRVTGLLVHTGVLEPLRPGATAALHLDAAHPIITRFALRDI
FT                   GGSPRRPLARGCLDWTARKPHVAGRLGAHLLTLFRERQWVTARLGSRALRLTEAGEDAL
FT                   TSLETG"
FT   gene            complement(465188..465964)
FT                   /locus_tag="Tcur_0410"
FT   CDS_pept        complement(465188..465964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c3387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96010"
FT                   /db_xref="GOA:D1A2J0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J0"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c3387"
FT                   /protein_id="ACY96010.1"
FT                   /translation="MGTRFGELHRAGDPLVLPNAWDVASAVALAAAGFAAVGTTSLGVA
FT                   ARYGMADASRAIAEPVRRLAHRLRRLPCPVSVDIADGFADEPEAVAEYAASLGVDGVNI
FT                   EDSTAGRLVPVEVHAAKIAAVKERCPGLFVNARVDTFWVGQDATVTATIDRAVRYVEAG
FT                   ADGVFVPGRLDGAQIRQITSAVPVPVNVLASSDFSVAELARLGVRRVSCGSLLYRAALD
FT                   RAVEVAVGLRDGSPAPPATSYGDVQELATRYRPVCG"
FT   gene            complement(466219..468042)
FT                   /locus_tag="Tcur_0411"
FT   CDS_pept        complement(466219..468042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96011"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96011.1"
FT                   /translation="MNSSSSRRKKESPIRFSFLDGEEESRWGADPVLAAGAGEAAFRRW
FT                   VQATCAADPSSVLVAVRPDRPAPGWAKVMFLEADPAHEKFLDAAYRSTLQPRHNGPVGT
FT                   EDLGGPPWTPPAEDDQAPAAPPGTSGGTDAPDLREPAPPVRAAVPQPAATGWYKIERPG
FT                   PLPEEAMFSGLLGRVVGEVHPYTEGDPVGVLATLLSALSAAVGHRPHIRLGSARHPLLV
FT                   WTMLIGRTALGRKGTATNAAMEIFQRVSADFTERHLLYGSPSSGAGLVGKLEAMAREAG
FT                   WYDEDGALHDAEPELRPGFPALMIEEEWAKVMRRSRIDDALGQNLRTAWQGNTLSVIVK
FT                   RKSDCATVKDAHLAIVGHITPDEFRANLSTADVAGGTFNRFLPVFVQRCQSLPLAEEMP
FT                   EALADRLAGELREAIARGRRLGLIRFDEAARDYWRDQLYDRLTALSTGSELIEAFAGRA
FT                   LPYAKRIAALYAVAAHQEMISLEHLQSAEAFITYVIASVEYIMATAAPPPSARARPGAA
FT                   KPHITRKVIEALLAAHPAPLSRSDLLAKVKNIGSTADLENSLASLGEDLQTSTARGGGR
FT                   PMRLYRLTEAAADRLGRRGGLTGAGDGGGRS"
FT   gene            complement(468047..470500)
FT                   /locus_tag="Tcur_0412"
FT   CDS_pept        complement(468047..470500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_2616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96012"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J2"
FT                   /inference="similar to AA sequence:KEGG:Veis_2616"
FT                   /protein_id="ACY96012.1"
FT                   /translation="MSEPTWALTVPQPAAWAISEGYQDVYNRMTDTAYRGWIAICAGSG
FT                   FDQTILYETARLTGWRTEQITAACTERQMVVAVARLVEVCKGGPCECGPWANKRFFHWR
FT                   LADAAPLPEPLPAPRNFGFWQMSDELAEQVARQWRQIHRPAPEPEPAPPQAKTALALRD
FT                   ELLPLPGADQGYRHVLLLGTTGAGKTTVVRQLLGTDPRSERFPSTSTAKTTVADTELIL
FT                   TEQGPFRAAVTFAERKEIADHLRDNVWEAARAVFEGRPQEVVYTRLLDHVSQRYRFSYL
FT                   LGRPPSAQPDDDELDDLDDYDDDLDEDTAEEAGAPQGVSDPATAAMLHGAVEALQHVVN
FT                   TQVGKLQTEITADEERSVEEVLEDELENRIRRSPVCARIVEAMLDAIEERFESLTPGEL
FT                   HRDADGWPVSWSWDCPDRAEFIGVVNRFSSNRHEDFGSLLTPLVNGIRVAGPFRPLWAE
FT                   THPRLVLIDGEGMGHVHDSASEVSTRLRKRLDEVDAIVLVDNAQQPMQAAPVSVMRTAA
FT                   ATGNADKLHFLFTHFDLVKGDNLRTVSERRRHVLDSAENVLNAVREDLGAAERVLRRRL
FT                   DESCHFVGGIHKRLDPRRIDPAKHKAATRTIREFNALVEALTADAAEVEVGPSRPVYKR
FT                   EEVTRAVSEAARSFHRLWNGLLGLSFEPDIPKKHWATIKALTRRLSEGHEDEYRDLRPA
FT                   ASLRHHLEKEIYRTLQRPVRWTGSEPDAEERQAIIDSISNAVTRRLIGLADLLITQEPR
FT                   ADWLRAYEEHGKGSTYRRAQILAEDIYARAVPRPDQHAAYDNPFVHEVHAAFTEAAAEL
FT                   DFLLD"
FT   gene            complement(471149..472207)
FT                   /locus_tag="Tcur_0413"
FT   CDS_pept        complement(471149..472207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0413"
FT                   /product="AIR synthase related protein"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: dal:Dalk_0686
FT                   thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96013"
FT                   /db_xref="GOA:D1A2J3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J3"
FT                   /inference="protein motif:PFAM:PF00586"
FT                   /protein_id="ACY96013.1"
FT                   /translation="MVWRARCVGRLATIIGPMFSGQTGWSHRLTGGETIRLLAGADAQD
FT                   DCAVFRLDGVQELVVGSDYVRGPKFGLYELGYLDDYDIGYYLAMANFSDIAAMGAQPIA
FT                   LLSVVRYPKTMPDERFAQVLQGINDACARVGAPNVGGDIGTAERLILSASAVGVVEAGR
FT                   SLLRGGARPGDRLCITGPTGVAAAAQKYFGKLDVADTRLSPQAEELLLNAWKRPQALVP
FT                   EGRSLSTSGLVTSCQDSSDGLKAGIESIAARSGVGFTVEEDALPVVGAVEEVAKLSDTE
FT                   LTPLLLGDSVDFQLIFTVPEEHVEELQEIFAAHGHSAFHDIGFATEEPDLLLRGSDGIT
FT                   RRLPGNPWRHAT"
FT   gene            complement(472212..472718)
FT                   /pseudo
FT                   /locus_tag="Tcur_0414"
FT   gene            473016..473732
FT                   /pseudo
FT                   /locus_tag="Tcur_0415"
FT   gene            473779..475389
FT                   /locus_tag="Tcur_0416"
FT   CDS_pept        473779..475389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_3678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96014"
FT                   /db_xref="GOA:D1A2J4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J4"
FT                   /inference="similar to AA sequence:KEGG:BURPS1106A_3678"
FT                   /protein_id="ACY96014.1"
FT                   /translation="MEFPEVMRRGGFDAVVGNPPFIGGQRLTGTLGTDMREYLVQHVGG
FT                   GQRGSADLCAYFYLRDLAVTNGGRVGIIATNTISQGDTREVGLAQALNRGWQIYRAEKS
FT                   RPWEGTASLEVSLIWSCRSGDHERFVLDDREVPGITSTLDSQSRIAGDPHRLAANADKS
FT                   FIGSYVLGMGFVLTPEQAHKLIEKDPRNRDVLFPYLNGDDLNSHWDLSASRWVINFHDW
FT                   DEDKARTYPDCYEIVEQKVKPFRAQNNRKVYREYWWQYAEKRPALHRAIRNLQRVLVFA
FT                   RVSKIGLPQFVATGQVMSEQLVVIATDALEDLALLSSDIHYFWWTVKGNSTLETRLRYT
FT                   PSDGFETFPRCLLTDRVRSAGEALHAVRREVMELRKWGLTQLYNCIYDPSVAGEEISSL
FT                   RDIHVEINEAVCEAYALQEEQDPGIRKFEARVASKPLPAWRDIELRHGFYETQQGIRFA
FT                   ISPQARDDVLDKLLALNHYRYQQEVSQGLHSGKGGRKGAKAAERQPKETEVGPGRGTDA
FT                   VDSADGALDGLFAPPGALF"
FT   gene            complement(475638..475829)
FT                   /locus_tag="Tcur_0417"
FT   CDS_pept        complement(475638..475829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0417"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96015"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J5"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY96015.1"
FT                   /translation="MTTKYGHWRKSRHSDPNGDCVEVAKAADGTVGIRDSKANTPDAII
FT                   ELTHSEWAHLLTRLRNMR"
FT   gene            complement(475826..476707)
FT                   /locus_tag="Tcur_0418"
FT   CDS_pept        complement(475826..476707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0418"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: gur:Gura_0878 cupin
FT                   2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96016"
FT                   /db_xref="GOA:D1A2J6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY96016.1"
FT                   /translation="MTSPYVRRLRLAAELRKLREERDLTTDELAKLVFQSRPKISKLEN
FT                   AQIRPDVGEILNILEALEVTGAKYRRLLRLARDASRKGWWDRYGNAMGDRQRLYADLES
FT                   GAKTIRSYNQTGIPAVLQTPELISTLIEIDQALGPITYRPHRLAEARTRRQQHLLSPDG
FT                   PTYDAVLDECTIYRLGVPRSVMSKQLFHMIKVVLAEPRITLRVLRYNTHIPGALMPKSS
FT                   FSLYTFPEKVDPTIAVVDTVTTDLVITERRGVARYTAHYDLLRKAALSPEESLAFLSQV
FT                   AEELDDGTGPSA"
FT   gene            477367..479589
FT                   /locus_tag="Tcur_0419"
FT   CDS_pept        477367..479589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0419"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; conserved hypothetical protein;
FT                   WD-40 repeat protein; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; WD-40 repeat protein;
FT                   KEGG: afw:Anae109_3558 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96017"
FT                   /db_xref="GOA:D1A2J7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY96017.1"
FT                   /translation="MEPGLEIAGRYRLERSLGRGGFGEVWAAADMLRDRQVAIKFLYPQ
FT                   ISATNPVAVAKFRQEAKIAARLDHPGITRVDDFGLHEGQWFLVMEFLHGRTLAAELADH
FT                   PQGLPVPRVVALGEQLADALVAAHEMGVVHRDLKPVNLMVIDGDRLKVCDFGIARMADA
FT                   SVAVTFTGQVGTPLYMAPEQWLGEPTDHRTDLYAMGGILFHLLTGHPPFTADGARELMG
FT                   RHLNADPPRARTERPEIPVALDALIVELLAKDPRQRPARTADVRDRLRDIQQSRTSPPP
FT                   ASESTSAAPDDATRRLSPPPEPQSTSPAGSAAPGPTRPSVPESRSPAFDGAARPPSPPP
FT                   APGVRDTNGTRRPGGPRRVARRALLGGAVLSLAAAAAVPLSRLTARTGSDGRAGGTGSA
FT                   GTDDGDSPLRFTLKGHEKWVESVAFSPDGATLATASWDGTARLWNAKNGKPVATLEGHR
FT                   GEVISVAFSPDGATLATGSGDGTARLWNAKNGELIITLKGHQKAIGSVVFSPDGATLAT
FT                   ASWDNTVRLWNARSSELITALKGHKEVVQSVAFSPDGALLATASSDDTARLWRVRSGEL
FT                   ITALKGHRSTVASVVFSPDGATLATASRDGTARLWRAKDGELITVLKGHQDQVTSVAFS
FT                   PDGAALATAGWDGTARLWRVKDGEFIAILANHPEVWSVAFSPDGALLATANNKGIARLW
FT                   NARNGELITTLEGHHGGIGSVAFSPDGALLATASRDGTAKLWRVGD"
FT   gene            complement(479907..480350)
FT                   /locus_tag="Tcur_0420"
FT   CDS_pept        complement(479907..480350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96018"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96018.1"
FT                   /translation="MRRAGGGAVVLTCGVVNYKLNHSRYIGSRRVRLSANEKKLIARAA
FT                   KRSKAKRKSGKGKALSLEEKAAQQSRFFKDAQRIAAQVAEARAGGDADRVLELYGQAKG
FT                   KLFLAFGKKVAQGMQMYAVLEGHRAWAWERKEEIRLREEAGRR"
FT   gene            480516..481292
FT                   /locus_tag="Tcur_0421"
FT   CDS_pept        480516..481292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical LOC485002"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96019"
FT                   /db_xref="GOA:D1A2J9"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96019.1"
FT                   /translation="MGDGRDALERGRRHGMRHRRHLGLLLQVLLVVVAGLLGIVTDYAT
FT                   GAEETPFHLDPLKKAAAPGIVVLIVGHVIAYGWRPRPAGERCLFGTSSTGRRSGALRSA
FT                   ARRRCRPPIRPSRGPRTPRSGPSTPADRPRRPRRPPARPSATPDPACSALPYPSSSLSV
FT                   HPIALKAPKYPSPMRLFRRTASPGQDGMSQSGRRHDLRRRGTGHPRDSRPQYPRPCGEE
FT                   SSVQNPAHNRRSRCGSGPAVREDRSGIRSYRDGTPA"
FT   gene            481392..481610
FT                   /locus_tag="Tcur_0422"
FT   CDS_pept        481392..481610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96020"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96020.1"
FT                   /translation="MRLRFLGTDSNEGTCPAMYVTDAGTYGVQGKLVTDPQALGDAVNL
FT                   ADDEAIVEIEPSLVRHLIAHYQEHHGG"
FT   gene            481615..482160
FT                   /locus_tag="Tcur_0423"
FT   CDS_pept        481615..482160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96021"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96021.1"
FT                   /translation="MAHLLSGGELDGLFDAFERSAFRLETRDRYNVPSERESLRRFLAG
FT                   DPDEDYARGRPWYDRTRRAAAEGRPFTRVRVVTVPLGDYSRYALWCARDNIRAGEDIRY
FT                   LERSQAARLGLPVEPPHDAWLLDDATVVILHFDADDAFAGAEVTDDPATVARHRAWRQV
FT                   AWEHALTREAFLRSLGGA"
FT   gene            482165..483013
FT                   /locus_tag="Tcur_0424"
FT   CDS_pept        482165..483013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0424"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: ppd:Ppro_1907 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96022"
FT                   /db_xref="GOA:D1A2K2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY96022.1"
FT                   /translation="MSTPSQQAREALGLRLRELRKDGGLTQRRLAELAGWVESKVSKIE
FT                   HGRQTPSEDDIRLWCRLVGAEAHIADLIATVRNIDSQYLEWRRTWRAGGRRRQQAIAAQ
FT                   EEQTSRFRIYEPLLIPGLLQTPEYARTRFAENIAFHRTPNDLDAAVEARMRRQEILRRG
FT                   DRDRRFHILIGEAALTLGVADDDVLLGQLDRLLTLAIMPRLLLGVIPARTRHRRAPHHG
FT                   FWIFDDRLVLVETVAAELTITQPREIAVYAKEFEWLAASAVYGAGARELISRAIRAIRE
FT                   N"
FT   gene            483148..483351
FT                   /locus_tag="Tcur_0425"
FT   CDS_pept        483148..483351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96023"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96023.1"
FT                   /translation="MSQQFQFQTSRACSEGCGGCCVEVATNLAATSGLVALRDSKTGIV
FT                   NTFTAAEWRDFIAGAKAGQFDI"
FT   gene            483419..483919
FT                   /locus_tag="Tcur_0426"
FT   CDS_pept        483419..483919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96024"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96024.1"
FT                   /translation="MDIPVFDYDAYWRDGDGVRDSTAWRDQGLHWHGYLWRGGAADYGD
FT                   EPARRDLGTELPPKLLADWLRKPARTVRTTATTPEEMAEWLRNEWRKARGQLGPDATAI
FT                   DETSRFGRALHDLRRGQPVCWGGWLGPSTFWHVAAIPTAAACHEATTAPDTAGRPWRPR
FT                   PAP"
FT   gene            complement(484239..485069)
FT                   /locus_tag="Tcur_0427"
FT   CDS_pept        complement(484239..485069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96025"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96025.1"
FT                   /translation="MAVPFLPLPQKLTPQAAADYLEGCVPPHRLPTWEPILAHLRAASP
FT                   ARPESGRPLAEVVATPLGLWLLRTVYIERNSDPAPLLHRERFPTPGALRDHLFDRLIDA
FT                   LIDARPPLDGPEKNADRFRPRRHRDPRQVRAWLGYLARLLSDQDTRDLAWWRLPTAVPA
FT                   PASLFKYVTGFMGGLAAGLVGGLASGLTFGGHRAWSMYLVASWWWTWKNLLPRRLMPFL
FT                   DDCHRLGLLRAIGPIYQFRHAEFQDYLAADHRRAHGTTGGSRAGEETASENAGR"
FT   gene            485435..486688
FT                   /locus_tag="Tcur_0428"
FT   CDS_pept        485435..486688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1511 putative
FT                   esterase/lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96026"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96026.1"
FT                   /translation="MSRISGRLRLFGALAAGVLAMGVAGAVTTPASAATAVFREDFSNG
FT                   LGSFTSSGSVTTGSYGARLSGSLLSDPSITSTTISLSGYSGVTVSYTRSTSGLDLGESF
FT                   TAAYSVDGGSFVTLESARQAGGPVSFRLPSSVDGRSVRLRFSLDANSPLESLTVDDVLV
FT                   TADGGGSDPGPGPGGPLPPVSDVTKPGPYAVAIDRSAGPRRNGWLVYPMNAGQYGVDHP
FT                   IFVWGPGAGSTPADYEDMLRQWASHGFVVYSEVSSSDGTYMVNALNWLQAQNSNPASPL
FT                   HQNLDLSEVAFGGHSRGSLGTFDVADEPRLSTTIHVAGGSFDGNGPNKLRKPTLYIGGD
FT                   SDFATSNMERDYRNTRVPVWFNILNNTDHIYATRNGQHIITAWLRWHLGDEEFRRTSDF
FT                   LSPTCTFCSLGRVQYKNW"
FT   sig_peptide     485435..485536
FT                   /locus_tag="Tcur_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 34"
FT   gene            486773..487363
FT                   /locus_tag="Tcur_0429"
FT   CDS_pept        486773..487363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0429"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96027"
FT                   /db_xref="GOA:D1A2K7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96027.1"
FT                   /translation="MNVRKWECTNSPVRPLISAAWPPFGVTACEHEATEHNDAHPRPDT
FT                   DRPREVHMLTMIPRTCTAAPLYWRRTFPGEAAQARAARRFVACLLDGLPCLDEVVLTVD
FT                   ELVANALRHTKSGQAGGSFTVEVLAGPDGVAVAVADQGGPTEPAARDAADTDENGRGLR
FT                   TVSLTATSWGWHGNDSGRTVTAVFTAGAKERAQ"
FT   gene            487360..487953
FT                   /locus_tag="Tcur_0430"
FT   CDS_pept        487360..487953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96028"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96028.1"
FT                   /translation="MNHTHGDLHEWVRRRVHAAVTDALRADGEAIAALPGLDRLDAHTR
FT                   DFVRNARRLVLACATGLTAVLEAHRPVTTSTGRRFCRGCGVDHCPTLRRVAELLSVHAV
FT                   RPAAIDRAEAWRRADAYLRRVHRPSPLGVQEFEHGFVAWPVTASGEPDFLLVIDRHTGR
FT                   LSCWPSLPLQTLIRRYRAHLAARVVPSPGTGTDA"
FT   gene            488248..488607
FT                   /locus_tag="Tcur_0431"
FT   CDS_pept        488248..488607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_2447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96029"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96029.1"
FT                   /translation="MTVENPDVVDGVSLSADESVCILRMIEDRPFSGSPEQNQQLVEKI
FT                   NTYLAFLQTGQLVEQFPQMAGKRMEVRLVCGEDPQGPPLLEILQAATALFAKHGADFVV
FT                   EVIPWEMVLGGRPRP"
FT   gene            complement(488906..489970)
FT                   /locus_tag="Tcur_0432"
FT   CDS_pept        complement(488906..489970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB4263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96030"
FT                   /db_xref="GOA:D1A2L0"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96030.1"
FT                   /translation="MDLGALAATVVAMLSSGAYLLGVALFKVAANRMEPLHGSHPFKLA
FT                   RQMLITPIWYAGGFLAAAGLALQWIAMSSLSLPAAQPAFVSGLVPLLLFATVLLGERLT
FT                   PREWGCVALAALATLLVALSSTGFGSAGQPPSPWVVVALTLPALSLPVAMFNFGELSPI
FT                   GVHARRPTGVAYGLSIGILIGTAELALAGIALFHDAGTPIMATPYPYLLVLAGALGIAQ
FT                   LQISLQRCRLAMIGVIATVTAKTYLLTVSLILYGYGWPGCRSVLLLVTGLALSAAALAA
FT                   IPPYHDPPRPKQEPPPPPTNGPVQREPRRIVPKYSLARQASAPSAGSSHIGYEKFAFTP
FT                   RSPKPDGENVRSRN"
FT   sig_peptide     complement(489914..489970)
FT                   /locus_tag="Tcur_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.320 at
FT                   residue 19"
FT   gene            490576..490761
FT                   /locus_tag="Tcur_0433"
FT   CDS_pept        490576..490761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96031"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96031.1"
FT                   /translation="MLHEPFVPRPWGEPSSETAGPSLARILLPLSDQDLATGARILNGA
FT                   DPGPPEPPARRAEHRP"
FT   gene            490758..491621
FT                   /locus_tag="Tcur_0434"
FT   CDS_pept        490758..491621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96032"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L2"
FT                   /inference="protein motif:COG:COG3662"
FT                   /protein_id="ACY96032.1"
FT                   /translation="MTAPEEPVPPAPLGPGSFLWDYSGLRLAAITDISAFVLQAMHPAI
FT                   GAAAERLTDLDTRRLSRAVHDFVSIRPWVYGEQGTRHLLPAGPLAWAHLATFYVTVTAA
FT                   RYFSAEPMTLDREQRIFEEFLLLGRLRGVPARMLPSTMADYWAYFEDMLTHTLVPHPVA
FT                   HRVLDRLGGFSSTVPVTLRPLLVPFGLRGGWFTHLVTVGTLPQAARTKLGLTWTADDEH
FT                   RLRAVGTLFTRVLPHLPERLRYAPSAYQARRTSRMQRSPRGPRHLRLTDTCPVVAGCRG
FT                   VRRAVR"
FT   gene            complement(491790..491984)
FT                   /locus_tag="Tcur_0435"
FT   CDS_pept        complement(491790..491984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96033"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96033.1"
FT                   /translation="MLPPAAREKLGISWSDTDERRLRLLGRGQSALPERLRYMPIAYRA
FT                   RVAARAAQRLEKALAERPM"
FT   gene            491983..492675
FT                   /locus_tag="Tcur_0436"
FT   CDS_pept        491983..492675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0436"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dal:Dalk_1538
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96034"
FT                   /db_xref="GOA:D1A2L4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96034.1"
FT                   /translation="MPMIRKNRVRDVTCAPLPRGLSGGRRARRRAALLEAGLELFGTRG
FT                   CAGTTVRGVCTLAVLNDRYFYENFPDLDALLVAVFDEVARRGEEAILAAVRSAPRDLPL
FT                   RVRAVANAGPGFLIADPRHARLLTHEIQVEPALRGRRNALIRRLAGIFTAQAHELAEDM
FT                   PLSDTDVEMTVLTLVGGAMELVSTWLRGELAVDREHLIDFLVALIVTSDGLPASPARKS
FT                   QAVRRAPA"
FT   gene            complement(492693..494933)
FT                   /locus_tag="Tcur_0437"
FT   CDS_pept        complement(492693..494933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0437"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   acp:A2cp1_2390 transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96035"
FT                   /db_xref="GOA:D1A2L5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L5"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACY96035.1"
FT                   /translation="MTTIDSPSRPVRRPLLGRPEDPRWAGPGLLVLLAATAVLYLWGLG
FT                   ASGWANAYYSAAAQAGSVSWKAFFFGASDAAGAITVDKTPGALWPMALSARVFGVNSWS
FT                   ILVPQALMGVAAVGVLHAAVRRSLAAEAGPQVAAACGLLAGLVPATTPVAALMFRFNNP
FT                   DALLVLLLTLGAYAMVRSLEPGGLRWLLVAGGCVGLGFLAKMLQAFLVVPAFALVYLVA
FT                   APATVRRRIGHLLAAGAVMAVAAGWWVAIVTLIPADSRPYIGGSQHNSVLELTLGYNGL
FT                   GRLNGDEVGGLGNTDQDAGWGRMFGPVIGGQVSWLLPAALILPAAGLWATRRRARTDAV
FT                   RAALLLWGGWLAVHVLVFSHMRGIFHEYYTVALAPAIGALVGLGTGVLWRRPAGTAVLA
FT                   GTVAVTALWSYALLERTPDFVPWLRWAIVAAGVAAVALMAPGRSAPRLLGGGAALAVLA
FT                   SLAGPAAYAVETASTPHQGAIPIAGPQVSRGPGFPGDRFRRPPSLPDGIRPPQARRPAP
FT                   NSAPGGFGPGNGSSSSGSAGRTGGSGPDAGLGGPGSSSRSDRSGSDNDSGNSGSDGRSD
FT                   GLSPGDGSGGWPGGFGPGGGFGWFGPGRRPGGFGPRFGGFGPGGGMGGAGGLLNASTPS
FT                   AELTALLKADASAYTWVAAAVGSNRAAGYQLATGKPVMAVGGFNGTDPAPTLEQFQRYV
FT                   REKKIHYFIGGGMPGRAGSGSDAAQRIAEWVQENFTAQVIDGVTLYDLTAAR"
FT   gene            complement(494970..496937)
FT                   /locus_tag="Tcur_0438"
FT   CDS_pept        complement(494970..496937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0438"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   cti:RALTA_A1339 putative glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96036"
FT                   /db_xref="GOA:D1A2L6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L6"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACY96036.1"
FT                   /translation="MSAATIPAQAAGAARRLLWGGPEDPRWVRPALYGVLVLSLALHVW
FT                   KLPDNGYANEYYAAAVQAGTQDWKAFFFGSLDAGSFITVDKPPMALWLMALSGRVLGFG
FT                   TWSMLLPQALAGTAAVGVVHATARRAFGPVAGLLSALVLALTPITVAINRDNNPDTLLV
FT                   LWMVLAGWATLRAVQARSGRAGLGWLSAAAFFVGCGFNTKMLQAWVVVPALALVYLVAA
FT                   RPSWPRRVAHLLAAGAVLVASSLWWVLLVDAIPEDRRPYIGGSTDNTAWDLVIGYNGLG
FT                   RIFGGDGPGGFGRGGGANFGGEPGGGRMFNDILGGQISWLLPPAGLLLAAALVWLWRRP
FT                   RTDVRRAGVLLFGGWAAVHFVVFSYSAGGFHPYYTTAMAPGIAGLVGGGVVLMAEAQRR
FT                   SAAWAWVLPAGVAVTGAWSFQLLERTPQWLPWLRWAVAAATVAAVAALVALRRGTRGAA
FT                   VVATAAGLVAGLAGPAAYAVDAAGSPVNGTNPLAGPATGFGGMGRGPGGPPPSVPRGGR
FT                   GPGGGMFGGQPPGGGFGGRMFGGPGGGRVSDAMAAYLVQNRGKATWLVAVGSAQQASSL
FT                   MLRTGAPVIAMGGFTGSDPAMTVAKLQRYVKEGRLRFILLGGRGGGAEVAEWVRQHATP
FT                   VDAGEYGDPFGGSGQLYRLA"
FT   gene            complement(496934..498211)
FT                   /locus_tag="Tcur_0439"
FT   CDS_pept        complement(496934..498211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0439"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; glycosyl transferase
FT                   family 2; KEGG: ppd:Ppro_2693 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96037"
FT                   /db_xref="GOA:D1A2L7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L7"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACY96037.1"
FT                   /translation="MSQATTRMPPSPAGHAGCRFLVEVVIPVHNEEHVLAASVRRLHGY
FT                   LTATFPYRFRITIADNASTDRTWRVARALCAELPHVTAVRLDRKGRGRALRHVWSRSDA
FT                   DVVAYMDVDLSTDLDAFLPLVAPLISGHSDLAIGSRLTRGAAVARGVKREVISRCYNLL
FT                   LRTALAARFSDAQCGFKAVRTEIAWALLPEVEDEAWFFDTELLLLAERNGLRIHEVPVD
FT                   WVDDPDSRVEVWRTALDDLRGMARVARRMLTGGFAAPVPGRARSGPPPGMARQLPRFAL
FT                   VGGVSTVVQLVLFLLLRTVMGPLAANAVSLVVATVGNTAANRRFTFGVRGRQGMARHHL
FT                   EGFAVFLLGLGLSSGGLALVHALVPDASRALEAAALIAANSTATVLRFVAMRAWVFHPR
FT                   RLRGPARSGTSTPVDAASIDAQEQTP"
FT   gene            complement(498334..499566)
FT                   /locus_tag="Tcur_0440"
FT   CDS_pept        complement(498334..499566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0440"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bur:Bcep18194_C7291 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96038"
FT                   /db_xref="GOA:D1A2L8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L8"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACY96038.1"
FT                   /translation="MADSPLAGRVVIDLTSALAGPYATLLLAGLGARVIKVENPLNGGD
FT                   QARGNAPYLSEDGLTLTRRSPRDMSVSMLVRGRGKQSVTLNLKHPRGREVFGDLVRRAD
FT                   VVVENFSAGVADRLGIGYDFAARLNPKIVYTSISGFGAQGGPGSGKAMDTIVQALSGLM
FT                   ATSGDPGGPPVRSGLPLADLTAPLFAVVGTLAALMQAERTGRGQHVDVSMLGALTSLVA
FT                   CEPFDALEAVGLPARTGPVMPRLAPFGIFPAADGWFAVCAPTDGFAHGLLKAMGREDLI
FT                   EEFRTRDRRVERADRLHELVAEWSSARPLREILDLLTEHGVPAAPVRDPATAVRDPLVL
FT                   EREEVVPLSHPRYEHAGELYGTGVPIRFSAARARLETPAPDLGEHNAEVYGGLLGYSEE
FT                   HIRELAEDGVI"
FT   gene            complement(500573..500764)
FT                   /locus_tag="Tcur_0441"
FT   CDS_pept        complement(500573..500764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0441"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96039"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L9"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY96039.1"
FT                   /translation="MTHFSQPQWRKSSRSAATGNDCVELADLGTAVGIRDSKNPNGPIL
FT                   QVSRHGLARMLEAARRSA"
FT   gene            complement(500761..501615)
FT                   /locus_tag="Tcur_0442"
FT   CDS_pept        complement(500761..501615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0442"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96040"
FT                   /db_xref="GOA:D1A2M0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M0"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACY96040.1"
FT                   /translation="MTPTGHGPPVRQRRLASELRKLREAAGLTAEVAAGNLGRPRSKLT
FT                   KIETARQIPTVADVEAILAAYGGRNSALGLALVELARNVRKRGWWVAFGDVLDGGFAEL
FT                   EDAATTIRIWQPETVPGLLQAPAYTRELITAEIDDPTEIERRVQARATRRARLERSDAP
FT                   ILDVMLTEEVLRRMVGGRPVMRQQVTALLRDLERPNVSIRIVPLEAGAFPDQGRGGLTM
FT                   FQVFEAGLDLSVAYFEAMNGGWYVEDVASIRECRRRFDQIARVALSTEETAKFLARIRK
FT                   ELE"
FT   gene            501833..503068
FT                   /locus_tag="Tcur_0443"
FT   CDS_pept        501833..503068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0443"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: scl:sce7166 DNA
FT                   repair exonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96041"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY96041.1"
FT                   /translation="MKLLHAADLHIDSPLRGLASYEGAPAQELRTASRRALENLVELAR
FT                   AEDVDAVLLAGDIYDGDWLDYQTGLFFARQMSALGKAGIDVYLISGNHDAQSSITRRLR
FT                   LPGNVRVFDTAQPQTFRDERLGLAVHGQGFARREVKDNLAVRYPAPLSGLFNVGLLHTA
FT                   LTGREGHEEYAPCKVGELQAKGYQYWALGHVHTREVVCEDPWIVFPGNIQGRHARETGP
FT                   KGCTLVTVDDLQVTGVEHRDLDVARWEHLRVDVTGAEDLDEAATLVAKRLRDLPAERLH
FT                   AVRVSLTGRTPAHLELNRERERLVNQIRLIATDLGALWVEKVRVETRPPDTPGEGTAGL
FT                   LADLQRTARELRLDHGRLHDLVARSELLRKGLPADVAERGGIDPGDPQWLTRIAEEAMD
FT                   LLAAMVAESRET"
FT   gene            503068..506517
FT                   /locus_tag="Tcur_0444"
FT   CDS_pept        503068..506517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96042"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M2"
FT                   /inference="similar to AA sequence:KEGG:sce7177"
FT                   /protein_id="ACY96042.1"
FT                   /translation="MRILRYDLTAFGPFTGLSLDLAAPGVHLVVGPNEAGKSTARHALG
FT                   QLLYGIDERTPYDFVHAKRDLRLGALIGRRDGGTLEIVRVKSRKAPLRTPDGDPIDQSV
FT                   LSAVLGGIDRQTFTAEFALSSTELREGGKALVAGKGELSQALAASRSGLRLTRVQEAIK
FT                   ARMEELYKPRGTRPAINTKLRELKETNARKRKASLRPDDYLAREREVERARQELERLKK
FT                   ELLDLRADHLRLERLDQALPQLNRRRHLLEELDRIRAEGPLAPPDAAERFPHLMEELRQ
FT                   ARRSEEQAGTRIENIDRQLAELHVDETLAAHADAIEALLQDMGAAQEAAERLEHLAGRA
FT                   AERREEAAALLARVHPDAALADERRYRIPQAVREQARELGERRTALDAELRERRQARDD
FT                   RHRKLQQARRRLAGLPPVPDDRPLRSALDAVPDDLLHRLTTTAAEVNRHRNRAAAIRER
FT                   LGLPEDGAVAVPSREQVDAHRQEADRIANDRRNLADRIAELTERLEEQRLELEGLRAHD
FT                   PPPTPEDLAAARARRDELWDGLPGTESEYLRAVRHADEIADRMFREAERVNRLRETRLA
FT                   IERDERRLARLQADHDALASREAELEAAWRRLWEGYAGPVPPPEAAADALEEVRRLQET
FT                   QREGDDAAALFEALADRAARHAARLRDLLDHPAGSDDPWTELPELQRLGRQRLEEWQET
FT                   AAACAAAEEKVAAEEHELEEAEAACAHCERRLEEWRERWKRLLGEAGLPAGREPVGALA
FT                   DLDLLARAEEALADADRIDREAQEAERKVARFHEELTRLADRCGREVPADPAERRLLVR
FT                   ALHQDAKDNRDRAAERDRLRRDREEHRAERDQAAQAVALLQAELEELMRATGACSVEEL
FT                   DAAVRRRDRHTEQERKLKELTETIVCGPHSLEELMAEAAETDPVRLRADLEELSGRIEE
FT                   LESLRTRLQDTFTRSKAELDRLDGSAEAAQAAAEAETLGAALVEEAEEYLRLEIAHAIL
FT                   LECAETYRSAQQDPVLERAGHLFGELTRGRFSGVELDPDEDPPVIVARRSGGELLRVHQ
FT                   LSEATADQLYLALRLASLERYAQEDRALPFTVDDIFMTFDDARTRAALRVLDGMADRFQ
FT                   VIVFTHHEHLAALARQALPPGRVHVHTLPEYRPGELAPAAGA"
FT   gene            507551..508486
FT                   /locus_tag="Tcur_0445"
FT   CDS_pept        507551..508486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce9199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96043"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96043.1"
FT                   /translation="MRGKTIRSLAVAALGLGGLAALAGTAEAARAGALAAPKITGVVRV
FT                   PAESADPESDKKTAVATCPAGKRVISGGGWVSAEQSGDVAKLALIELRPFYSSQVGSSG
FT                   YHASAVETSVVPSAKWKVHAYAVCADISSLKGWDLRLDYTDTTDRPKHSKEVGCADPAK
FT                   QRVVGTGAVAVTARGQEDKVTLQIARPSANGDIARAQSQKVDPAYTGLHRLDVYAICVD
FT                   KPQGYEVKVAPSPQKDSESIKVASANCSSGRRPLGAGGGISNVAPPHISLKRIIPSNPD
FT                   EGYAQVIAGEHTPTNANWDFITAYAICAAK"
FT   sig_peptide     507551..507622
FT                   /locus_tag="Tcur_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.488 at
FT                   residue 24"
FT   gene            509387..510445
FT                   /locus_tag="Tcur_0446"
FT   CDS_pept        509387..510445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0446"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pmy:Pmen_3447 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96044"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACY96044.1"
FT                   /translation="MKTKLLAIASVTGLAVALSGCGGGDSGGSDSTLTVTMWGGAAQKA
FT                   HVDSYFTPWAEANGVTIKQDSPTDYAKIKAQVEAGKVTWGLTEVEPNFANTACESGLLE
FT                   KLPQDIIDKAKASGVAEEQIGECAIPILQYSFTIAYNTKTFSGDHPKTWAEFFDTRRFP
FT                   GKRGFWKYATGGMFEAALLADGVKPDELYPLDIDRAFKKLETIKKDIVFYDTGDQMTQM
FT                   LASGEAPLVQAWSGRIYQARQEGEKVANEWNENLVSYDQIAVPKGYPNKELAFQWMRWF
FT                   LDNPKAQAADADASIYGPASENALQYVSADVRKELPGHPANAEKAIGLVNYDYWAEHYD
FT                   SVTERLNAWIAQ"
FT   sig_peptide     509387..509455
FT                   /locus_tag="Tcur_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.220 at
FT                   residue 23"
FT   gene            510442..511347
FT                   /locus_tag="Tcur_0447"
FT   CDS_pept        510442..511347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pmy:Pmen_3448
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96045"
FT                   /db_xref="GOA:D1A2M5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY96045.1"
FT                   /translation="MTTVATDSSMDTMQGRPRPLRLPQWLRFDGWGALVLPLLLFLILI
FT                   FVAPLVVMLSRSLTDPSLGLQNYRDLFANSVYLRVLGNTFLIATIVTAVTLALAYPYAY
FT                   LMTLVGPTWRMIMLGLVLVPFWTSILVRSFALVLFLRDTGAFNATLQSLGVIDEPIPLI
FT                   RTLPGVVFGMVQVALPFAVLPIFATMQNIDRRLLLAAESLGARPSGAFWRIFVPLSAPG
FT                   VAAGLLLTFIQALGYYITPALLGGPKNMMIGELIVQQVSSVLRFGFAAALATLLLVTTL
FT                   LLLLVASRFVDLQKHLMRQT"
FT   gene            511344..512171
FT                   /locus_tag="Tcur_0448"
FT   CDS_pept        511344..512171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcm:Bcenmc03_3606
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96046"
FT                   /db_xref="GOA:D1A2M6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY96046.1"
FT                   /translation="MTKILTRTGLAVLAALIGVYLILPILIVVPMSFSDSSFLSFPPEK
FT                   LSLRWFRNLVDDPVWLESAWASLKVALASSVCSVVLGVLAALALVRGRIPFRNTIIAVL
FT                   LAPLIVPYVIIGLAAYIAFLQLGLTQTTLGFVLVHTCLAVPYVVINVVAGLVAVDRRLE
FT                   MAAMSLGAGPVTTFFQVTLPLILPSVLAGGLFAFFTSWDEVVTAIFLSGPEVTTLPVQM
FT                   WSGIRVQIDPTVAAISTLVLLVVFGSFLILGLTRLIRRLARRRVTGPATNTGA"
FT   sig_peptide     511344..511448
FT                   /locus_tag="Tcur_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.820 at
FT                   residue 35"
FT   gene            512173..513273
FT                   /locus_tag="Tcur_0449"
FT   CDS_pept        512173..513273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0449"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rlt:Rleg2_4107 spermidine/putrescine ABC
FT                   transporter ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96047"
FT                   /db_xref="GOA:D1A2M7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M7"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ACY96047.1"
FT                   /translation="MTATLQTASPRKSTGASISIDAVSKKYGDNTVLEAVDLDIRAGEF
FT                   LTLLGASGSGKSTLLNIIAGFIRPNSGTVKVDGRDITSLPPHKRGFGMVFQHYALFPHM
FT                   SVADNVAFPLKRQKVAKNEIRTRVAEALEMVELGHLGNRRPAELSGGQQQRVALARAIV
FT                   FRPRVLLMDEPLGALDKLLREQLQLEIRRLHQEMGITFVFVTHDQDEALMMSDRIALLR
FT                   NGRIVQLGTPEQLYAEPNCRYSAEFVGASNIFTGTIQANGFIDDADGQHYRIPEGADRD
FT                   GRSLMIRPERLHIATETAFVPESMNRVEAIVEDCIYLGSSRTVQLRTPAGRRLLARTDV
FT                   PRVPDGVVPGARVYAYWDVHDSRVLD"
FT   gene            513295..514899
FT                   /locus_tag="Tcur_0450"
FT   CDS_pept        513295..514899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0450"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: pmy:Pmen_1795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96048"
FT                   /db_xref="GOA:D1A2M8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M8"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACY96048.1"
FT                   /translation="MATMTGGEALIAALAAHGVDTIFGIPGTHNLSAYAAMKRHGIRHI
FT                   SPRHEQGAGYAADGYARSSGRPGVCLTTTGPAILNAASAALQAYSDSVPVLFVSPGMPL
FT                   RHPGRGNGLLHEVKDQSGAMAAILGRSHRVTSVAEIPLAVAQAWTDLTGGRPRPVHLEI
FT                   PLDLLEERAEVTVVDPVPATTCTPAPESVTAGAAACAGARRPVLVVGGGARRAGAEVIA
FT                   LAEAVGAPILATSNGKGIVPEDHPLFVGAGLQHRCVLDLMDDSDLVIAVGTEFAPSDWW
FT                   IGLPDLSGKVLRIDVDPAGIVTNVVPAVPVVGDAAVALRALRAELDRPAPAGAAQRAAQ
FT                   WRDRHRQAARAEGEPWLPIVSAIAEALPRDAIVAADSAMACYYGALSNLPLHRPGAFLY
FT                   PTGAGTLGFGLPAGIGAKIADPDAAVLVLQGDGGTMFTVAELAAAAELGIALPVVVVDN
FT                   GGYGEIRNEMADRGEPVHAVALGRPDFPALARSLGCHGVRAADPAELTGAVKAALEADR
FT                   PTLIHVREESRAARGMA"
FT   gene            514896..515861
FT                   /locus_tag="Tcur_0451"
FT   CDS_pept        514896..515861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0451"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: rec:RHECIAT_CH0002310 putative
FT                   phosphoglycerate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96049"
FT                   /db_xref="GOA:D1A2M9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACY96049.1"
FT                   /translation="MRKPVAVYTDVVDTDPAPGVKLLEEAGFTVRFAASAAPADIVAAA
FT                   ADADALLLGYAEIDRPLLEALPAVRIVATQSVGYDMVDLDACRERGIWVTNVPGAATEE
FT                   VASHALAMTLALLRGLPYLDRDVRAGIWDGTRHDLRRLSEVTVGVVGLGRIGRRYAEYV
FT                   RPLVGRIVGYDPAVTAMHGVQWLALDELLACSDVVSLHLPLTAETRGLLDARRLGLMRE
FT                   GASLVNVSRAGLIDHRALVRCLDEGRLSGAALDVLPQEPPEPGDPILAHPRVLLTPHAA
FT                   YLSAASSRDYVLQQAENVVLWHARGRPVSVVVEGRPMAPR"
FT   gene            515947..516570
FT                   /locus_tag="Tcur_0452"
FT   CDS_pept        515947..516570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0452"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5356
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96050"
FT                   /db_xref="GOA:D1A2N0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2N0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96050.1"
FT                   /translation="MPRPSVEAERREQILKAACRVISEKGYKALRVTDVARYAKLSAAL
FT                   VHYYFETKRDLVHAAFEWNFSRSLERRKSILDRHSNARDRLRAFIDSYLPRDEETEAAW
FT                   RVWAETWVEALHDPDLRKLNERIYGEWRSIITEIIRLGQAEGLIVPGDPVLLANVLVST
FT                   IDGLAIQALVGSEHMTIARMQSVCDHLVKTMSVQSAEPVQAALG"
FT   gene            516703..517866
FT                   /locus_tag="Tcur_0453"
FT   CDS_pept        516703..517866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0453"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: mxa:MXAN_5921
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96051"
FT                   /db_xref="GOA:D1A2N1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2N1"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACY96051.1"
FT                   /translation="MFYELTDGIELTDEQREFVALARDFARNEIRPRAREVDEADTEAP
FT                   MDLWYKAAEVGLTSYMLPAEYGGGGVTDLVTQCLVQEELCHGDIGIANFLTSSSFFADP
FT                   ILELGTEEQKKKWITPLTGSEPPVTSVAVTEPGVGSDAAGLQTRAVRDGDHYVLNGVKT
FT                   WISNAPLSQYFVVFATVDPSKRARGVTAFLVERDREGVTVGAPMKKYGQRGTLNAEVFL
FT                   ENVRVPVENRLGEEGKGFYGLMRTFDASRILIGAAATGLSRAILEDAVQYAKERTQFGK
FT                   PIIEHQAVAFRLADMAAKTDISHLVTMRAARLFDAGKPVTAASAIAKVVASENTTWVAN
FT                   AGLLTHGGWGYSREFMVEKWLRDAKLEELEEGTSDIQRLIISRSLAK"
FT   gene            517878..519950
FT                   /locus_tag="Tcur_0454"
FT   CDS_pept        517878..519950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0454"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   xau:Xaut_5066 CoA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96052"
FT                   /db_xref="GOA:D1A2N2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2N2"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACY96052.1"
FT                   /translation="MSLSVFSDPASVAVVGASADPAKWGYWIARGALRGAHRREVHLVN
FT                   AKGAVIEGVQSARSLSELPSAPELVVLTAPARTIPAVIDEALALGVKGFLGITAHIDAA
FT                   NGEAGLERRLAERIRRAGARIVGPNCLGLYDAGSELELAWGTFVPGSIAIVSQSGQLGL
FT                   ELAGLAAHAGLGVSRFVSIGNQVDVTAAELLEDLISHETTRTVVLYLENFGAGRELAAV
FT                   MARLRQAGKHVIVLTVGASDAGRAAARSHTGAMTAATDVVAAACRAAGAAFVETPAQAI
FT                   DLAHLLIDGPLPAGDRVAIVSDSGGQGAIAADTLSRHRLTVPALSEGTRAAVAALLPEG
FT                   AGTANPIDLAGAGEQDLATYARLVDVLLGSGEVDTVVLSGYFGCYGADTPSLVDRELQV
FT                   ADAIAASAARHGRPVIVHSMSHDSQAVRRLRSRAVPTLFTIDAVARSLGIAAELARSAP
FT                   ADPARLAAPAAPLGDTGKALPYLAGRDLLAKAGLSYPRAIAVWTPEEAGTVARSMTGPF
FT                   VLKAGWLEHKTELGGVAVGLPDADAVRAALADMISRLGEGDYVLEEMDTRTGAVELIVG
FT                   ARRDPAFGPVVLVGLGGVTAELYRDVALALAPVDVAEARRLLESLAGLPLLTGFRGRPA
FT                   VDVDAVAESVVAVSRLIAEDGRVLECEVNPLRVGPDGAIAVDALVVAAAGDQPDW"
FT   gene            520174..520983
FT                   /locus_tag="Tcur_0455"
FT   CDS_pept        520174..520983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0455"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: vei:Veis_0229 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96053"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3C8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY96053.1"
FT                   /translation="MTEKSPLAEFDGRLAIVTGGGSGIGRAIALRYAAGGGDIVVIGRR
FT                   PEPLEETARMAERFGVRASVIPCDVRDADALTEAIDGVAAEHGRIDALVNNAAGNFVCP
FT                   AENLSPGGWRAVVDIVLNGTFYATRAAARHMLASGGGAILNVIASYAWHGHPGTVHSAA
FT                   AKGGVLAMTRTLASEWGGRGIRVNCISPGPTETEGAGAALWPTDEDRRRVLASVPANRF
FT                   TTPKEVAESAAFLLDPQRAAYINGAVLSVDGGQWLGKVIYSDSSARS"
FT   gene            520980..522431
FT                   /locus_tag="Tcur_0456"
FT   CDS_pept        520980..522431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0456"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pca:Pcar_1701
FT                   aldehyde dehydrogenase, NAD- linked"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96054"
FT                   /db_xref="GOA:D1A3C9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3C9"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ACY96054.1"
FT                   /translation="MSDPKTAGGLRPEWARSQVYIGGRWREPAAGRITPVENPATETVI
FT                   GTAADADAADVQTAVSAAAAAFPAWSSLPPAGRLEALERFHAALERRRHLLVETTVAEV
FT                   GAPVRVAREAHVDTGLAVLRAYLDAAAEVAWEERVGNSLVVREGIGVAACITPWNYPFY
FT                   QVLAKIGGALAAGAAVVLKPAELTPLSAYLIADAADEAGLPPGVFNLVPGTGPIVGEAL
FT                   VAHPAVDAVSFTGSTRVGSHVAALAAATVKRVSLELGGKSASIILPGADLEPAVRASVE
FT                   AAMLNSGQTCTAWTRLLVPRAAFEAALRLAAARAEEFTVGDPTRPETDLGPLVSAAQRR
FT                   TVTGFIERAAAGGARIVTGGPQRPAGLVRGHYVQPTVVTDVAPDAEIVQEEVFGPVLTV
FT                   QSYEDVDEAITLANGTPYGLAGAVWGDRDAAVAVARRLRTGQVDINGGAFNPAAPFGGY
FT                   RRSGNGRELGRWGIEEFLETKALQL"
FT   gene            522428..523369
FT                   /locus_tag="Tcur_0457"
FT   CDS_pept        522428..523369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0457"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mxa:MXAN_5916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96055"
FT                   /db_xref="GOA:D1A3D0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACY96055.1"
FT                   /translation="MTPIPARHDLRGALAIGALVAITAIWGSTFPISKDLLTRLPVPDF
FT                   LALRFLTAALVVGLVRPRALPRAGWRVIGVGAALGLLYFIGQYLQFVGLQHTAPTVSAF
FT                   VVSMYVVFTPLLAALLTRKPPSRRTVVATLLATTGVAAMSLRGLAFGWGEMLTLFAASL
FT                   YAAHILALERWSRAQIAYTLTVVQLGTMGLAFLAVASIDGLQLPATRDVPVFLYLALLA
FT                   GGLALLGQTWAQAHLPAPTVSITLVLEPVWAGIISVLFFKERLDARIIIGAALILCALL
FT                   VITGRARNAPQDGLRRPQRRKVPRVPLLRRSR"
FT   gene            complement(524301..527126)
FT                   /locus_tag="Tcur_0458"
FT   CDS_pept        complement(524301..527126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0458"
FT                   /product="NB-ARC domain protein"
FT                   /note="PFAM: NB-ARC domain protein; TPR repeat-containing
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96056"
FT                   /db_xref="GOA:D1A3D1"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D1"
FT                   /inference="protein motif:PFAM:PF00931"
FT                   /protein_id="ACY96056.1"
FT                   /translation="MVADTLVPPPAIWVGREEELDRLRQARRQAQAAGRPVVLSAVHGM
FT                   GGAGKTALARALAAEVAADYPDGRIEVDLFGFTPGHEPRDPGEVLGELLAQVGFDPADI
FT                   PAHPQAKVGLWRSWLASRRVLLILDNARDAAQVQPLLPGVGAAGGCLVVVTSRNQLTEL
FT                   DAAARIRVDTLPPQDAAALLVEAAGRSRAEIRATGEELAELARLCGYLPLALRPVGALL
FT                   ARLSAAELIEVMRAADHPLHYLDEADRAARTAFTVSYQALSPALREVLGACAWHPGPDF
FT                   DAGSLAALTAKPRPLAAVRLAELLQRNMLIGLPHGRYTFHDLFLGYARHHTGYSADDPG
FT                   VRQARHRLYQHLTATTDTAISTLTTKSTNHTGNAFATPTQARTWLSAATGELTTAAYTA
FT                   LTDHWSQAPTLAHHVARWLRLDDRYEQAAGLYTALHTTAQTTGDQRGQADALQGLGITA
FT                   RLQNEYGRAADYHHQALQIYQDIGNRRGQANALHSLGITAQLQDEYGRAADYHHQALQI
FT                   YQDIDDRLGQADALHSLGITARLQNEYGRAADYHHQALQIYQDIDDRLGQANALHSLGI
FT                   TAQLQNEYGRAADYHHQALQIYQDIGNRGGQADALQGLGETTRLQDEYGRAANYYGRAL
FT                   QIYQDIGDRGGQADALQGLGDIARLQDEYGRAANYYGRALQIYQDIGNRGGQADALQGL
FT                   GETTRLQDEYGRAANYYGRALQIYQDIGNRGGQADALQGLGDIARLQDEYGRAANYYGR
FT                   ALQIYQDIGDRRGQADALQGLGDIARLQDEYGRAANYYGRALQIYQDIGDRRGQANALH
FT                   SLGITARLQNEYGRAADYHHQALQIYQDIGNRGGQANALQGLGITAQSQNEYGRAADYH
FT                   HQALQIYQDIDDRLGQANAHLGLALLAEGQGQPQTAAQAYQSAATLYTEIGFTEQANQC
FT                   STAYQRIKRKA"
FT   gene            complement(527276..527716)
FT                   /locus_tag="Tcur_0459"
FT   CDS_pept        complement(527276..527716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_2923 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96057"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96057.1"
FT                   /translation="MLTEALAALAGAAGTGLVTAMTTDVWQQVRTRAARVLGRGDAREE
FT                   ERQQERLERARREVLQAPERQAEEVRRRQGEAWRTRFADLLEDTPQAEAQVRELVAFLA
FT                   KHAAPAAAAGAVQVNAQASDHAQQANLGQGVQNNTFGSPQAQ"
FT   sig_peptide     complement(527654..527716)
FT                   /locus_tag="Tcur_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.962 at
FT                   residue 21"
FT   gene            527954..528792
FT                   /pseudo
FT                   /locus_tag="Tcur_0460"
FT   gene            complement(528931..529004)
FT                   /locus_tag="Tcur_R0008"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(528931..529004)
FT                   /locus_tag="Tcur_R0008"
FT                   /product="tRNA-Phe"
FT   gene            complement(529018..529095)
FT                   /locus_tag="Tcur_R0009"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(529018..529095)
FT                   /locus_tag="Tcur_R0009"
FT                   /product="tRNA-Asp"
FT   gene            complement(529228..530589)
FT                   /locus_tag="Tcur_0461"
FT   CDS_pept        complement(529228..530589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0461"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gsu:GSU0452 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96058"
FT                   /db_xref="GOA:D1A3D3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96058.1"
FT                   /translation="MITTKGWPLRARLPLMAGGSMALMCLLAGLLVIMGIRGEAADQQR
FT                   AQTFETALSVTRHLQREDPPRVLPAQPDGTAIQVVDPSGRVISATGQLAGKPPMADFRP
FT                   TGASAVAHRELCPPRGMDACMDVVGFQVYTPSGERTVYAANRTVPWYVSGALVAFLVAL
FT                   SLLLILLVMAVTSRTINRTLAPVEAIRAELAEITASDAGRRVPVPESRDEIRLLAQTVN
FT                   ATLQRLDAALVQMRRFTADASHDLRTPIAAARARVEEALLYPDETDWPAMATDVLESLN
FT                   RLQAIVTDLLELAALDSKPEHVGEEVNLTGLIASEIARQPRRVPVHTDLAPEVMVRGDP
FT                   LRLTRLLVNLLDNAERHANSEIRVTLRAENGTAVMEVLDDGAGIPPEHRETVFQRFARL
FT                   DAARNRDAGGTGLGLPIARQTAAAHGGTLAAEDSPQGARLVLRLPLLATHDRPR"
FT   sig_peptide     complement(530467..530589)
FT                   /locus_tag="Tcur_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.772 at
FT                   residue 41"
FT   gene            complement(530729..531109)
FT                   /locus_tag="Tcur_0462"
FT   CDS_pept        complement(530729..531109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96059"
FT                   /db_xref="GOA:D1A3D4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96059.1"
FT                   /translation="MSTLRPAAGGLFTDGRRLLRAAALITGVNGPAYLALAGPLEDLLG
FT                   PAPGPSGRSCCSMRSPWGRCPRPPGSGAAPPRPSWRSTCCGRSSASRRPALNPAGRVWA
FT                   PLQAAVVAGFAAVQYAALRRTR"
FT   gene            531797..532036
FT                   /locus_tag="Tcur_0463"
FT   CDS_pept        531797..532036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0463"
FT                   /product="putative signal transduction protein with EFhand
FT                   domain"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   SMART: Calcium-binding EF-hand-containing protein; KEGG:
FT                   similar to calcyphosine-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96060"
FT                   /db_xref="GOA:D1A3D5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D5"
FT                   /inference="protein motif:PFAM:PF00036"
FT                   /protein_id="ACY96060.1"
FT                   /translation="MTAESIEGGLSNAFRRVDVDGDGKLDLMGFTLVLEELGLSWSRAE
FT                   TQERFERADSNRDGLISLDELRAMLASYNLTGAA"
FT   gene            532671..533492
FT                   /locus_tag="Tcur_0464"
FT   CDS_pept        532671..533492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0464"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ara:Arad_8116 aliphatic
FT                   sulphonate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96061"
FT                   /db_xref="GOA:D1A3D6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACY96061.1"
FT                   /translation="MSAPSIDLARPAGRVRNVPIRLPRGALLRAASPLALLVLWQLASS
FT                   TGLLSDRLLAAPSTIAATALDLLQDGTLTGAIGVSLRRAALGFALGAIAGIGLALIAGL
FT                   SRLGEHAVDPPMQMLRALPLFGLIPLFILWFGIGETPKIALVAFGVAFPLYLNTYAGIR
FT                   GVDAKLAELGKVLRLSRAALIRHIVLPGALPQTLVGLRQSLGVAWLALIVAEQINANQG
FT                   LGFMINDAREFLRTDIVVVGLLTYAALGLLTDAFVRLLERRALSWRRQFLG"
FT   gene            533468..534202
FT                   /locus_tag="Tcur_0465"
FT   CDS_pept        533468..534202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0465"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: avn:Avin_21610 aliphatic sulfonates ABC transporter,
FT                   ATP binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96062"
FT                   /db_xref="GOA:D1A3D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY96062.1"
FT                   /translation="MATSVPGVTTQPAARVSGLVKRFGDRTVLDGVDLRIERGEFVALL
FT                   GRSGSGKSTLLRALAGLEPISGGELEVPGTVSVAFQEPRLVPWKRVAANVALGLDVPDP
FT                   RKAAEEALAEVGLRGHRDAWPLTLSGGEAQRVSLARALVRNPSLLLLDEPFSALDALTR
FT                   INVHRLVLDLWERHRPGVLLVTHDVDEALLLADRVLVLENGRIGHETTVGLERPRHRDN
FT                   TELIRLRAVLLERLGVNPEGTA"
FT   gene            534199..535191
FT                   /locus_tag="Tcur_0466"
FT   CDS_pept        534199..535191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0466"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: bid:Bind_0526 aliphatic sulfonate ABC
FT                   transporter periplasmic ligand-binding protein; TIGRFAM:
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96063"
FT                   /db_xref="GOA:D1A3D8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D8"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ACY96063.1"
FT                   /translation="MKRRIIALLAALSLTVTAVSACGGSDEEAASGTGDPSKVTLTIGD
FT                   QKGASLQSLLKAAGQLDDTPYKVNWSLFTSGPPILEAINAGSVDFGLVGNAPPVFAAAA
FT                   RSKIVIIGATEISLEGQAVVVPGDSAIKTPAELRGKKVAVAKGSSAHYHLVQVLKKNGL
FT                   SYGDIQPQYLQPADALAALSGGRVDAWAIWEPYTAQAETQEGVRIIADGNGYVNGYNFQ
FT                   ITSEAALKDADKTAALKDFLGRYHKAVLWANDHPKEWAELWAADTGLPVDVAEQAHRRR
FT                   LATILRIDDEVVTEEQRVADAFSELKLIPGKVEIADFFDRRFNDIVEAK"
FT   sig_peptide     534199..534264
FT                   /locus_tag="Tcur_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.702 at
FT                   residue 22"
FT   gene            535206..536369
FT                   /locus_tag="Tcur_0467"
FT   CDS_pept        535206..536369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0467"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   avn:Avin_30500 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96064"
FT                   /db_xref="GOA:D1A3D9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D9"
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /protein_id="ACY96064.1"
FT                   /translation="MTLKFHWFLPTFGDGRTLNGGGGHNVPRDASGLAARPGTADRERR
FT                   PTLEYLAQIARAAENLGFDAVLTPTGTWCEDAWITASALISETRRLRFLVAFRPGLTSP
FT                   TLAAQMAATYQRMSGGRLLMNVVTGGEKTEQARFGDHLSHAERYARTDEFLTVVRGAWS
FT                   GEPFDFSGKYYQVEGATVAGGVDPVPELYFGGSSKPAGPVAARHVDVYLTWGEPPEQVA
FT                   EKIAWIRKLAAQEGRILRFGIRLHAITRDTSEEAWKEADRLLKAIDPATFAKAQKALAA
FT                   SESVGQQRMLALHENFRAFGGSTRDLEIYPNLWAGIGLVRGGAGTALVGSHSEVADRIE
FT                   EYAELGITEFIMSGYPHLEEAYWFGEGVLPELQRRGFLASEPLKATA"
FT   gene            complement(536494..537198)
FT                   /locus_tag="Tcur_0468"
FT   CDS_pept        complement(536494..537198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0468"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG:
FT                   bur:Bcep18194_C7069 carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96065"
FT                   /db_xref="GOA:D1A3E0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E0"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ACY96065.1"
FT                   /translation="MQTRTESVAVDDGAFDMHLWVPERGRGPGLLLIQEIYGVGKYIRG
FT                   VAEKLAARGYVVGAPDLFWRLQPGWAAEHDEEGLQQSLKLASRFQLEAGVADLSAAFDR
FT                   LRELPEVTGAAGVLGFCLGGTMAYHLAARRSELAAAVSFYGSGVPSALELAGRITCPLQ
FT                   FHFGGSDPYIPREQIAAVEEAVAPMPNVEIHVQEEAGHAFHNWEAPMFHQPEHAERAWS
FT                   LTERFLERHLPC"
FT   gene            complement(537272..537556)
FT                   /locus_tag="Tcur_0469"
FT   CDS_pept        complement(537272..537556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0469"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   cak:Caul_0214 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96066"
FT                   /db_xref="GOA:D1A3E1"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E1"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACY96066.1"
FT                   /translation="MIIVAGWIRLRAGAREDYLAGCRPVIEAARSAPGCLDFTLSADPI
FT                   DPERINVFERWESDAALEAFRGTGPDEDQTSAIRDAQVSRYRIAAVEPA"
FT   gene            complement(537799..538311)
FT                   /locus_tag="Tcur_0470"
FT   CDS_pept        complement(537799..538311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0470"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: abc:ACICU_01968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96067"
FT                   /db_xref="GOA:D1A3E2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E2"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACY96067.1"
FT                   /translation="MTRTLTRHPPVSTRRFRRTIAKHASGVVVVTARDAHGHPIGQTAT
FT                   SFSSVSLDPPLVSFCIERSSPAWPGLAEAELLAVNLLAGHQAPIATRFTRDDVDRFGVP
FT                   TAWRPGPGGVPLLEEVTAHLLAVPHSVTEIGDHCLMVGLVIGARTGHGGTPLLYHHGRF
FT                   GRFIPHP"
FT   gene            complement(538308..538820)
FT                   /locus_tag="Tcur_0471"
FT   CDS_pept        complement(538308..538820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0471"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   rfr:Rfer_1780 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96068"
FT                   /db_xref="GOA:D1A3E3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E3"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACY96068.1"
FT                   /translation="MSSLVTLVGNPRAASRTHRAATAAAGAIADRIGWDGPREVIDLSA
FT                   LAAQLYASDPTADLDAALKTVADAHVLVVASPTYKGTYTGLLKSFLDLLPSGALAGTTA
FT                   LPLLVMGAPQHALAVEVHLRPLLVELGAHVPTPGLALLESQLPELEKVLGEWAERTAPQ
FT                   IPREAAS"
FT   gene            complement(538817..539308)
FT                   /locus_tag="Tcur_0472"
FT   CDS_pept        complement(538817..539308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0472"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96069"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E4"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACY96069.1"
FT                   /translation="MVTVRPPQARSIEEILQAARRRLDRLEPAEAHREFSRGQALLVDI
FT                   RPQAHRAAEGEVPGSLIIERNVLEWRFDPASPARLPQATGYDVRVIVLCAEGYTSSLAA
FT                   ASLHELGLTRATDVIGGYRAWRAAGLPTTGAPHAAAPDPTYPTLPPEPVMNARPARRSR
FT                   "
FT   gene            complement(539302..539760)
FT                   /locus_tag="Tcur_0473"
FT   CDS_pept        complement(539302..539760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0473"
FT                   /product="cysteine dioxygenase type I"
FT                   /note="PFAM: cysteine dioxygenase type I; KEGG:
FT                   mxa:MXAN_0927 cysteine dioxygenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96070"
FT                   /db_xref="GOA:D1A3E5"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E5"
FT                   /inference="protein motif:PFAM:PF05995"
FT                   /protein_id="ACY96070.1"
FT                   /translation="MTLSTPIAPAHLRPAEIARTLAAAPQEWIHRVRLNIPERWYERLH
FT                   HDEHHEVWLLSWMPGQSTGLHDHGGSRGAFAVALGSLDEYDLHTRRTLTVGQFREFGAD
FT                   HIHEVANTTQAPAVSVHVYSPPLTSMNRYDLTPAGRLVRLAVERADQW"
FT   gene            complement(540341..540568)
FT                   /locus_tag="Tcur_0474"
FT   CDS_pept        complement(540341..540568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96071"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96071.1"
FT                   /translation="MEIPLWVNYGQAYLMEKEAKPLVIHLDDETVIKAGSAYAYFLTGL
FT                   TRGSPAWTWRSPRRPRGESRRLWGRRGSES"
FT   gene            540938..541165
FT                   /locus_tag="Tcur_0475"
FT   CDS_pept        540938..541165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96072"
FT                   /db_xref="GOA:D1A3E7"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96072.1"
FT                   /translation="MAAGLGLFLAAGVVLALKISVIIQLIILAIQIAQAIATAAVTFGA
FT                   SLAQIPIFRIITKMIIDMLIDQAIGALLGQ"
FT   gene            541745..542197
FT                   /locus_tag="Tcur_0476"
FT   CDS_pept        541745..542197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96073"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96073.1"
FT                   /translation="MSAEAYHWPPEVTAHMTAAGWSPERRVDVSAWEEELSRTSGFRMH
FT                   TAAARFLAEFGGLKVPEGPNEPGQQVASDEFDLDPLEGEKMRPYFQRVGRAAVGELYPI
FT                   GSVAGGHALLAIDEAETVFMLFGDHCRRIGVGREAIANLILGRRPQ"
FT   gene            542528..543730
FT                   /locus_tag="Tcur_0477"
FT   CDS_pept        542528..543730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0477"
FT                   /product="ABC-type sugar transport systems ATPase
FT                   components-like protein"
FT                   /note="KEGG: noc:Noc_0279 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96074"
FT                   /db_xref="GOA:D1A3E9"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E9"
FT                   /inference="protein motif:COG:COG3839"
FT                   /protein_id="ACY96074.1"
FT                   /translation="MPTLAREAGISQATGHRYLGEPALQALRTMRAFGRSPAADPSLPN
FT                   MWEDDVRPAMESGRAAYQINWPFVHASMAANRPDMLPHFKWAPTRASPARVRPRWAAAT
FT                   SPSAPTPATPTTLCLRDAESQEIAAIRDGLPPTLRSLYDDPQLARAYPMRQAILDAKLR
FT                   VQMRTTISRLQKELGTTTVYVTHDQVEAMTLGDRIVIMRDGVVQQVGPPQDLYDHPRNL
FT                   FVAGFIGSPPMNFLPAKITPDGLRSPLGTIPPSDRLRRATSGPNTPDEVILGIRPEAFE
FT                   DAELVPDADPSTTFTGTVDILESLGAEKYAFFDLGTEGMARSEHLEALARDRGTQDMTG
FT                   TVQITTRLDPRSTATEGRPLKVWFNPSAIHLFDPASGINLTEQPRPETPSTGHGRPSRS
FT                   S"
FT   gene            complement(543978..544493)
FT                   /locus_tag="Tcur_0478"
FT   CDS_pept        complement(543978..544493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96075"
FT                   /db_xref="InterPro:IPR025851"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96075.1"
FT                   /translation="MISHQEMSDLWGEDGLLYIPPEHVERFRFDLRMLSPEAAIPAEVP
FT                   LLFTAYIDDEIKLFNVLEIQVGDNEPMGLLALGAVPDEKMYYCLDGDTGRVLLLDLGDQ
FT                   VGLEPVNSSLATFVEFLYRLEQFIRADQGRATRAPRAAELRRELAALDPSAFADPESWW
FT                   SIAFNQLQ"
FT   gene            complement(544497..545006)
FT                   /locus_tag="Tcur_0479"
FT   CDS_pept        complement(544497..545006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96076"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96076.1"
FT                   /translation="MRQQVQRKLEAAMATLATIPDSYMFANFQPGSRDPMPDIPEGLRD
FT                   LLAITDGFNAGDVAIFSYRELDRNQFYIDDSESIELMGGDRDRWLCFGLNNDFPLIIER
FT                   TAGTIWWFPETWLEYSFMATRFEQLADSIDDFIDRFLLGEGYLQLIGGQDRWSDFLHEH
FT                   GFITTE"
FT   gene            complement(545003..545383)
FT                   /locus_tag="Tcur_0480"
FT   CDS_pept        complement(545003..545383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96077"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96077.1"
FT                   /translation="MPKAQFRRKARALQRLGEENMLFKAINPVRPRDQNRRRAHQQDLI
FT                   RRIHRQYGQRNPDFSRRLISRITNARDMQLDHVHELQLGGADLRNNLRYLDAFTNREVG
FT                   NQIRQQIRNLPDGTPIRIRIIE"
FT   gene            complement(545573..546067)
FT                   /locus_tag="Tcur_0481"
FT   CDS_pept        complement(545573..546067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96078"
FT                   /db_xref="GOA:D1A3F3"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96078.1"
FT                   /translation="MGLQLPGELVSLLSMLGFTWPEADETELLKMGNAWLRFAAAHEGP
FT                   LGELDGHAHQVWQNNRADDIDAFRNAWNRPDAPKANLEDFGTAANIIGAGLMVCAGIVL
FT                   ALKINVIIQLTILAIQIAQAIATAAATFGASLLEIPIFKMITKFAIDMLIDMALQAILN
FT                   G"
FT   gene            complement(546070..546396)
FT                   /locus_tag="Tcur_0482"
FT   CDS_pept        complement(546070..546396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96079"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96079.1"
FT                   /translation="MGNQYEVNPNSIKTAGGRIYTSAQQLKADWEAFQAELAAFGEPWG
FT                   TDEIGSLIGGCYQAIYELAAECYADNIAALEEQADKVKIMAANHFAAEDASVIEVNRVR
FT                   DILG"
FT   gene            complement(546426..546839)
FT                   /locus_tag="Tcur_0483"
FT   CDS_pept        complement(546426..546839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96080"
FT                   /db_xref="GOA:D1A3F5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96080.1"
FT                   /translation="MSHDFAHTELEELLTRTREAIEASFGNRSPQVEVRGEGTDPDGHV
FT                   RAVAVSGGRIETVEIAPQAVRLGSHRLAECALAAVNAALADLEAKAAEAAGLTGPQADA
FT                   LRERLREMQDLSLQQLRSYSRSLQDLMNSFERS"
FT   gene            complement(547715..547864)
FT                   /locus_tag="Tcur_0484"
FT   CDS_pept        complement(547715..547864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96081"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96081.1"
FT                   /translation="MTDEAPGARYAIAVPSSALKAALRVPQRIRDLLRVTVYEVRDDLT
FT                   VKAH"
FT   gene            complement(548939..549130)
FT                   /locus_tag="Tcur_0485"
FT   CDS_pept        complement(548939..549130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0485"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96082"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F7"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY96082.1"
FT                   /translation="MDTPKWRKSSRSNINGGDCVEVARLPYAIGIRDSKNPHHGHLTIT
FT                   PNAFRTLTHRIKRDEAHA"
FT   gene            complement(549180..549371)
FT                   /locus_tag="Tcur_0486"
FT   CDS_pept        complement(549180..549371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0486"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96083"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F8"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY96083.1"
FT                   /translation="MDTLKWHKSSRSNINGGECVEVARLPYAIGIRDSKNPHHGHLTIT
FT                   PNAFHTLTRRIKQDALCA"
FT   gene            complement(549419..549610)
FT                   /locus_tag="Tcur_0487"
FT   CDS_pept        complement(549419..549610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0487"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96084"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F9"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY96084.1"
FT                   /translation="MNHLIWRKSSYSMNQGGECVEIARLPHAVGIRDSKNPHHGHLTIT
FT                   PNAFRTLTHHIKQEQLTR"
FT   gene            complement(549610..550413)
FT                   /locus_tag="Tcur_0488"
FT   CDS_pept        complement(549610..550413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0488"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96085"
FT                   /db_xref="GOA:D1A3G0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96085.1"
FT                   /translation="MTRPSPDPKNSLWDFMAYYLRFLRTQHNMTGETVGRLIQRSKSTI
FT                   SRYESGEYRLTDHDCEALDQAWNTGGLFSTLLHYARLGHDPDWLRQYIDHEAQATVIKS
FT                   WHSNLVPGLLQTPDYARAGLMAGGVKDVDAAVAERMGRQAILDRENPPTLLVMLAESLL
FT                   ELPCGGPAVMKAQLAHILDLSERPNIGVRVVPKAAGHHPGLDGPFMLLTVETTDVAYVE
FT                   AHGGGRLVTSAPQVRAFGLRYDWIGQYALPECQSRDVIARIMGAM"
FT   gene            550653..551090
FT                   /locus_tag="Tcur_0489"
FT   CDS_pept        550653..551090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0489"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: pzu:PHZ_c1828 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96086"
FT                   /db_xref="GOA:D1A3G1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96086.1"
FT                   /translation="MSPWNGTPGRVENFQFVKWEVPVTDQAPALVRRRAVAVLDGWGMA
FT                   EVARDAATVLTELVTNARQAGATRMVVLVEADAAPDLVEVCVWDDAPGVPCKQEPDPCS
FT                   ERGRGLLMVEALAVAWGHHPLSLDAEHPGKVVWAALARSGK"
FT   gene            551087..551338
FT                   /locus_tag="Tcur_0490"
FT   CDS_pept        551087..551338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96087"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96087.1"
FT                   /translation="MNIQQIAQALERAHPGWVVIPGYYSGHFTAIPGAFYRYRDSGMII
FT                   ADDPDELERRIRLVEKSAAQNGAGQPSSVRRDVASPDR"
FT   gene            complement(551360..552424)
FT                   /locus_tag="Tcur_0491"
FT   CDS_pept        complement(551360..552424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0491"
FT                   /product="cell shape determining protein MreB/Mrl"
FT                   /note="PFAM: cell shape determining protein MreB/Mrl; KEGG:
FT                   pla:Plav_2479 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96088"
FT                   /db_xref="GOA:D1A3G3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G3"
FT                   /inference="protein motif:PFAM:PF06723"
FT                   /protein_id="ACY96088.1"
FT                   /translation="MPLRDFPCRDTAIDPGSRTSRVHVRGRGVVAVVPSLLALCERTGQ
FT                   CLAAGGHALALHAEAPRGVRFVRPFEGGVPGDLEATRLMLRHLLRVAHGRRFLTTPRLA
FT                   IAVPSQITDVQQRALAVAAAGAGARKLTLVPTPLAAALGAGLPVDEPPAVMIVDLGAVI
FT                   TDIAVISMGTLVTARTVRVGGESLDQAIVSYVRRNRSALVSIEHAATAKSRMGADGQWG
FT                   YGRPPLMLTGRDPDNGLPRPVMLAPADIAAAISGPMESVIRAIRETLAGCPPEIVRDLT
FT                   TNGITLTGSGARLSGLTTLLWTRTGLPARVADAPSEATVLGAARQLERARPAGHRWLSR
FT                   RDRRHGFLTAPRYL"
FT   gene            complement(552609..553652)
FT                   /locus_tag="Tcur_0492"
FT   CDS_pept        complement(552609..553652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96089"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96089.1"
FT                   /translation="MGSFGGRDGWRPAGNCSLFACDIVGFSDPLRSDRAREHLHQKLYS
FT                   ILESAFAESGLPPESCYQEDRGDGALVLLPPELDPSLLVHPLIGLLRGKVLDHNELSAD
FT                   VAQIRLRVALHIGRAKANAKGIVGSDVNHLRRLLDAPPFKEEMAESGAVLGVLVSQEMY
FT                   DAVIRDARGLIDPEEFRPVEVHVKTTHATGWLRIPGDRRGLGGVRAGGGPSPPSPNGSS
FT                   QELVQAGRRPSQEPRAEVHIPGPNGEPALRPEVAGQFELVNRILAIPHMRTSEGRDDVV
FT                   DSLRQDIRIRIARRSRPQTDWLSIVRTCAEYPDGLEELIGLIHEYTGDTAQMMALRELV
FT                   ARMGWTN"
FT   gene            553966..554343
FT                   /locus_tag="Tcur_0493"
FT   CDS_pept        553966..554343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0493"
FT                   /product="protein of unknown function DUF488"
FT                   /note="PFAM: protein of unknown function DUF488; KEGG:
FT                   bte:BTH_II0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96090"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G5"
FT                   /inference="protein motif:PFAM:PF04343"
FT                   /protein_id="ACY96090.1"
FT                   /translation="MPGRCAGMPTGVIEIRRVYDGPPDHGAVFLVDRVWPRGVRKEELR
FT                   LDGWAREAAPSTELRRWFGHRPERFAQFADRYRRELDARPDAVRPLLEAARRGPLTLLY
FT                   SARDTEHNQAVVLRDYLNDHL"
FT   gene            complement(554350..556557)
FT                   /locus_tag="Tcur_0494"
FT   CDS_pept        complement(554350..556557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96091"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96091.1"
FT                   /translation="MRMSRRRLTALLAEAEELPPSQAQVTAFRKAVGHAAAAGMTDLLI
FT                   DARLGLVDAMIAADARDVSEVNDALTAFAQTVALHVADPGAFDEDQQDRLWWQFGVLGL
FT                   VMTGLPDYSPATVRRLLDDMERHCRPDRDDRYMICSLRVMLAEATGDTELGDRSLAELR
FT                   HLQAPDYTCPACMHMMQVRYLERTGRDEEAIAAAEPLLAGLLPCLTDDQPHRTLALLTL
FT                   PYLRTGRLEEARDAYRMAVRHKLPQADLARLLHFCVVTGNLEQALTLFKRNLEMLENAP
FT                   LTEHDMDLAASAALMCRAMVEAGRGEEVLVWPANPELGETEDEEWTYRELLEEFRKDAL
FT                   EFAERLDRSTGSTLAGDRVRAVIAAGPSVAHLPLSPLAAHRPSVPPAGAQGRAAAPAGG
FT                   SGPSAPDEQALRRAYEEAVAHARRGAALSEEGRFDAAIPEFIEAVARFTALGNRRLATY
FT                   ARVDLATAYLSAGRMLDAAEVAEEALPDVPEDRQREYTGLQCRWVLVRAYPALGQHEDA
FT                   LKMVAEMRRLQSEDAPEPVRLPRLDREEAQILSDLDRDEEASALLESAADGYAALGDVP
FT                   AQLSCLRRAALTAVWSDRPERAADLIGRARAVAGGLPAGDPHAAEQRAFTDFDTARVLS
FT                   AVGRLEEGLQSAERASAALRELGLPAMATRAATLTGELLGALGRLEEAAGVLRRALAEP
FT                   AADEEHRNEQESAARLLAEVLRDLGRPEEAARVENAFAMSE"
FT   gene            complement(556560..558356)
FT                   /locus_tag="Tcur_0495"
FT   CDS_pept        complement(556560..558356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0495"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mxa:MXAN_1393 HSP90 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96092"
FT                   /db_xref="GOA:D1A3G7"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96092.1"
FT                   /translation="MRHSFSVDVRGVVDLLSRHLYRSPRAYLRELLQNAVDALSAHTPA
FT                   DPLVRIEPPSVTGDGTLRVHDNGVGLTEEQVHELLATIGRSAKRDELGFARQEFLGQFG
FT                   IGLLSCFLVADEVEVVTRSAAVPDAATVRWLGHCDGHYTVEPAGPRPEPGTTVTLRARP
FT                   GAAQWLSEETVTELACEFGRFLPYPVQVAGRTVTEGEPPWLVSHPDPRARREALLRYAD
FT                   RALGMQPLDVVELSVPAAGLSGVAFVLPEAVSPSARPAHRVYLKRMLLGDRVERLLPDW
FT                   AFFVRCVVNATELRPTADREQLYEDDLLEETRQALGEQIRAWLVRLAATSPARLRRFLQ
FT                   VHHLGVKAMAVHDIEMLRLVDRWLELETSDGDMTAAEFRRRHGRIRYTTDAEEFAQLAA
FT                   VAAAQGVGLINGGYTYEAEILNRLPLLDPDIDVAPLDPAELTTRMDVLDPQTELVVRDF
FT                   LEVARTALERLGCEPVIRAYQPVGLPVLLLESRQAERRAEHRSALESAVGAWADLLDDI
FT                   AGEEDRPARQARPQLVFNYNNPLVRRMTGVGDPLLVRLTVEALYGHALLQSRRPMRPAD
FT                   TAVLNRSFLGLVEWAMHNTSEG"
FT   gene            558532..560403
FT                   /locus_tag="Tcur_0496"
FT   CDS_pept        558532..560403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0496"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: scl:sce0244
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96093"
FT                   /db_xref="GOA:D1A3G8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G8"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACY96093.1"
FT                   /translation="MARIRWRDRVRYWFDNTMSKGTPALIGWLGMASAVLIVTVATLAV
FT                   WITPRDADDNGHWAGVLWRSLLRTLDAGTMGDDTGSAPYLALMLTATFGGLLIVSAFIG
FT                   VLTTGLEAKLTELRKGRSRIVESGHTVILGWSDQVFTVLSELAEANQGRRRTTVAILAD
FT                   CDKVEMEDAIRARVGDTGRIRVVCRHGNPLKVGDLELVSPSTARSIMVLAPPGGDPDTY
FT                   VIKVLLSLNTRSWDEPRPHVVAAVQDSANLPAARLAGGPAAQVIDADDIAIRLIVQSHR
FT                   QSGLSQVCTDLLDFKGHEFYMRAEPSLAGTTYGEALLAYELGIPVGLRRDGKSQLNPPM
FT                   DTVIAPGDEVIVLAEDDLLIKLAAARPPVVEEAIETARAHPAAPSRTLMLGWNHRAPKI
FT                   IRLLDEFVEAGSELTVAGLCADPRAHLADLRNLRIGFVYGDDTSRTFLDSLDVGSYQHV
FT                   VVLSDEAFEPPLADARTLVTLLHLRDMEEELGDPYSIVSEINDDADREVAQVTKADDFV
FT                   VSDKLISLMLTQLSENRHLHEVFFDLLDPAGSEIYLKPAADYLTPGVEANFATVIEAAR
FT                   RRGQTAIGYRRWEDFHEPPTYGIVLNPDKTAPLTLSADDRVIVIAED"
FT   sig_peptide     558532..558666
FT                   /locus_tag="Tcur_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.698 at
FT                   residue 45"
FT   gene            560629..561468
FT                   /locus_tag="Tcur_0497"
FT   CDS_pept        560629..561468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0497"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mxa:MXAN_6105
FT                   Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96094"
FT                   /db_xref="GOA:D1A3G9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G9"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY96094.1"
FT                   /translation="MSSAAPVLFAASDLHVGHRENRALVEAVRPSSPGDWLIVAGDVGE
FT                   KIADIEWALRTLAGRFAKVIWTPGNHELWTAPGEDQELRGEKRYRYLVEMCRTLGVLTP
FT                   EDPYAVWEGPGGPVTIAPLFLLYDYTFRPDGASTKEEGLAIAYETGVVCTDEMLLHPDP
FT                   YPDRESWCAARIAETERRLAQRPQGLPTVLVNHFPLIREPTRVLRYPQFAQWCGTERTD
FT                   DWHVRYEASVVVYGHLHIPRTIWRDGVRFEEVSLGYPREWRHRGTPPVLRKVFPDVS"
FT   gene            complement(561469..562074)
FT                   /locus_tag="Tcur_0498"
FT   CDS_pept        complement(561469..562074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0498"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: mlo:mlr4723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96095"
FT                   /db_xref="GOA:D1A3H0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H0"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACY96095.1"
FT                   /translation="MSVVRRAGTLSRGRSPLIDRPPRTEPGHMNIDQHWFRDRQEVLEH
FT                   PGPQDPPAPLPAPGTRHPPGDGGQVASLSPQECLALLRTASIGRIVFTDRALPAIQPVN
FT                   FALDGEDIIIRTRPGTKLAAATRRAVVAFEADDLDPETGAGWTVTLVGQAEAVRDPGQV
FT                   VRLLRLPLYPWSPEPLHHFIRIRTHRITGRRVRKNATP"
FT   gene            complement(562086..562514)
FT                   /locus_tag="Tcur_0499"
FT   CDS_pept        complement(562086..562514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0499"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: mlo:mlr4723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96096"
FT                   /db_xref="GOA:D1A3H1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACY96096.1"
FT                   /translation="MPYDSGGLEILDEDECRALLAKAPLGRIVFTQRALPAIQPVNFTV
FT                   DNGDVIIRAAQGTKLAAAARNAIVAFEVDDFDEASRTGWSVVIVGPARVVSDPKEVARL
FT                   QELPLRPWAPGRREHFIRIRPTLISGRRIPEHSAPPPS"
FT   gene            complement(562603..563283)
FT                   /locus_tag="Tcur_0500"
FT   CDS_pept        complement(562603..563283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0500"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: dar:Daro_0834 LuxR response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96097"
FT                   /db_xref="GOA:D1A3H2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY96097.1"
FT                   /translation="MSAEQSQDQRTIRVFLLDDHEVVRRGVAALLSAEDDIEIVGEAGT
FT                   AEQALARIPAARPDVAVLDVRLPDGDGVSVCREIRSRMPEVACLMLTSFEDEEALFDAV
FT                   MAGAAGYVLKQIHGSDLVGAIRTVASGQSLLDPQSTAKMLQRVRERAARKDPLASLTDQ
FT                   ERQILELIGEGLTNRQIGERMFLAEKTVKNYVSNLFTKLDMRRRTQAAALAAQLKANRG
FT                   SLSR"
FT   gene            563440..565155
FT                   /locus_tag="Tcur_0501"
FT   CDS_pept        563440..565155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0501"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; GAF
FT                   domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: GAF domain protein;
FT                   ATP-binding region ATPase domain protein; KEGG: scl:sce2236
FT                   putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96098"
FT                   /db_xref="GOA:D1A3H3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96098.1"
FT                   /translation="MAPEQGAGEDRARLLLPQLKLDDLLTELQARLETVRSTRDRVHAL
FT                   LEAVVSIGGDLDLETVLRRITEAATTLVDARYGALGVIGEEGERLVQFVSVGVTQEEID
FT                   AIGHWPHGHGILGLLIKDPRPLRLHDLTKHPEAYGFPPGHPVMKRFLGVPIRVRDEVFG
FT                   NLYLTEKVGGGDFEEEDEIVLTALATAAGVAIENARLYEAGRQRERWLAASGEVTTALL
FT                   SGRERSDVIALVAERARQICDAELAMVALADEDAGEFVIEAAAGEDAERFTGRRVPMEQ
FT                   PAEALQVYRSGEPSSLVEGQPLVEDPQLRVGPVLIVPLGTGSTARGVIWVADKPQSLPF
FT                   REDARRLLEAFAGPVTVALELAERRRDAERLTLLEDRDRIAKDLHDTVIQRLFATAMTL
FT                   MSAAKLIDRPDAQARVRRAVDDLDDTIRQIRSTIFALQTPPDEESLRSRLHHVVDAAAE
FT                   NLGFAPSVRLDGLLDTAVDESIGEHLLAVTHEALSNVARHAHASEASVSVDVGDSDLTL
FT                   RVEDNGVGIPEGGRRSGLRNMAERAQRLGGTFTVQNRPEGGARLVWTVPLAADS"
FT   gene            565335..565910
FT                   /locus_tag="Tcur_0502"
FT   CDS_pept        565335..565910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_2920 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96099"
FT                   /db_xref="GOA:D1A3H4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96099.1"
FT                   /translation="MAVLEGKAGDKTRGEHRGFPRPHLAAPLTEPPAARYVWAAARLGL
FT                   AWIFLWAFLDKTFGLGHGTPAAKAWLEGGSPTEGFLKNAASGPFADFYHGLAGMAWVDW
FT                   LFMLGLLGIGTALALGIGMRIAAASGTLLMVMMWTAVLPPENNPILDDHIIYALVLIGL
FT                   ALVKAGDTLGLGAMWERTALVRRFPILK"
FT   gene            566063..566512
FT                   /locus_tag="Tcur_0503"
FT   CDS_pept        566063..566512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96100"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96100.1"
FT                   /translation="MKAFPFSTLARDRNEVFAELDDADVLLERRDAENVWLVRDERYRA
FT                   ARDALVTLARSMTIVARANRVLAEKALAEDLPWLVWLPEGERRQCVRELLAHLLAGADT
FT                   GELLPYARARRSWMSTALAWSDPETARVLSDPFDGTGGRPLDNGA"
FT   gene            complement(566706..568100)
FT                   /locus_tag="Tcur_0504"
FT   CDS_pept        complement(566706..568100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0504"
FT                   /product="acyltransferase, WS/DGAT/MGAT"
FT                   /note="TIGRFAM: acyltransferase, WS/DGAT/MGAT; PFAM:
FT                   protein of unknown function UPF0089; KEGG: maq:Maqu_3067
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96101"
FT                   /db_xref="GOA:D1A3H6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H6"
FT                   /inference="protein motif:TFAM:TIGR02946"
FT                   /protein_id="ACY96101.1"
FT                   /translation="MERMNTLDAGFYFADSEQAPLHIASITVLEGPPPSREEMLGVLTA
FT                   KLPKVPRYRQRVRTVPLNLDLPVWVDDPRFRLSYHLRHTALPSPGGRQELQNLVGRIMS
FT                   QRLDPTRPLWEMWVVEGLAGGQWALIAKVHHCVVDGVGGSDLLTALFDLEPLPAPAAAR
FT                   PPGPGEESAPSRLALAINGLGQSVAVPAGALARRLTRLPALGRPDRLREAREFTEGLPQ
FT                   TVQHITRPPVPSLRGPTGPHRRWIALQTELDRVKAVRRELGCTVNDIILAAVTCGFREL
FT                   LGARGELEDDTTVRSLVPVSVRTDGQAGELGNRVSALVVELPCGERDPIVRVAQLHGQM
FT                   AQLKQTHQAAGADALVRLAGTAPTMLSLASRAVITVMRTMFQTVTTNVPGPQFPLYIAG
FT                   RRVTALYPYVPIAAGAGISTGIFSYMGHLCFGVTGDFDTTPDLQTFVNGIATGLDELAA
FT                   AIPNGR"
FT   gene            568233..570896
FT                   /locus_tag="Tcur_0505"
FT   CDS_pept        568233..570896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0505"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; GCN5-related N-
FT                   acetyltransferase; KEGG: pol:Bpro_1205 CoA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96102"
FT                   /db_xref="GOA:D1A3H7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H7"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACY96102.1"
FT                   /translation="MTTQVHLDVTSAEPVSALLKDGVQIQIRPLTGADREQVRALHAGL
FT                   SPESRYLRFFTIDPGMADRAAWQLCRPPGPDHAALGAWLHGELIGVAGYEPTEEDGVAD
FT                   LAVVVADWMRHRGVGTLLLEHLGSLARSRGVRCFRADTLARNEAMLRVLADTGMSVRRT
FT                   DRADLVEVEIPLEQSEEYLEAVGRRERLATVESLWPLLRPASAVVVGASRRRRSVGNAL
FT                   LRRLHAAAAFPVYAVNPRAGRELEGVRCVPSVAELPEPPDLAVLTVPAHIVPQAAEECG
FT                   RRGARALVVISSGLTEPQARRLLEACHRYGMRLVGPNCIGVADPGAGLDATFTPRDPRP
FT                   GTAGVVVQSGGVGIALQDHLSRLGIGISSFASVGDKLDVSANDMLMWWESDGVTRLGVL
FT                   HLESFGNPRKFARTARRVGRKMPLLTVIAGRSQAGRRAAASHTAAVATPEVTRRALFAQ
FT                   AGIVATDDLGELVDAAALLAHQPYPRGSKVAIVTNAGGAGVLAADACTERGLIVAELSA
FT                   STRRRLRQLLPEGASLDNPVDATAAVPPRAFRAALAAVAADEGVDAVMAVAVPTAVGRP
FT                   AAVAGCGGKPLVAVTLGQAETVTVNRDGVPSYAYPENAAAALAHAASYGRRRSRPQGTE
FT                   PVFTDLDRERADRIVGGFLKRCPDGGWLPPDQAMELLEAYRLPMAPWRWARTEEEAVAA
FT                   ARKLGGSVALKAHAAGVVHKTEAGALRLGLSGEAEVRRAHRELAERFGDALEGVLVQAM
FT                   VGERADDGVEVLAGVIQEQIFGPVVVLGLGGVATEVLGDRCARMAPLTDVDAEELIDGL
FT                   RAAPLLRGHRGRPPADLPALREALLRLSRLAADRPEIAELDLNPLIARPDGVVAVDARI
FT                   RLVPNRPWDPFLRRLR"
FT   gene            570984..571961
FT                   /locus_tag="Tcur_0506"
FT   CDS_pept        570984..571961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0506"
FT                   /product="poly-gamma-glutamate biosynthesis protein"
FT                   /note="KEGG: gur:Gura_2950 poly-gamma-glutamate
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96103"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H8"
FT                   /inference="similar to AA sequence:KEGG:Gura_2950"
FT                   /protein_id="ACY96103.1"
FT                   /translation="MSITLALAGDAMLGRDVAKRLGVAASHDLFSTAVRDWFATADLAV
FT                   LNLECCISERGAPWRSPGKLFHFRAPAKAAQALAWLGIDCVTLANNHALDFGPDALLDT
FT                   CEHLQNAGIETVGAGPDAEHARAGVILQARGMRLGVLGLTDHPADMAAGPDRPGVAYAD
FT                   LSCGVPDWVRERIADLRARCDAVLVTPHWGPNMTAEPLPYVRRAARQLLEAGATLVAGH
FT                   SAHVFHGVDGPILYDLGDFIDDYAVDAQLHNDLGLLWLVTLDAAGPREITAVPLALDYC
FT                   RTRLAVEHERAWIRDRLRAASAEFGTPVEERDGVLTMRVAVPAR"
FT   gene            572101..573006
FT                   /locus_tag="Tcur_0507"
FT   CDS_pept        572101..573006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0507"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4412 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96104"
FT                   /db_xref="GOA:D1A3H9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H9"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACY96104.1"
FT                   /translation="MRIGIVLNEPSGPDALHRLRDELRRAADDGFASAWVTQIFGVDAL
FT                   TALAVAGSQVPGIEVGTSVVPTYPRHPAVLAQQALTAALALDGRLTLGIGLSHQVVIEA
FT                   MYGLDYSRPLKHMSEYLSVLLPLLDGEPAQFTGETLAGNITLSTPRTGRVPVVVAALGP
FT                   RMLKLAGSRTDGTVTWMTGPVTLRDHIVPTIIAAAQEAGRPAPRVVAILPVCVTDDVDA
FT                   ARQRAAKVYQVYGTLPSYRAMLEREGVAAPEDVAIIGDEDTVGARIRALADYGVTDFVA
FT                   GDFSKGKDSERTRALLTSLL"
FT   gene            complement(572927..573868)
FT                   /locus_tag="Tcur_0508"
FT   CDS_pept        complement(572927..573868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0508"
FT                   /product="rRNA (adenine-N(6)-)-methyltransferase"
FT                   /note="KEGG: xac:XAC0863 dimethyladenosine transferase;
FT                   PFAM: ribosomal RNA adenine methylase transferase; SMART:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96105"
FT                   /db_xref="GOA:D1A3I0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I0"
FT                   /inference="protein motif:PRIAM:2.1.1.48"
FT                   /protein_id="ACY96105.1"
FT                   /translation="MQRRRGSRTSARTGRDWTRRSLSQNFLADPAAIGRYVRVVTRDLP
FT                   GGALVVEVGAGDGRITRALAAHAGAVIAYEIDPVLAGRLHAACRPLGNVRCVPGDFLSA
FT                   RPPARPFHLTGSIPYAATSRIMDWALAAPSLASATLITQLEYALKRTGGYRRWSRLTVL
FT                   TWPVFTWRLAGRIDRRAFRPVPRVDSAILRIERRERPLLPPGLPAGYRRCVEIGFGGRG
FT                   GTLHASLRGAYPRSRVDAAFEAAGLGRDTVVAYVHPDQWVRLFKALRGPGRRPSPAAPG
FT                   DGLRQGLTAGRSAAPWCARCPCPWRSRRRRSR"
FT   gene            574656..575519
FT                   /locus_tag="Tcur_0509"
FT   CDS_pept        574656..575519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0509"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   met:M446_3650 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96106"
FT                   /db_xref="GOA:D1A3I1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I1"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACY96106.1"
FT                   /translation="MTERSRRPRPAAVRPKRHVRRWRAVRAGAAALAAVTVLATGGCGS
FT                   GGGSGGGSGGEQRPQAEPSVAVDLAKLPRATTFTTLRGLPQDPAPSAATDGTVVRPNAA
FT                   LPVSAQPGGPPVAALPDRQLDGPTWVPVVETRGEWLRVLLPSRPNGVTGWIRRDESALT
FT                   VAHTPYLVTVDRQERRLTLLRSGRQVGSWTVAVGADETPTPAGRTFLLALLKPSHATYG
FT                   PLVIPVGAHSQTLETFGGGPGTVAFHGWRDASVFGKAVTHGCIRVPDEALDRLSKVPLG
FT                   TPVLVT"
FT   sig_peptide     574656..574775
FT                   /locus_tag="Tcur_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.354 at
FT                   residue 40"
FT   gene            575595..576260
FT                   /locus_tag="Tcur_0510"
FT   CDS_pept        575595..576260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96107"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96107.1"
FT                   /translation="MSSAARSAVITGVLAAPLIVAAAPISYADPGGHGSAYGLTADGLV
FT                   NLPATPSVSSSGNGPTRQSVTRLPDNPLVDASALETSARGRHGHARVSDLEVAKALLRA
FT                   ETVSARCHAGKGSSYLGNARIAGRPLAVSPPPNSTLRVPIKGVGDASLILNRQERTANG
FT                   GVTVTAMQLNLPGVHGKGQQLNVASVTCEPKPAKPQPKPAKPEAPKPTPVPRDLPVTG"
FT   sig_peptide     575595..575681
FT                   /locus_tag="Tcur_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.650 at
FT                   residue 29"
FT   gene            complement(576337..577014)
FT                   /locus_tag="Tcur_0511"
FT   CDS_pept        complement(576337..577014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0511"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bmj:BMULJ_04575
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96108"
FT                   /db_xref="GOA:D1A3I3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96108.1"
FT                   /translation="MSKATADGGRARRVRKEPDERRDQILRCARELFSKHPYEAVSSAQ
FT                   IADAAGVSRGLLNHYFGTKRGLYLAAVRQMLSVPPPPVPAFVAGATVRDRVAQALDAWL
FT                   ELLERNRGTWITALDMMASGGDRELGRILDEARDRAVARVTEIVGLTPLAAEHPEVLSA
FT                   LRGFAGMAMDTSREWLKYGRLTRAQVHMLLEQTILHLTEHLIPRLVAEADRPAAAEASP
FT                   SSV"
FT   gene            complement(577307..578179)
FT                   /locus_tag="Tcur_0512"
FT   CDS_pept        complement(577307..578179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96109"
FT                   /db_xref="GOA:D1A3I4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96109.1"
FT                   /translation="MTTKTDTPQQEPNPSISWLGDDTAPASARPAGDAAEQTPAEPAAE
FT                   ESAGQSKPPSTGKDGSAAADAASPEATGPDDAEPAVKTVQAKRAADGGGKRRRPTAGML
FT                   LKAAVAVALVASTVTAGLQWHRAETLAAEQEARRQVRERAGQFGVALLSYRHNDLKAAR
FT                   EKVMSMASADFAKTYDVAFTGGLEGVITQLKADATATVSDVYVSELSDTTAKAIVVLDS
FT                   EVRSSAGTRRVVGSYLEMDLVLQKGEWMITDVSSIGALDEQMTDTGGGKDSGKGDRSRA
FT                   AEPSASPRQ"
FT   gene            complement(578196..579488)
FT                   /locus_tag="Tcur_0513"
FT   CDS_pept        complement(578196..579488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0513"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   afw:Anae109_1978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96110"
FT                   /db_xref="GOA:D1A3I5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I5"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96110.1"
FT                   /translation="MNHQRRIVINLVFFAALGVVLAIWAVTSIIDIDALRRPVPVTAEF
FT                   DSSPGLSPDLEVTHLGVRVGKIGEVRLKPGSVHVRIDLDRDARVPSTVGARVMRKSAIG
FT                   EPHIELTAPPPSSAEPRPLRAGDHIPLSRTTGTADYQKLFGTLGDTLKAVDPRDAQTLV
FT                   HELATGLEGRQDSLRDAIADTHRLTGALAGEAGTLDALSAQVTRLTGTLAGRRSQIASG
FT                   VHDLALVSTQIRRSRRDLETVLDEGPDFLTQVHRLLEEARPGLGCLLTAAGAPSEPLFT
FT                   PANEAKIHHVLTMVPTLRALVSDITVVESGARWARIMPVLTIAGPDQAAEFAKPRPKPK
FT                   AKPLNVCPATPGASSRQAGAFAAGGKAGTAGGSLSEQGATALRKTAGEQGAEPSPPART
FT                   AHLLPPLVAALILIMVAARFLRTVIRRRPGR"
FT   sig_peptide     complement(579411..579488)
FT                   /locus_tag="Tcur_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.825 at
FT                   residue 26"
FT   gene            complement(579485..580507)
FT                   /locus_tag="Tcur_0514"
FT   CDS_pept        complement(579485..580507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0514"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   ftm:FTM_0312 ABC transporter, periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96111"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I6"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96111.1"
FT                   /translation="MRRSAAVATALAVTLAAGGTGCSVQTAGAPKGGMTLSATFEDVQT
FT                   LTTGHSVQISDVKVGTVTKIELSGYRALVTMSLEKGRRIPTGTTATISRTSLLGENYVR
FT                   LDPPPGRDLSTGPFLPDGAHLSATSVQPDLEQITERVGPLLAAISGQNLQTITSEGATA
FT                   VSGKGKQLNTLIKKAAQVTDSYAAANADLARALDALAELGGTLEGGRDRLDKLPGNLQL
FT                   ATQRLKNERAQLKRSVQELLKLARSINDNVHLRHGKRLEAVLRRAEELIDAAVRGREQL
FT                   KALTLSILKLLKGPSVSYSGQALVMVWLKGFLPPAGGASASQGRADSGGPLRDLLEPRS
FT                   "
FT   sig_peptide     complement(580427..580507)
FT                   /locus_tag="Tcur_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.623 at
FT                   residue 27"
FT   gene            complement(580504..581532)
FT                   /locus_tag="Tcur_0515"
FT   CDS_pept        complement(580504..581532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0515"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   sat:SYN_00409 ABC-type transport system involved in
FT                   resistance to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96112"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I7"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96112.1"
FT                   /translation="MRRVIAALAALTMAAATGGCSVIDGGGTYRVTVYFSKAPSLYERS
FT                   QVKVMGIPAGTITDIRHEGGRVRVELDIDEEVPLPAGVHATIMSANALGERFIQLHPAW
FT                   KKGEPKARPGTVIPIERTELPVEIDDALDAFGKLGDSIDPKSLGDSIASGADGLRGKGG
FT                   DINRALQATATLTSDLAAQDERLVKLARELRSLATTLNEREKRLTELIDSFSATSRQLA
FT                   EERAELQRFIVGLAQAIRKSDVLITSLRETLPGTVADMSNIIMTLKANAGTLNQTIEAL
FT                   AEFTDVAVQAWDRERHVATVRVVVHGTVRVWLQPLFDALGWGTVPCLPDKQLGNCTEGE
FT                   GP"
FT   sig_peptide     complement(581464..581532)
FT                   /locus_tag="Tcur_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.353 at
FT                   residue 23"
FT   gene            complement(581529..582566)
FT                   /locus_tag="Tcur_0516"
FT   CDS_pept        complement(581529..582566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0516"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   gsu:GSU1899 virulence factor Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96113"
FT                   /db_xref="GOA:D1A3I8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I8"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96113.1"
FT                   /translation="MALKSFRDRNRIAVGLVSAGTLIALVVSVYLIGTEGLLLRRYTMS
FT                   GVFADSGGLRAGDQVRVAGVDVGEVTEVKPDYDNGRVIVTWKVDSDVDLGVGTRAEIKV
FT                   SNVLGGRYLRLSGPVGPRRMADLPEERRRIPIERTSVPHTVNDMLKSSTEAINKLDTKS
FT                   IRTIVEELGGIGERDRDRLSRALTNLTELAETVNESSPRIRELLDNGERLVHLARTKEQ
FT                   QLIALMNNVRALLEELRLRRAELSAFLGGGNATVNAMTTLIDRQQAKLTQIMEDLQVTL
FT                   AGLRPANDELNELLAWAGPTLGGLAAAGSKGPWIELLATGLGPISPKDLGDLARRLPRQ
FT                   QGGTR"
FT   sig_peptide     complement(582465..582566)
FT                   /locus_tag="Tcur_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.394 at
FT                   residue 34"
FT   gene            complement(582566..583633)
FT                   /locus_tag="Tcur_0517"
FT   CDS_pept        complement(582566..583633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0517"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   nis:NIS_1335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96114"
FT                   /db_xref="GOA:D1A3I9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I9"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96114.1"
FT                   /translation="MADVPSQIRGRSTLLIKLIVYVAVTGLLTAFIGAQIAKVSLSGGW
FT                   SLSATFDDASGLARGDQVKIAGAPVGRVDEVKVVDGKARVKMTVRDSVKIPADSTAAIR
FT                   WRDAMGQRVVYLIPGSSTTMMRPGAHISRTKSVVDGGELVNQLVPLTESLSGEQVNRLL
FT                   VSLAQAVDGNAADIDRLIGDIELLSATLSRRRESLKQMIDDYATVSEIIARRDKQIASV
FT                   VDDLVTLSEAFTDNRKLIDDTLVELAAMARTSDAVLARNTAQLEQVIAKLAVFSSGVRR
FT                   NYRSVQQVMELTKPKLERIFAAADNGEYLEVAIPCLTLVAPPCPYPTRLPGPREGVGKV
FT                   DTLPKLQRLMVGGGD"
FT   gene            complement(583635..584648)
FT                   /locus_tag="Tcur_0518"
FT   CDS_pept        complement(583635..584648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0518"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   gme:Gmet_0786 virulence factor MCE-like protein-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96115"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J0"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96115.1"
FT                   /translation="MNGEMSLRRKLVITAITLATAAALLHVLLARPFADPGTRLVAEFG
FT                   RAGQGLGDNAPVKIRGMDVGKVTKVELTAAGRVRVTMHIDRKVRVPDTVTAAIEPTSVF
FT                   GPKFVNLKPGPHEHSGPFLASGATITRTADPRDLSDLLGDAGATLAAVDPDEVATIINT
FT                   LAQGLDGQGRKLRQTIDSTGVLLNVAHRNRGNARRFLADGADLAETAAASGGDLLTIVS
FT                   DANTLISETAAGGEDRVGRFADGLSQVSALAAGGFDRRSGQLGEGFRSGERAVAILYSQ
FT                   LGLLGDGVRAANQILPAYGELTSVPGVGGKNYLNAHGWLPGSPCELIIGLCGRGGR"
FT   sig_peptide     complement(584556..584648)
FT                   /locus_tag="Tcur_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.622 at
FT                   residue 31"
FT   gene            complement(584645..585511)
FT                   /locus_tag="Tcur_0519"
FT   CDS_pept        complement(584645..585511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0519"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   wsu:WS1969 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96116"
FT                   /db_xref="GOA:D1A3J1"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J1"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACY96116.1"
FT                   /translation="MSGIITPTRAVRGGARMASTAVHRTADLAGWPVFILRVIVHIAVD
FT                   LIWRRKYGKVVARQVSDVVVGAGATVVGGGMVFVIFTMSFFVGTEIGLQGYTGLRSIGA
FT                   ESFMGLVGSFANVREITPVIAAVALAAQCGSAFTAELGAMRISEEIDALEVMGISSFTY
FT                   LVCTRVLAALIALVPLYLIALFASFFSTRLITTQFFGLAPGVYDYYFQLYLPMIDLVYS
FT                   SIKVAVFAFAVIAIHCYYGYYATGGPAGVGRATGRAIRLSIIVIVTLNLLLSYLFWGNG
FT                   ETVRLTG"
FT   gene            complement(585508..586296)
FT                   /locus_tag="Tcur_0520"
FT   CDS_pept        complement(585508..586296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0520"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   dvl:Dvul_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96117"
FT                   /db_xref="GOA:D1A3J2"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J2"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACY96117.1"
FT                   /translation="MVMAQVPVRIHGLLNQVGELFVVALEGLRRTWDVRTWFWEFVEQC
FT                   WFLARVTSIPVILVALPLGATVALQVGQVAAQLGAQSATGGAVIVGLVREVAPIAAAMI
FT                   IAGAGGSAMTADMGTRRIRDELDAMEVMAINPIHRLVTPRLWAASLISTLLVSLVVLSG
FT                   AAGGFVFNVLLQDVTPGAYFDGATSLLQTSDLVVTLLKAWLFGMIAGIVACYMGMNCAS
FT                   TPVGVGRAVNQAIVVAFLLVFALNYVITTVYFIAYPPKIG"
FT   gene            586825..587028
FT                   /locus_tag="Tcur_0521"
FT   CDS_pept        586825..587028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0521"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: mxa:MXAN_1617 cold-shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96118"
FT                   /db_xref="GOA:D1A3J3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACY96118.1"
FT                   /translation="MAQGTVKWFNPDKGFGFISPDDGSADIFVHHSAIQMRGFRTLVEE
FT                   QRVEYTAVQGPKGLQADVVRAL"
FT   gene            587197..588885
FT                   /locus_tag="Tcur_0522"
FT   CDS_pept        587197..588885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0522"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; DbpA RNA-binding domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; KEGG:
FT                   scl:sce0700 ATP-independent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96119"
FT                   /db_xref="GOA:D1A3J4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J4"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACY96119.1"
FT                   /translation="MTITTTGETTGFADLQLRPELLTALAGLGYEEPTPIQREAIPHLL
FT                   AGRDLLGQAATGTGKTAAFALPILHRTPRPADEPDPGALVLVPTRELAVQVADAFHRYG
FT                   REMGVRVLPVYGGAPIGRQIQVLKRGVDVVVATPGRALDLIDRDVLRLARLRTVVLDEA
FT                   DEMLDMGFAEDIEAILAQTPPQRQTVLFSATVPPRIDGIARRHLREPVRIEIARPEREV
FT                   GRPPLVRQRAYVVDRAHKPAALGRLLDVEAPTAAIVFCRTRDQVDELTEMLNGRGYRAE
FT                   ALHGGMSQDQRDRVMGRLRAGTAELLIATDVAARGIDVEHLTHVVNYHVPSDPDSYVHR
FT                   IGRVGRAGREGVAFTLAEPREHRMLKSIERATGHKITIEKIPTVADLRARRLELTRAAL
FT                   RESLLTDDLEPYRVVVETLSDEFDVMEVAMAAVKLAQEAGGAAGDEEEIPEVAHRPPRE
FT                   GRDGGPRRERRAAGPPPEGMTRLFLGVGRRAGVRPQDLVGAIAGESSLRGRDIGAIEIA
FT                   DRFSLVEVPEHAADEVIDALRRTTIKGRKTIVRRERQNPGQRRPR"
FT   gene            589022..589450
FT                   /locus_tag="Tcur_0523"
FT   CDS_pept        589022..589450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96120"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96120.1"
FT                   /translation="MTPFMVAVAQTCQAPDEAGRPRTVPSEPRSVSVGTERQVAVRSLA
FT                   EQLVCEANAVLADFGEHIVLEDDTGAGVLGFVLSIRDRRAQVRTTYADGVARARLHWSV
FT                   PGEAEQAGPAIELAGPDDVADLILRLLAGVAGPDARHP"
FT   gene            589462..590490
FT                   /locus_tag="Tcur_0524"
FT   CDS_pept        589462..590490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0524"
FT                   /product="Phenol 2-monooxygenase"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; KEGG:
FT                   reh:H16_B0540 phenol hydroxylase P1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96121"
FT                   /db_xref="GOA:D1A3J6"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J6"
FT                   /inference="protein motif:PRIAM:1.14.13.7"
FT                   /protein_id="ACY96121.1"
FT                   /translation="MQYELRTQVIEPVRATYTPLVERRGDRPASRYEEGTVDLQATEHF
FT                   HYRPLWDPAHELYDPGYSVLKLTDPYSFADPRQYYYAPYVTARAQMFDAFSRTLDYIDD
FT                   HGLFGRMAQEWRDLMIAALLPIRHYEGGAQLISAEGARFAYGTSVEQCLSYAAFDRIGN
FT                   AQMLSRVGLALGEGDTGPLTEARQSWLERAELQPLRRYVEELLVERDWAVSAFALDLAD
FT                   RLLYPLLYRHLDNAALAAGQSALSLVAQHLHAWFTDHRKWVDALVAAWTGDSEHGAANT
FT                   EALAAIVRRRLPQAVSAVANLAAAADAAVDTGARAAAEEQAERLRADLAAAGIPTQHKE
FT                   QA"
FT   gene            590487..590792
FT                   /locus_tag="Tcur_0525"
FT   CDS_pept        590487..590792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0525"
FT                   /product="monooxygenase component MmoB/DmpM"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   reu:Reut_B5682 monooxygenase component MmoB/DmpM"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96122"
FT                   /db_xref="GOA:D1A3J7"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J7"
FT                   /inference="protein motif:PFAM:PF02406"
FT                   /protein_id="ACY96122.1"
FT                   /translation="MTGTAPATGRPRTVGVDLQQNNEETRYVVEAIAKDNPDATIRHLP
FT                   GLIKIQTPGTLVIRRETVEELLGRPWETHEFQLSIVSYYGHVDEWDDDQIVIKWSH"
FT   gene            590798..592306
FT                   /locus_tag="Tcur_0526"
FT   CDS_pept        590798..592306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0526"
FT                   /product="methane/phenol/toluene hydroxylase"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; YHS domain
FT                   protein; KEGG: reu:Reut_A1702 methane/phenol/toluene
FT                   hydroxylase:YHS"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96123"
FT                   /db_xref="GOA:D1A3J8"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J8"
FT                   /inference="protein motif:PFAM:PF02332"
FT                   /protein_id="ACY96123.1"
FT                   /translation="MAKRLPLKQRYAALTRDVHWEPTYVPAEEVFPYTRFEGIKIHDWS
FT                   QWEDPFRLTVDAYHKYQAEKDRRLYAVLDGFAQSQGHLSLSDARYLNSMKLFLQGVTPL
FT                   EYQAHRHFAFLARYLDGAGPRFAALCQSIDELRHAQTQIHTLSGYNRYYSGFHSFAKMH
FT                   DRVWYLSVPKSFFDDALSAGPFEFLIAISFSFEYLLTNLLFVPFMSGASFNGDLPSMTF
FT                   GFSAQSDESRHMTLGLEAIKFLLEQDEGNVPIIQDWIDKWFWRGYRLASLVAAMMDYML
FT                   PRKVMSWKEAFELYFEEQMLGGLFPDLAYYGIQPPRHVGQAVEEKELISHQVYWVLYQF
FT                   SFAAAFTTTVPEPEEMRWLSEQYPKTFDRYYAPLWERARKIQQEGGRFFFQGLPQLCQV
FT                   CQIPMTFTEPGDPTRICQRHSIYRGERFDFCSDGCKWIFDREPEKYVQAWLPVHQIHQG
FT                   NCGGPTVPEVLEWYGITDGDNGEYLGSRDHDNWLRWHATAGAKG"
FT   gene            592310..592633
FT                   /locus_tag="Tcur_0527"
FT   CDS_pept        592310..592633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0527"
FT                   /product="phenol hydroxylase subunit P4"
FT                   /note="KEGG: avn:Avin_08820 phenol hydroxylase subunit P4"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96124"
FT                   /db_xref="GOA:D1A3J9"
FT                   /db_xref="InterPro:IPR006756"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J9"
FT                   /inference="similar to AA sequence:KEGG:Avin_08820"
FT                   /protein_id="ACY96124.1"
FT                   /translation="MPVRAITEDYDFPSRSRAELYGDDQLVHVLWRGNMMFCSAACFRA
FT                   PKAMTWGDFLTQMVDPWASSDPDYLPGSPRKWVLDGREFTPEADRTLAELGVGHKSLLE
FT                   FEV"
FT   gene            592635..592982
FT                   /locus_tag="Tcur_0528"
FT   CDS_pept        592635..592982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0528"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: pmy:Pmen_0311
FT                   CDP-6-deoxy-delta-3,4-glucoseen reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96125"
FT                   /db_xref="GOA:D1A3K0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K0"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACY96125.1"
FT                   /translation="MAEVTVRPAGIRLALRPGETILAGLHRAGYTYRIGCRRGGCGICK
FT                   AEVVDGEVTHRGAVADEALPPEPECLTCRAVPVSDVVIHLPDDARLRCVAPLLAGIAGV
FT                   STTPPSTKGER"
FT   gene            592982..593896
FT                   /locus_tag="Tcur_0529"
FT   CDS_pept        592982..593896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0529"
FT                   /product="catechol 2,3 dioxygenase"
FT                   /EC_number="1.13.11.2"
FT                   /note="KEGG: bur:Bcep18194_B2964 catechol 2,3-dioxygenase;
FT                   TIGRFAM: catechol 2,3 dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96126"
FT                   /db_xref="GOA:D1A3K1"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K1"
FT                   /inference="protein motif:TFAM:TIGR03211"
FT                   /protein_id="ACY96126.1"
FT                   /translation="MGVMRLGYVHAKVTDLEEAKAHYGGTLGMRLVHEEDGRVYYKAWD
FT                   EYDHHSVVLEAGGVGLTKLGYKVARSEDLEDFERRAQAFGCTTERMSKGDNLAVGDGVR
FT                   IFLPSEHVLELYADIEVTGTETGTVNPDPFPAHLVGVGVPRIDHALLTCEDVGLLERFF
FT                   TECLDFGVAERAVTELGENGKTIGTWMFCTNTPHDIAFIEGANGKLHHFAYYLNDWNDI
FT                   LHAGDLFSMNDVSVDIGPTRHGITRGTTIYFFDPAGNRNEVFSGGYITYPDFPTITWTA
FT                   DQLGKGIFYIDRELNDRFTTVVT"
FT   gene            594029..595087
FT                   /locus_tag="Tcur_0530"
FT   CDS_pept        594029..595087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0530"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; KEGG: ppg:PputGB1_3306 oxidoreductase
FT                   FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96127"
FT                   /db_xref="GOA:D1A3K2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K2"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACY96127.1"
FT                   /translation="MPKTHRVTVEPVGQELECREDQTILDACLRAGIWLPHACTHGTCG
FT                   TCKAEVLEGEVDHGEASAFALMDFERDEGRTLLCCARPRSDVVIEGDVDLEPGVTTYPV
FT                   QDFTGTVAAVEDCALDTRRVLIDLDRPIAFNPGQYISLRLPDGRGDRSYSMANPPSRPD
FT                   RIELNIRRTPGGAATDGWVFKTLRAGDQVALSGPYGRFFWRPERTEPAVLIAGGTGLAP
FT                   LKSMIRHVLDSGAERRMVLFHGGRTQAHMYDVEYLRALEDEHADRFRYVPCLSEESAPG
FT                   YRHGLVTDVMAADTDTYRGHVAYVCGPPPMVEAAIKTLMSKRLFPRDIYREDFYDTADK
FT                   AGRGVRSPLMRR"
FT   gene            595093..595914
FT                   /locus_tag="Tcur_0531"
FT   CDS_pept        595093..595914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0531"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: dar:Daro_3786
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96128"
FT                   /db_xref="GOA:D1A3K3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K3"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY96128.1"
FT                   /translation="MEEPEIGRTVVANGIRTNYLEAGSGEPVILIHGSGPGVTAYANWR
FT                   LTLPALGARLRALAPDMVGFGHTERPPGQRYGVEVWADQILGFMDALSLPRASLVGNSF
FT                   GGAIALRVAARHPDRVHRLVLMGSAGVPFPITPGLDAVWGYEPSLEAMRRLLDIFAYSR
FT                   ELVTDELAEVRYRASIRPGFQESFRAMFPAPRQRWVDALVTPEEELKALPHRTLLVHGR
FT                   DDRVIPLETSLRLLHLIEDSRLHVFGRCGHWTQIEHAAEFNRLVLEFLTDD"
FT   gene            complement(595964..596725)
FT                   /locus_tag="Tcur_0532"
FT   CDS_pept        complement(595964..596725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0532"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   mpt:Mpe_A3670 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96129"
FT                   /db_xref="GOA:D1A3K4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K4"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACY96129.1"
FT                   /translation="MCAAQRNEAAPTVIARAAALLSAFGPGDDVLGVSELARRTGLAKS
FT                   TVYRLTRELVRSGLLERSGTGLRLGLRLFELGQRVPRQRDLRSAALPFMEDLREATRQI
FT                   VHLAVLDGTEMVYLEILRSPDAPAPPSRVGGRLPAHATGVGKAALAFSPPEVTDAVIAA
FT                   GLRRLTRRTIVQPGLLRQELETIRQQGCAFDREESADGVVCAACPVFGPDGTVAGALSI
FT                   SGWSARMNLDRVAPAVRTAALALSRKLRESR"
FT   gene            596877..597620
FT                   /locus_tag="Tcur_0533"
FT   CDS_pept        596877..597620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0533"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   oca:OCAR_6782 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96130"
FT                   /db_xref="GOA:D1A3K5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K5"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACY96130.1"
FT                   /translation="MDGGLRSVLRALDLLDCFLTEDELGVADIARRLGVAKSTAHRLLT
FT                   TLCARGFAEQNPQTGHYRLGFHLYELGQLAVSRTDLHQAALPLLEELRERTGCTIHLAV
FT                   PDGPEIIYLERLHSLRGMRLFHGVSRRLPAHCTSSGKVIAAFDPAVARARAAAGFTRLT
FT                   SRSIPDAARFDRELAKVRRVGYAVNSDEAKHGLTSVAAPVRDHTGRARAAISLVGPTAE
FT                   VLGSVERHARLAGAAAHRLSRILCL"
FT   gene            597729..598532
FT                   /locus_tag="Tcur_0534"
FT   CDS_pept        597729..598532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0534"
FT                   /product="2-oxopent-4-enoate hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   reu:Reut_B5691 4-oxalocrotonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96131"
FT                   /db_xref="GOA:D1A3K6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K6"
FT                   /inference="protein motif:PRIAM:4.2.1.80"
FT                   /protein_id="ACY96131.1"
FT                   /translation="MDATTRRLVAEELLTAYRTGVPVEPPTEKFPDMTVQDAYAVQLLQ
FT                   VERWRADGARVKGHKVGLSSAAMQRQLGVDQPDYGHLMDSMFLLEGTPIPAGRFLQPKV
FT                   EPEVAFVLRAPLAGPGVTVAEAAAAVDFVLPALEIIDSRVRDWRIALPDTIADNASSGG
FT                   VVLGGRPVRLEELDLRLVGCVLQRNGEVAATGAGGAVLGSPLNALVWLANTVGPLGVVL
FT                   EAGHVVLPGSVTPAIEVRPGQTVTASFGCGLGKVTAVFADAEGER"
FT   gene            598532..599443
FT                   /locus_tag="Tcur_0535"
FT   CDS_pept        598532..599443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0535"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /EC_number="1.2.1.10"
FT                   /note="KEGG: reh:H16_B0596 acetaldehyde dehydrogenase
FT                   (acetylating); TIGRFAM: acetaldehyde dehydrogenase
FT                   (acetylating); PFAM: Acetaldehyde dehydrogenase;
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96132"
FT                   /db_xref="GOA:D1A3K7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:4LRS"
FT                   /db_xref="PDB:4LRT"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K7"
FT                   /inference="protein motif:TFAM:TIGR03215"
FT                   /protein_id="ACY96132.1"
FT                   /translation="MGKAVAAIVGPGNIGTDLLIKLQRSEHIEVRYMVGVDPASEGLAR
FT                   ARKLGVEASAEGVDWLLEQDELPDLVFEATSAKAHLANAPRYAEAGITAIDLTPAAVGP
FT                   LVCPPVNLTEHLDAPNVNMITCGGQATIPIVHAVSRVVPVAYAEIVAAIASRSAGPGTR
FT                   ANIDEFTETTAAAIEQVGGAARGKAIIILNPVEPPMIMRDTVYCAIPPDADTDAITASI
FT                   EEMVAEVARYVPGYTLRTEPQYDQPRDIWKGMARVAVFLEVRGNGDYLPPWAGNLDIMT
FT                   AAAARVGELLAQAPRPTRAGAR"
FT   gene            599464..600531
FT                   /locus_tag="Tcur_0536"
FT   CDS_pept        599464..600531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0536"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /note="TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein; KEGG: reh:H16_A1807 4-hydroxy-2-oxovalerate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96133"
FT                   /db_xref="GOA:D1A3K8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="PDB:4LRS"
FT                   /db_xref="PDB:4LRT"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K8"
FT                   /inference="protein motif:TFAM:TIGR03217"
FT                   /protein_id="ACY96133.1"
FT                   /translation="MTDQDGATAAPRVRITDSTLRDGSHAMAHQFTEEQVRATVHALDA
FT                   AGVEVIEVSHGDGLGGSSFNYGFSAVDEIDLVAAAVDEAVNAKIAVLLLPGVGTVRDLK
FT                   RAHDAGASVARIATHCTEADVSCQHFAAARELGMETVGFLMLAHRIGPEELARQARIMV
FT                   DAGAQCVYVVDSAGALVLSDVQARVQALVREIGHEAQVGFHGHQNLSLGVANSVLAYQN
FT                   GARQIDGALCALGAGAGNSPTEILAATFERLNIETGVNVQAALAAAEEVVRPYLPRLPW
FT                   ADRAAIVQGYAGVYSSFLLHAERAAERYGVPAHEILQRVGEAGYVGGQEDMIIDIAVQL
FT                   AEERHGRPAPAGGRR"
FT   gene            600528..601310
FT                   /locus_tag="Tcur_0537"
FT   CDS_pept        600528..601310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0537"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   ajs:Ajs_0225 4-oxalocrotonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96134"
FT                   /db_xref="GOA:D1A3K9"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K9"
FT                   /inference="protein motif:PRIAM:4.1.1.77"
FT                   /protein_id="ACY96134.1"
FT                   /translation="MSGWDVYRAAEELLAAERQRRDRGPITEQWPELDLATAYRVQDEL
FT                   VHRKVAAGERIVGVKLGLTSRAKQRRMGVHSPLTAWLTDAMVLPAGEPVPLGELIHPRV
FT                   EPEIVFVLGERLAGPGVTAASALAAVRSVHAGLEIIDSRYTDFRFTLPDVVADNASSAR
FT                   LVVGGRALAPGELDLALEACLLEVDGQVVDSATGAAVQGHPAEALALAANSLAERGLAL
FT                   EAGWLVLTGGMTDAVPLGPGTCVSGHFTHLGSVSVQGG"
FT   gene            601312..601545
FT                   /locus_tag="Tcur_0538"
FT   CDS_pept        601312..601545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0538"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: msl:Msil_1481
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96135"
FT                   /db_xref="GOA:D1A3L0"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L0"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ACY96135.1"
FT                   /translation="MPLVEITLVEGRPPERIRELIHRVHEAVRTSLDAPSPSIRVLVRE
FT                   LPAEHWAAGDVTIAERRAAQGDAPPAPQESEG"
FT   gene            601549..602985
FT                   /locus_tag="Tcur_0539"
FT   CDS_pept        601549..602985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0539"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: ara:Arad_7263
FT                   betaine aldehyde dehydrogenase (BADH) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96136"
FT                   /db_xref="GOA:D1A3L1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L1"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ACY96136.1"
FT                   /translation="MDFYGHVIDGEEVPSADGAEFDSIDPYRREPWARVALGSATDVDR
FT                   AVRAARRAFDEGPWPRMGLAERGAVLHRLADLLERNAEEMGLSDTRDMGKPITQSRDND
FT                   VFRSAANLRFFADHARLSTAETLPMDSGHHAYTRFEPAGVVAAIAPWNYPLMLATWKVA
FT                   PALAWGNTVVLKPAEDSPVSATKLARLALEAGMPPGVLNVVHGRGPDSAGQALTEHPGI
FT                   DRITFTGASSTGRVIARAAAANLVPVSLELGGKGANVVFADADLANAVEWSIKAVYTNT
FT                   GQVCLAGSRIYVQRPIYEEFLARFVAAAEAMVIGDPCDAATQIGPLASEQHYRKVRGYV
FT                   ETVESAGGKILTGGLGDGWTVRPTVVVDMPQTAPHCTEEIFGPLVVISPFDTEQEAVEL
FT                   ANNTRYGLNAMVFTENLHRAHRVSARLRAGTVWVNCFFIRDLRAPFGGVGDSGVGREGG
FT                   SFSREFFTEPKAVIIDVKRD"
FT   gene            603059..604735
FT                   /locus_tag="Tcur_0540"
FT   CDS_pept        603059..604735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0540"
FT                   /product="PEP-utilising protein mobile region"
FT                   /note="PFAM: PEP-utilising protein mobile region; KEGG:
FT                   scl:sce7847 pyruvate, water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96137"
FT                   /db_xref="GOA:D1A3L2"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L2"
FT                   /inference="protein motif:PFAM:PF00391"
FT                   /protein_id="ACY96137.1"
FT                   /translation="MAAAPPADRASVFPAGEPWYPHAPRPTGAGRRGGEPPAVLRPADL
FT                   ERSWHLDFHYPRGVVPLGTALVGDVVAGAQRAARRLRLAESGGLAVRFAGPHVYVGSAP
FT                   AVAVPERERAKARALTRRYPAVFPGRWRAARAALERELDALRRSDPAGLPPAEIGAYLR
FT                   RARAVHAAAWRVHFAFMYRLLSCHEMLRAELAEAGVDEHTLIAVLQSADNRVLEVDRKL
FT                   HALAARARADGLAPLFERDDGPLLPRLAARPAARDWLGAFTGFLAEHGHRADAMSDLTV
FT                   PSWEEDPEQVLSLLRRIILGRVPPPRPPGAPAIPPGLTGRARELLREALRANVVCWNED
FT                   HNLVIEMRAHLPVRAGALALAAATGAPAPDEVLFLFPEEVDQLAAGSADWADLAERTAA
FT                   RRAYYHRWHALRAGLPRLLGTSTGLHDPVVSGVFCADPLRDRTAGPPAVLHGLGVSGGV
FT                   ARGRVRLVRSPDGLPDLRPGEVLVCEATTPTWTPLFGLVAACVCDTGGMLTHAAVISRE
FT                   YGIPCVCDVRTATATLRDGDEVEVDGTRGTVTLLARADRSP"
FT   gene            complement(604761..605915)
FT                   /locus_tag="Tcur_0541"
FT   CDS_pept        complement(604761..605915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0541"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: gme:Gmet_2075
FT                   acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96138"
FT                   /db_xref="GOA:D1A3L3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACY96138.1"
FT                   /translation="MDVLRLDNRLTDEERMIRDTVRAVVAEKVLPHVADWFEAGTFPAR
FT                   ELAPELGKLGLLGMHLKGYGCAGMSAVAYGVACRELEAGDSGLRSFVSVQGSLAMAAIH
FT                   KYGSQEQKQQWLPKMAAGEAIGCFGLTEPDRGSDPGDMRTHARRDGADWVLNGTKMWIT
FT                   NGSVADVAVVWARTDEGIRGFLVPAGTPGFTARDIHRKLSLRASVTSELVLEDVRLPAD
FT                   AVLPGVTGLKGPLSCLSEARYGIVWGAVGAGRACYEAAVAYAKTREQFGRPIGAFQLTQ
FT                   EKLAWMEIALGQAGLTALHLGRLKDEGSLTPQQVSFGKMANVRAALDVARQARTILGAN
FT                   GITLEYPVIRHMNNLESVLTYEGTQEVHTLVLGQAITGISAYRG"
FT   gene            606090..606464
FT                   /locus_tag="Tcur_0542"
FT   CDS_pept        606090..606464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0542"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: cbc:CbuK_0644
FT                   stress-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96139"
FT                   /db_xref="GOA:D1A3L4"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L4"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ACY96139.1"
FT                   /translation="MDKDLRTQTEPTAGGSHADTGQAGPPQPRRLCRTREGRMIAGVCS
FT                   GLGDYLGVDANVLRLLLALFVLLGGSGVALYILGWVLIPEEGKGTSVLQDFIDRNRDNP
FT                   AVQDVIGKAKEGLHKVTSKR"
FT   gene            complement(606520..607866)
FT                   /locus_tag="Tcur_0543"
FT   CDS_pept        complement(606520..607866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0543"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rle:RL3147 putative transmembrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96140"
FT                   /db_xref="GOA:D1A3L5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY96140.1"
FT                   /translation="MDRQTGRHRRPPERQATYREVFAVGEFRALWAAQTFSYIGDQLAQ
FT                   VALAVLVYHRTGSPLLTAVAYALTYLPPIVGGPLLAGLADMFPRRTVMVVCDIVRAALV
FT                   ALMALQVMPFPLLCLLVFSTVLLGAPFTAARAALLPDILDGDRYVAGSAINNITHQTTQ
FT                   MLGFLGGGALVALVGPHGALALDAVTFAVSGLILMVWLQPRPAPRGGRREPLALWRNTR
FT                   DGARLVFGDPVLRSLVLFAWLCAFYVIPEGLAAPYAATYPGSTAVTVGLLMSAMPTGMV
FT                   VGVFVFSRFVRPFDRLRAMGWLSMLACAPLIGSVLHPPLWAVVVLWALSGVGSAYQLAA
FT                   NAAFVAAVPPADRGQAFGLAQSGILAGQGLGILVGGLAAELVGPQTVVALAGVAGLSAA
FT                   TLLTMLWTPVRGDLLDEPPGLAGVPDAPAPPEAAGREGGDGRDTDAVPV"
FT   gene            complement(608047..608397)
FT                   /locus_tag="Tcur_0544"
FT   CDS_pept        complement(608047..608397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0544"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   ank:AnaeK_1469 protein of unknown function DUF1025"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96141"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L6"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACY96141.1"
FT                   /translation="MMGVIELSREEFEGLVADALDTIPPELTRHMDNVVIVVEDEAPEP
FT                   GLLGLYHGVPLTERGDWYGGVLPDHISIYRKEILAICDSVEDVVDEVRLTVVHEIAHHF
FT                   GISDEWLHRHGY"
FT   gene            608424..610058
FT                   /locus_tag="Tcur_0545"
FT   CDS_pept        608424..610058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0545"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: dol:Dole_1743
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96142"
FT                   /db_xref="GOA:D1A3L7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY96142.1"
FT                   /translation="MVFGRFRDRPSGRPAAVARFLRTRLSGAARRRGTGVLLVILVGLA
FT                   GGLIGTLLGGRVETPIGPADVALSIRPSSNGGTTVQIPPLGSLQFDSHWGPLRLEAQVA
FT                   ELHAEPARKLIEDDAALDRLTDQIAGQLRHGVVVLVVRAAVFATVFGFLAGLLVFRNWR
FT                   RALLSTGSALGGLLATCLLAYATFTPQSINEPRYTGLLANAPQVVGDVQSIVARFSEYR
FT                   GQLARLVGNVSRLYAATSTLPTYEPDPSTLRVLHVSDIHLNPAAWDVIRSVSDQFRIEL
FT                   IIDSGDLTDHGSAPEDRFIGDIKKLKIPYVFVRGNHDSKDTQEAVAEHKNAIVLDGETK
FT                   EVAGLRIHGVGDPRFTPDKTTRDDDVTAAQLRALGTRQAQALRASGDAPDLVVVHDPNQ
FT                   GAGFSGVTPLVLSGHTHSRRTELLPTGTRLFVQGSTGGAGLRGLEKEEPTPIELSVLYF
FT                   NRTTKRLQGWDDLRLGGLGLSSAQIERHLEPQPDRPVTQPTPDPTPAATPSRWPSLAPT
FT                   EWPTFSRPATTPTTTPPPASPTPGPSR"
FT   gene            610122..610194
FT                   /locus_tag="Tcur_R0010"
FT                   /note="tRNA-Glu1"
FT   tRNA            610122..610194
FT                   /locus_tag="Tcur_R0010"
FT                   /product="tRNA-Glu"
FT   gene            611351..612631
FT                   /locus_tag="Tcur_0546"
FT   CDS_pept        611351..612631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0546"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   dvm:DvMF_3051 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96143"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L8"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACY96143.1"
FT                   /translation="MRYSRAAFYLDFDNVFGGLFKLDPDVAIQFASNPGVWLQRLSTTL
FT                   TVDAPRRWLVLRCYLNPAGWVDYHPPLGEPSRLQFFRFRSSFISAGFEVIDCPRYNATK
FT                   NGADIRIAVDVVDALSADVTYDEFVIASGDSDMTPLLQRLRRADRRTVVMSSVDAAEAF
FT                   ISIADRTINGQQLLELVQGEPVGVEDDEYDAVAAELDGIGGDHTYAGAVPSDHARAYEY
FT                   FRSVVADKYNNASEPLNMANLAAQLRSELGPVIDETGWFGFGGFARAVESLKLPNLRMS
FT                   KHEIWDESRHSPPADAVATVPRVTLPEPVERLTALINLPRLPQGWWPMIYQTLADYASS
FT                   HQFNLTQCTSWTRDRLREQGFAINRNSVSFVVRGAAFGGCPLYRQPPPTAAEIGEAFVN
FT                   NVLTRVDGEILTEEEIEMVRTWLGGYS"
FT   gene            complement(613104..613250)
FT                   /locus_tag="Tcur_0547"
FT   CDS_pept        complement(613104..613250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96144"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96144.1"
FT                   /translation="MALAFATEGTIAAVGDAVYRPLFDLIIGIVAEGQASGEPTTPLPP
FT                   GSS"
FT   gene            613632..614666
FT                   /locus_tag="Tcur_0548"
FT   CDS_pept        613632..614666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0548"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: rpe:RPE_2412 protein tyrosine/serine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96145"
FT                   /db_xref="GOA:D1A3M0"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M0"
FT                   /inference="protein motif:COG:COG2365"
FT                   /protein_id="ACY96145.1"
FT                   /translation="MGECGLGRLMRAMVVHVEVVGNGRGDLEVSWEPAWDGPVEVAVGP
FT                   SPESIRCDEPVARVEGATRVSLQGLGPGRHYVSVAPVGGAAVVAAERLLRMEGLSNFRD
FT                   LGGYRTADGGRVRWGLVYRSDAPHLLTPADLEVIARLGLRTAYDLRTDEERAHAPSVLP
FT                   EGVRREWIAISGAAAKTEQIVQEVIAGQRTALPGDFLVRVYHAMAETEAAAFGRLLTGL
FT                   AEPGGLPALIHCTAGKDRTGIGAALLLSALGVDERTVLDDYELSAVYYSAPQLEQLRTA
FT                   LAGTGIDVERFRAALDTSRQAMAAVLATLKERHGTIENYLLQEAGVSPDVLAELRARLV
FT                   QRPG"
FT   gene            complement(614695..615813)
FT                   /locus_tag="Tcur_0549"
FT   CDS_pept        complement(614695..615813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0549"
FT                   /product="Cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="PFAM: Cysteinyl-tRNA synthetase class Ia; tRNA
FT                   synthetase class I (M); KEGG: hha:Hhal_0107 cysteinyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96146"
FT                   /db_xref="GOA:D1A3M1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M1"
FT                   /inference="protein motif:PRIAM:6.1.1.16"
FT                   /protein_id="ACY96146.1"
FT                   /translation="MRPDSTVPSLRLGGRPLPAIGHARMYVCGITPYDTTHLGHARTFV
FT                   WADVAARVLRHAGNTVKVCRNVTDVDDVLTRAAQRAGSPYDSFAAVQQYYFEQDMAALG
FT                   VHSVTHQPRAHNYIRETIALAQALLDLGHAYLREGAVYFRGAHVPGQAGLDRQTALDLL
FT                   AEYGDDPEDPRKDDPFDIALWRPSEAGEPAWPSPWSAGRPGWHAECASMALAIFGPALD
FT                   LHAGGADLRFPHHAYESALAEAMTGVRPFARAWLHVGMVSKDGAKMAKSTGNLVFVADL
FT                   LKEHPASVLRLALLSTPWAQEWHYTPGDLSAAAARLDRLHTAAGRPGSSPAADEAVTAA
FT                   LLDDLNVDAALNIAEQEGGRTARTALSVLALE"
FT   gene            complement(615957..617027)
FT                   /locus_tag="Tcur_0550"
FT   CDS_pept        complement(615957..617027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0550"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; methyltransferase
FT                   small; Methyltransferase type 12; KEGG: ara:Arad_8655
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96147"
FT                   /db_xref="GOA:D1A3M2"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACY96147.1"
FT                   /translation="MTTTDRSDALVERLFSAALGALELYSIYLGGELGLYAALAEHGPL
FT                   TAGELADRTGIAPRYAREWLEQQAVAGLLNLAPGSGERRYLLAPDHARVLLHADDLSHV
FT                   APFAHMLAGIGGVLPQVVQAYRTGGGVPYESYGTAFRHGQGRINRPAFTHELPTSWLAA
FT                   LPDVAERINGADRPRIADVGCGQGWSSLALARAFPNAWVDGIDADAASIEDARRHAAEA
FT                   GLDGRLRFRCEDAAELADGPYDLIVILEALHDMARPVDALRAARAALADGGAVLVVDER
FT                   VAEEFTAPGDEVERMMYGWSVTHCLPSQLAEPGSAALGTVLRSSTLRRLAEEAGYSRVQ
FT                   ILDVDNDFFRLYRLNP"
FT   gene            complement(617171..618034)
FT                   /locus_tag="Tcur_0551"
FT   CDS_pept        complement(617171..618034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0551"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   bcs:BCAN_A0116 PhzF family phenazine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96148"
FT                   /db_xref="GOA:D1A3M3"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M3"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ACY96148.1"
FT                   /translation="MDGTRPQVLRYAAFTRDPAGGNPAGVVPDAAGLREEEMLSIAAEV
FT                   GYSETAFLTAPPDGPGRSFTVRYFAPETEVPFCGHATVAAAVALAERIGPGPLEFATRS
FT                   GPVPVEVEQEADGTLRATLTSVEPYVEQVPDQDVSQALAALHWRPDELDPALPPRIAFA
FT                   GARHLVLAAATRARLAALDYDFDALRAFMTARDLTTLHLVWRESKHVFHVRDPFPVGGV
FT                   REDPATGSAAAAFGAYLRELGLVDATATVTLHQGQDMGRPALLRVDLHEGDRRVRVSGT
FT                   AVRIPR"
FT   gene            618152..619066
FT                   /locus_tag="Tcur_0552"
FT   CDS_pept        618152..619066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96149"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M4"
FT                   /inference="protein motif:COG:COG3662"
FT                   /protein_id="ACY96149.1"
FT                   /translation="MSKCPLTFLSDEPAARGSTGKACKVPSTEVTPLGPDSLTWRFFGD
FT                   TRLLLVGPRAAVLQNMLPALGQGVLEHSVFFSETFARLKRSAGPILNTVYGGEDAPAIG
FT                   RQVRDYHHHVKGELPDGGRYHALDPETYYWAHATFVDHMIYGVETFIRPLDEAEKRRIY
FT                   EESKTWYRMYGVSDRPMPEDWEGFQAYWKHMLEEVLIAHKTARYGVGYTTKGLPAPRRF
FT                   PKKLWRAVSPPLNKAASFLTIGGLPPRARELLELPWSAEDERRYRRFAARVRRAGRHWP
FT                   LLPEAVRYFPQARKAFARARAAR"
FT   gene            619087..620670
FT                   /locus_tag="Tcur_0553"
FT   CDS_pept        619087..620670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0553"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   scl:sce5853 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96150"
FT                   /db_xref="GOA:D1A3M5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M5"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY96150.1"
FT                   /translation="MSRIRQVLEGLTAARRAGLIGLPPRAVAPSIRALRAYGPLGAAAT
FT                   MNALRFGSRTALVDEHGTLTFADLERRSNALANAWRARGLGPASRVGILCRNHRGLLDA
FT                   MTAAAKIGAGVLFLNTDFGGPQLVQTVEREGVTALVHDEEFTPVAAGAPAPQGRFVAWT
FT                   DRPGGGDLERLIAEGDPAPPPAPGRHGSLVILTSGTSGAPKGAPRSSGPSAAWLPVGIV
FT                   HRIPFRPGESVFVGPPMFHGWGLTAMLVTLGTGSVLLLRRRFDADAVLDLLERHRVRAL
FT                   VAVPVMLSRLLAADARRENRPRLRLRIIATGGAALSPALAERVMARFGPVLYNFYGSTE
FT                   ASSISIATPEDLRAAPGCVGRPTLGTTVKILDASGREVPPGVTGQIHIDSPLRFAGYTG
FT                   GGTKPTAGKLMAVGDLGHLDAAGRLFIDGRADDMIVSGGENVYPAEVEELLAGHPGIRE
FT                   AAVVGVPDEEFGQRLRAYVVAADTALGEEEVRRYVSANLARYKVPRDVVFVEELPRTST
FT                   GKVLKRLLPR"
FT   gene            621080..622735
FT                   /locus_tag="Tcur_0554"
FT   CDS_pept        621080..622735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0554"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: tmz:Tmz1t_1403
FT                   cytochrome b/b6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96151"
FT                   /db_xref="GOA:D1A3M6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M6"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ACY96151.1"
FT                   /translation="MTNPQKPGQAPAALRGMGRAIDDRLGGGRWGVKAIKKAFPDHWSF
FT                   LLGEIALYSFVIVLLTGVFLTLFFKPSMAPVVYEGSYTKLRGVEMSEAYASTLHISFDV
FT                   RGGLLMRQIHHWSTVIFIAAILAHLLRNFFTGAFRKPRELNWVIGVTLLLLVMLNGLFG
FT                   YSLPDDLLSGTGLRILHGVVLGIPLVGTYLAMFIFGGLYPGEEIIPRLYVVHILLIPAL
FT                   LLALIPLHAVILTWRQTHTTFPGRGATNTTQRGYPFMPVFIAKTTAYLFWTFAVAAFMA
FT                   TFFQINPVWLYGPYDPGAISAGSQPDWYMGFLEGSLRLMPAWEITLWGHTVPLSVLIPA
FT                   LVVPGVLFVGLYLYPWIERWITGDHGTHHLLDRPRDVPARTGIGMAGVTFYGLLWLAGA
FT                   NDVIADRFNFNLYGTTWFFRFAIFIGPVLAYIVAYRVCLGLQRRDRQLIEHGLETGVIR
FT                   MAPEGRFSELEVPLSKEAASPITDERPPAAVPLEAPARAGVRPPAERGRIGRLRLSLNR
FT                   HFLRDLYRPVAPHPNGDRAVREEERRAEQRALKE"
FT   gene            623116..624258
FT                   /locus_tag="Tcur_0555"
FT   CDS_pept        623116..624258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0555"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="PFAM: glycoside hydrolase family 25; SMART:
FT                   glycoside hydrolase family 25; KEGG:
FT                   N,O-diacetylmuramidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96152"
FT                   /db_xref="GOA:D1A3M7"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M7"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ACY96152.1"
FT                   /translation="MKRLTAVVAMGVSAAVMAAGAAAAAPTPGHGLRPGEAYAGAGNPE
FT                   RRAGGVGAAQVPAGLKGVDVSSYQGPNVDWAALKQNGVRFAFVKATEGAKVKGDPDSGY
FT                   VNPYFKDQYNGARKAGLIRGAYHFALPHKSGGARQADYFINNGGGWSTGGGTLPGVLDI
FT                   EFNPYDNGLDTCYGLKPAQMVGWIRAFSNRYRKRTGRYPIIYTNAYWWNKCTNNNTSFG
FT                   NHPLWQAHYGSGPVTPPAGWKTYTFWQYAAGTGATGNPSVFNGSLKALRKLAAQARTGF
FT                   TKVNAGPEPRKKGKKLTVVGRLHYHNGTAWRPLAKRKVSIWFRARGTSKWVRKAVVTTN
FT                   GKGRFRRKFIARKGGYWRAKFAGGPKFFGVTSGSDYVDVR"
FT   sig_peptide     623116..623190
FT                   /locus_tag="Tcur_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.813 at
FT                   residue 25"
FT   gene            624788..626017
FT                   /locus_tag="Tcur_0556"
FT   CDS_pept        624788..626017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0556"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   acp:A2cp1_2463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96153"
FT                   /db_xref="GOA:D1A3M8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M8"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACY96153.1"
FT                   /translation="MRDRSTEPVDPNLPVGKRIQYYRTKRGMSCEVLGGLVGKTGRWVR
FT                   AVESGRLQTPKLPVLLAIAEALKIRDLGQLLGGQPMPTSTFRGPGHPALPAVRDAINAI
FT                   GVPDTAPPRLDHLAARVAAAWRARHAAPDHRTVLGGLLPELIRDARHAAYAYGGDDRRR
FT                   ALALLAEVYNLTQFFVAYQPDSGLLWRVAERALLTAQEAEEPRTIGGAVWLLAEAHRDA
FT                   GDLDAAEQVIRDGMELLRPRLEQGGDDLRAMWGALHAAAAYTAARAGQKGTAWGWWDRA
FT                   EEIARSLSADHYDPLTSFSRVVMGAHAVTLAVELRQSGESRRQAARHAAAAIPSQPRRG
FT                   RHLVEVARAWQTAGDHAAAVDALADGYATAPETIRFNGYARQMITEYAGKPGPLRAPAR
FT                   DLAERVGLLV"
FT   gene            626149..626421
FT                   /locus_tag="Tcur_0557"
FT   CDS_pept        626149..626421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96154"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96154.1"
FT                   /translation="MSTTVPHTRSPAHAPEPTAADACGPDVLADLQRQIGRQWLVWYGH
FT                   HTRHWWAMPRPPYPWFGLVEGRTPADLPARVREVQAYYGPSRGMR"
FT   gene            626418..626744
FT                   /locus_tag="Tcur_0558"
FT   CDS_pept        626418..626744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96155"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96155.1"
FT                   /translation="MTASLDGLELFPWEVRGEDGEIHESGVSGDWAAASRAAIRALETR
FT                   PAGWTACVWSARLNPLEYDYRKVIGRGSGKQARPGSSGGPAGAAARFPTRRAAAPQRRG
FT                   IRRG"
FT   gene            complement(626731..626919)
FT                   /locus_tag="Tcur_0559"
FT   CDS_pept        complement(626731..626919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0559"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   abn:AB57_2839 rubredoxin-NAD(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96156"
FT                   /db_xref="GOA:D1A3N1"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N1"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ACY96156.1"
FT                   /translation="MSEQPYRTWQCLGCGWIYDEAEGWPEEGIPPGTRWEDIPDDWCCP
FT                   DCQMAKSDFEMVEITRA"
FT   gene            complement(626941..628137)
FT                   /locus_tag="Tcur_0560"
FT   CDS_pept        complement(626941..628137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0560"
FT                   /product="Alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bpy:Bphyt_5401
FT                   alkane 1-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96157"
FT                   /db_xref="GOA:D1A3N2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N2"
FT                   /inference="protein motif:PRIAM:1.14.15.3"
FT                   /protein_id="ACY96157.1"
FT                   /translation="MVMTVAADVEVRGSGAADGEWKDPKRYLWLLGLLVPAIPFGAWGL
FT                   VNLTGLDLFWWFGLIAIFVIFPFFDWFFGEDPTNPPESAMKRLENDRFYMWANLLYIPI
FT                   QYASLIVGCAILVRDSMSVIDRIGFATTIGAVGGIAIAAAHEMGHRKEKVEVFLAKVTL
FT                   AQTGYGHFVAEHNRGHHVRVATPEDPASARMGESFYRFLPRTVFGGLRSCWQLEKKRLA
FT                   RQGKGPISLRNDMIQGWLATAALFGALCLAFGIELLPYLILQAVLGFMMLEVVNYLEHY
FT                   GLLRQKLPSGRYERTTPAHSWNSNRVASNVLLYNLQRHSDHHANPGRRYQMLRHFPEAP
FT                   QLPAGYATMILRALVPPWWFRVMDKRLLEHYDGDITRCNVHPAKREKLMARYGAAAAR"
FT   gene            628292..628885
FT                   /locus_tag="Tcur_0561"
FT   CDS_pept        628292..628885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0561"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pmy:Pmen_1681
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96158"
FT                   /db_xref="GOA:D1A3N3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96158.1"
FT                   /translation="MTRYRESVRSLLRERLLDAAYELVAADGWDKMRMTRLAIAAGVSR
FT                   QTVYTEFGSREAIGEALIMREVERFLVGIQEQLDANTADLRAAITAGVRFTLQQAADNP
FT                   LIKSVLTNARSGNEGLLALLTVRSDQLLNAAQTMLDAYVADVWPEMDPASRSLAIEAVV
FT                   RITLSHIVQPGGSAEETARRTAEIVMRVAQISDD"
FT   gene            628969..629853
FT                   /locus_tag="Tcur_0562"
FT   CDS_pept        628969..629853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96159"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96159.1"
FT                   /translation="MTEVDLSAAASFMAAHARILDRRRFQLITGEGDPSAVLAALDGYR
FT                   NPDGGYGWGLEPDLRSPESQPAGALHALEVYADAAPAKSPHSAALCDWLEAVSLPDGGL
FT                   PFALPVTDPAGCAPWWVRADPATSSLHITAAVAGMAHRVAATDPAVAEHPWLARATDYC
FT                   LRAIDAIDTAPPALELMYALQFLDAVHDTRPEAPPLLTRLGAYLPADGILHVEGGTENE
FT                   ALRPLDFAPLPGRPVRALFPAEVVAGELRRLAAAQQGDGGWPVEYTVFSPASGLEWRGY
FT                   LTVRALWLLSRNR"
FT   gene            complement(629953..631601)
FT                   /pseudo
FT                   /locus_tag="Tcur_0563"
FT   gene            complement(631901..632512)
FT                   /locus_tag="Tcur_0564"
FT   CDS_pept        complement(631901..632512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0564"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5545
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96160"
FT                   /db_xref="GOA:D1A3N5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96160.1"
FT                   /translation="MGETASKSRLRAPARRATIIEAALKVFAGKGYHAASLGEIAKVAG
FT                   VARTVLYDHFPSKRVLLLAVMQEQNAALMEYVGARITGSGTPEERMRSTIDAFFSFAQS
FT                   RPEARKLLFGQADEADPEISTVRRGIRESHAQVVTALLANDMRAVGVDPKEPIAEAMVE
FT                   LLIAGLDGVAQWWERHPEMPRSMLVEGAMRLLWTGLGNVR"
FT   gene            632635..633195
FT                   /locus_tag="Tcur_0565"
FT   CDS_pept        632635..633195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0565"
FT                   /product="flavoprotein involved in K+ transport-like
FT                   protein"
FT                   /note="KEGG: bam:Bamb_5336 alpha/beta hydrolase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96161"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N6"
FT                   /inference="protein motif:COG:COG2072"
FT                   /protein_id="ACY96161.1"
FT                   /translation="MRRRNLSIAIVGAGFSGICLAIGLKKAGFADFVIFDRGNGPGGVW
FT                   RDNTYPGAACDAPSHLYSFSFEPNPDWSRRFAEQPEILDYLRHCVTKYVLTPHLRLRTG
FT                   DGETGEYGLLVAACGQLSNPAVPELPGMDAFTGTMFHSSRRSAPTHQRHSVGCRERRGA
FT                   APLRPAGCAGARTIRDGTSPHWW"
FT   sig_peptide     632635..632700
FT                   /locus_tag="Tcur_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.798 at
FT                   residue 22"
FT   gene            633484..637225
FT                   /pseudo
FT                   /locus_tag="Tcur_0566"
FT   gene            637504..637992
FT                   /locus_tag="Tcur_0567"
FT   CDS_pept        637504..637992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0567"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: dat:HRM2_24770 RpsA2"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96162"
FT                   /db_xref="GOA:D1A3N7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N7"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACY96162.1"
FT                   /translation="MADLERLKSYRAGMIVTGRVRSLERFGAFVDLGGVEGLLKTHNIS
FT                   WRPIEYPSDVLSVGKEVTVKILDVDLQRGQISLSLKDLQPDPMIPLKEKVGSVVTGKVV
FT                   KIVPFGIFVQIEEGQLGLLMNSEFTGPGAPPRPEIGEEIQVRIADVDLDSRRIRLSLP"
FT   gene            638448..638663
FT                   /locus_tag="Tcur_0568"
FT   CDS_pept        638448..638663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96163"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96163.1"
FT                   /translation="MRLLIGLLTWATFTLRHLERTAAERAMQAARTRNDPVMGGAATFA
FT                   RAHCRPSAALPRTLRGAAAAADCLES"
FT   gene            639313..639639
FT                   /locus_tag="Tcur_0569"
FT   CDS_pept        639313..639639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96164"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96164.1"
FT                   /translation="MRSAWTPWLICNGGVALSGSSARSAHSLVCRVLHGDEGGVHVYCW
FT                   QNEQNVPGIPAYRGKIDVPSGVLTLGDAVGERTVRADVGAGTHDVAVYIDRPAEATRVD
FT                   VVLS"
FT   sig_peptide     639313..639390
FT                   /locus_tag="Tcur_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.759 at
FT                   residue 26"
FT   gene            complement(640216..640291)
FT                   /locus_tag="Tcur_R0011"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(640216..640291)
FT                   /locus_tag="Tcur_R0011"
FT                   /product="tRNA-Lys"
FT   gene            complement(640418..640900)
FT                   /locus_tag="Tcur_0570"
FT   CDS_pept        complement(640418..640900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0570"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: hhe:HH1821 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96165"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P0"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACY96165.1"
FT                   /translation="MTAVPAEAAALPAAPAAAQAPAASAKAAAAKKASKIKKQRKRAAK
FT                   AVKFAYAQIGDPYRYGATGPNAWDCSGLAGGAWRKAGVKLPRTTYQIYAHVKRKVRYSK
FT                   LRKGDLVFFYSGRSHMGIYVGKGYMIHAPSSGKRVQKVKLSTYYKRHFNGAVRPGL"
FT   sig_peptide     complement(640823..640900)
FT                   /locus_tag="Tcur_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.696 at
FT                   residue 26"
FT   gene            641842..642417
FT                   /locus_tag="Tcur_0571"
FT   CDS_pept        641842..642417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96166"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P1"
FT                   /inference="similar to AA sequence:KEGG:sce5972"
FT                   /protein_id="ACY96166.1"
FT                   /translation="MSQADPGIDGGALISTLKRAAGVLRDAGVEFALAGGFAAYVRGAA
FT                   ISTHDVDFVLREQDVDAAVSALTAAGMRHRECPEEWLTKVYDGDRPIDLIFRPSGRPVD
FT                   GGMLQRAEELPVAAVSMPVLPADDLVIMRLLAFTETACDFSDFLHVCRALREQVDWPKV
FT                   AKETAHSPYAYAFLTLLHRLDVIEGGFL"
FT   gene            642414..642668
FT                   /locus_tag="Tcur_0572"
FT   CDS_pept        642414..642668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0572"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96167"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P2"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACY96167.1"
FT                   /translation="MSKAEDEPHYMAARIRERVAERAHELGIQVDVRGEVIYLRGDVAS
FT                   EQRRRDVEEAARAAAPDRTVRNELSVVSSGAPEGEERLS"
FT   gene            642665..643429
FT                   /locus_tag="Tcur_0573"
FT   CDS_pept        642665..643429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0573"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mes:Meso_2768
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96168"
FT                   /db_xref="GOA:D1A3P3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P3"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACY96168.1"
FT                   /translation="MIRVAAVGDIHVGPDVAGRYREQLAGLAGHADVLLVAGDLTRHGT
FT                   VAEGRIAVEELSACPVPVIAVLGNHDYHSDAQEEITALLREAGVTVLEGDWTVLECAGV
FT                   RLGVAGGKGFGGGFAGRSAGEFGEPEMKEFVRHTREFSERLHAALTALDEHGADVKIAL
FT                   THYSPVKDTLAGEPLEIYPFLGSYLMAEAIDRAEADLAVHGHAHRGAEKGMTAGGVRVR
FT                   NVALPVIRHAYAVYSLDETTLGRPVRSASLSR"
FT   gene            643479..643676
FT                   /locus_tag="Tcur_0574"
FT   CDS_pept        643479..643676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96169"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96169.1"
FT                   /translation="MTDKQQPDRSKSLADRRAEAGAPVDSGDEPDLAGEWEPGPTDPPN
FT                   AEAETPGGEAEGYSPQTRIP"
FT   gene            complement(643691..644539)
FT                   /locus_tag="Tcur_0575"
FT   CDS_pept        complement(643691..644539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0575"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: eba:ebA6991 putative oxidoreductase
FT                   (related to short-chain alcohol dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96170"
FT                   /db_xref="GOA:D1A3P5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY96170.1"
FT                   /translation="MSEQPAQTQPYPGRTPDMTPKPRDEMRDYRGRGLLAGRRALITGG
FT                   DSGIGRAVSVAFAKEGADVALAYLSEDADARRTAELVEREGRRCLTLGGDLAAAGHCRR
FT                   VVAHAARELGGLDVLVLHHGTQRPVEDVRQIDQEHLRRTFEVNVFSLLWIVQAALEHLG
FT                   EGSSIIVTGSINGLRGNKTLIDYAASKAAAMNLVQSLAQTLMDKGIRVNCVAPGPVWTP
FT                   LIPATFPKERVEGFGRQAPMGRAADPDEIAPSYVFFASDRMSSYYTGQTLVPAGGEIHP
FT                   G"
FT   gene            644728..645501
FT                   /locus_tag="Tcur_0576"
FT   CDS_pept        644728..645501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0576"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bur:Bcep18194_A5880 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96171"
FT                   /db_xref="GOA:D1A3P6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY96171.1"
FT                   /translation="MDLNGVSAVISGGASGLGEATARDLAAHGVKVVIADLNEAKGKAL
FT                   ADEIGGVFVKTDVSDEAQVQAAVQAAVDTGAPLRIIVNSAGIGWASRTVNRDGSPHDLA
FT                   SFQKVIQVNLVGTFNLMRIGAAAIAKTEPADADGLRGVVINTASVAALEGQTGQVAYSA
FT                   SKGGIVGMTLPAARDLSAIGVRVNTICPGIIDTPIYGEGEAAEAFKAKLIAPVVFPKRM
FT                   GKAAEFAHLVRALIENDYMNGEVIRFDGGIRFQPK"
FT   gene            645519..646283
FT                   /locus_tag="Tcur_0577"
FT   CDS_pept        645519..646283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0577"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A1889 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96172"
FT                   /db_xref="GOA:D1A3P7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACY96172.1"
FT                   /translation="MSDAVLTETEGAVLVITINRPEAKNAVNAAVAEGIAAAIDEFEGR
FT                   KDLSVAVLTGAGGTFCSGMDLKGFLKGEAPWAAGRGFGGIVEKPPVKPIIAAVEGYALA
FT                   GGCEIALSCDMIVASREAKFGLPEPKRGLVAAAGGLMRLPRRIPYHIAMEIALTGDFYG
FT                   AERMAELGFVNRLTEPGGALAAAKELALKIGENAPLALAATKRIIVESPYWSAEEMWQR
FT                   QNEISGPVFASKDAQEGPKAFAEKRKPQWTGE"
FT   gene            646426..647160
FT                   /locus_tag="Tcur_0578"
FT   CDS_pept        646426..647160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0578"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: dat:HRM2_18670 two component
FT                   transcriptional regulator (winged helix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96173"
FT                   /db_xref="GOA:D1A3P8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY96173.1"
FT                   /translation="MTDRTAHRPRPQRAAGARLLVVEDDANIRELLAGSLRFAGFEVVT
FT                   ATSGTTAVEAAHRHRPDLIVLDVMLPDFDGFAVVRRLRSGGTHTPVLFLTARDAVGDRI
FT                   TGLTIGGDDYVTKPFSLEEVIARIHAILRRARGGAAEPSPRMVFADIELDEDSHEVWRA
FT                   GKPISLSPTEFKLLRYFMANAGRVLSKAQILDHVWNYDFRGDAGIVESYVSALRRKVDN
FT                   TEPRLIHTLRGVGYVLRQPRRS"
FT   gene            647157..648674
FT                   /locus_tag="Tcur_0579"
FT   CDS_pept        647157..648674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0579"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gme:Gmet_3382 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96174"
FT                   /db_xref="GOA:D1A3P9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96174.1"
FT                   /translation="MTGPAARRAGGPLGTLRSLPDRTPLWVKLIAAVLLLVTAGLTVTG
FT                   VAGVSVLRGYLVDRVDEQLGQSARRLAGQIARPPPGPAGGPIVLRVPGDMSLQIRDADG
FT                   TVRSDTQAQDADGGPRIPAELAGRYGTPFTVPDVRSGPSWRVLAVPLKDGSSMIVGMSL
FT                   GETERTVDRLIAIDLLVGLVVLVVLAGLGVWVVRVSLRPLTGIEQIAGAIAAGDLSRRV
FT                   PQADPRTEVGRLAGSLNGMLAQIEAAFRARAASEHTARESERRMRRFIADAGHELRTPL
FT                   TAIRGFAELYRQGAARDAAEIDRLIGRIEDAASRMGLLVEDLLLLARLDRQRPLERRPV
FT                   DLLAVAAEAVQEARVLAPDRDIELSVESGMAYQVLGDEPRLHQVLSNLLTNAVRHTPAG
FT                   TPVRVRLRPGTPAEERALRERGAAAGTSAVVCEVADSGPGLTREQAERVFERFYRADES
FT                   RSREDGGTGLGLALVAALAAAHGGLAQVETAPGRGATFRVLLPQAPD"
FT   gene            649010..650095
FT                   /locus_tag="Tcur_0580"
FT   CDS_pept        649010..650095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0580"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   vei:Veis_1784 peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96175"
FT                   /db_xref="GOA:D1A4E0"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E0"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACY96175.1"
FT                   /translation="MSGSQEAPAGSGVGHVQAPGAHPAGPQASGAGSHVPWTGVQWAGG
FT                   HVDRPWAGLDGAQGRAAGVRPAAGPPGVVSGESGPWGPPQAPPGWTLRRRLVTFGAAVL
FT                   IAAGAGGAGAAAAVALLGDGGAAGRSAASSSAVGAAPRSVAEVAAAVQPSVVSIRAVSR
FT                   SAESEGSGVVLRADGTIITNAHVVFGAARIQVKFSDGRTATAEVVGADAEHDIAVIRAQ
FT                   GVSGLQPARIGDSGELAVGDTVLAVGSPLGLDGSVTAGIVSALGRTLQSGSQPGPGGPP
FT                   PGFGRRARQEQTTTIENAIQTDAAINPGNSGGALVDAAGRVVGINTAIATTDQDGGNIG
FT                   VGFAIPINAAMESANRIIAAS"
FT   gene            complement(650124..650954)
FT                   /locus_tag="Tcur_0581"
FT   CDS_pept        complement(650124..650954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96176"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E1"
FT                   /inference="similar to AA sequence:KEGG:AO090103000184"
FT                   /protein_id="ACY96176.1"
FT                   /translation="MSDRYFQDDDIICRVAQEGILIAGGGVASLLQTSHPKVGQGVHDH
FT                   SYTFDDPTARLRNTMGWVYTVVFGTKEEADQLSAIVTRMHDKVTGPGYQANDPELQVWV
FT                   ASTLFAVAAQLYQRLFGKFTPEELEEYYQQSKIYATILGCPEDRMPATYPEFREYYARM
FT                   VNTLKINDASRYVADGVLHPKKLPWFMRPGLIPIRLITYGMMPPPIREQYGWKWNLFRE
FT                   IQFHLLMEFLALVYPRLPKRVRTLPRDFYLHQIRKMLRNRAFDKPRLKVSSRAA"
FT   gene            651098..651529
FT                   /locus_tag="Tcur_0582"
FT   CDS_pept        651098..651529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0582"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   xop:PXO_02765 peptidyl-tRNA hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96177"
FT                   /db_xref="GOA:D1A4E2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E2"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ACY96177.1"
FT                   /translation="MPPAIRVRGSVTIPETELRWRFSRSSGPGGQHVNTSATAAELSFD
FT                   VAGSPSLPEPYKRRALERLAGRLNGGVLTIRAEEHRSQKLNRDAARARLAALLTEATAP
FT                   PPKKRRPTKPSRRVHKRRLENKRRRGALKRERSSRWHWH"
FT   gene            complement(651837..652373)
FT                   /locus_tag="Tcur_0583"
FT   CDS_pept        complement(651837..652373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0583"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: lpc:LPC_0547 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96178"
FT                   /db_xref="GOA:D1A4E3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E3"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACY96178.1"
FT                   /translation="MAVTRSPKGRGEVRPIRRLGDPVLRTECDPVRTFDAGLRRLVDDM
FT                   FATMYAANGAGLAANQIGVSLQVFVYDCEDDLGRRHVGHVINPVLVAEDGDIVVEDEGC
FT                   LSVPGLRFPTPRYRHAVVEGVDLDNKPLRIEGTGYFARCLQHETYHLRGGVYIDVLKGE
FT                   TRREAMRAIRSAGLS"
FT   gene            complement(652499..653476)
FT                   /locus_tag="Tcur_0584"
FT   CDS_pept        complement(652499..653476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96179"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96179.1"
FT                   /translation="MSNETEIVPNLLREEEEFEIVMRGYNRRQVEDRLRDLKTQYQNQI
FT                   RDLEARLARALDDVERTRREMAELRESRKPTGDDLSERLRQIINLAEDEARDKVAEAEA
FT                   KGAQIRKEAEAESQRIINEAREAAAKNLAEAQEKADHVLGMAKKESEAILTAAKQEAEQ
FT                   TVTSARLEAERTLTAAERRAGVINEDATQRLNQLTRNHTQALQRLTEISETLAALLRAE
FT                   NEAGPLEKMVDDAVKQVAPAARKPAAPAKPAASAKPAAPAKPAPAPKHAVAPAPSEPVR
FT                   PADPPAPAVPLPAQAADEAAEPGKPAAPLSPVPPQAPAPGVGEG"
FT   gene            653705..654268
FT                   /locus_tag="Tcur_0585"
FT   CDS_pept        653705..654268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0585"
FT                   /product="hexapaptide repeat-containing transferase"
FT                   /note="KEGG: pfo:Pfl01_1011 hexapaptide repeat-containing
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96180"
FT                   /db_xref="GOA:D1A4E5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E5"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_1011"
FT                   /protein_id="ACY96180.1"
FT                   /translation="MPVPYHRAMSMSYVGSLGEAEPDIHPQAWVAPGAVVIGKVRLGRG
FT                   SSVWYGSVLRGDDEEIIVGEDCNIQDLCCLHADPGTPAVLEDRVSLGHKAMVHGAHVET
FT                   GALIGIGAIVLNGARIGAGTLVAAGALVGPGKKIPSGVLVAGVPGRVVRELTDDDRLVL
FT                   EHTWRIYTKKAEHHRTAARWRTGT"
FT   gene            654472..658149
FT                   /locus_tag="Tcur_0586"
FT   CDS_pept        654472..658149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0586"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: bid:Bind_2798 ATPase
FT                   central domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96181"
FT                   /db_xref="GOA:D1A4E6"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E6"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACY96181.1"
FT                   /translation="MRAMVSAGWWPSAPPQQRQHVIAGRMLVLPDGTWWLFGAWARWYR
FT                   LHPSDGQWYLCPPPQAPATRMAARPAPQTGRLPMLPPHVLPAGPDFTFQAPAPLPFVGH
FT                   GISPEVTDRVRATIEQAAALPAADYPHWWALFSSDVPSTVAATWGVMLWCAVAPVFDSR
FT                   LDEQMLRLWEPYRARPLPEVDGPRWLTPPPLEALVGLYAERLRAGRVDAAVSVLRTMWA
FT                   MAGALRDDPRFQARADALLAILNATLANPQMDYGVLPYGDQALVQQWLTRCPPSLAPAL
FT                   RHESSPGDNVRHAYYEFAEALVPIAGDPADPAYIEPRLVAAALLAADLAKVRQDVAAQV
FT                   VPWLDPEIRYTIQAVQGQTGHPLRRLWPQDARLPEQLRAGLEGGERAESLLASAYALDL
FT                   AWCRLVGIPARPRGFPMPTAILGEIIGASRARAAVAAAPITPPPGVSQPLQQAGRPGQP
FT                   GTPPGGMPAAPAGPVGQPGGLPGAPASGSVHPAGRQPEPGQPFMQAPAEPPVANPAGGQ
FT                   GFVIEPPQSFQPPEGDGEAGDGFVVPYTRLGFVRPDGPPPQQPAAENRSPAPEPAGREL
FT                   PFDPAATRLDDGAGSARPAAGPPRTRILGQDDILGDAPGETPGDGPDGEAARQGPPVPP
FT                   APNPALGGGTRIMSETMIADFDYLDEAPMPQVEQIAPPPERPGGDDGRVVERYGISFLS
FT                   GREDVTVLLEELRTHPAWSAGAADMEATRIDGRPGSGPPPSVLLVGSPHTGQRRLSRMI
FT                   ALALAEIGIGDGAIRTADAADVRGAAPEQLAAVLEPGGPTLLFERLDVAILEAADPEAM
FT                   VRSVRSVRTRPGPTTLIATCEPRHFKRLSQDHPELIELFRVYRLPDLTRPETRMRLLYL
FT                   LADERRVTLDADALEAAEADLRRLRGPGDLVNARLVEAYLDQACQRGMERAGAAQSRLV
FT                   LSAQDFAGVAEAIEPALRPPGDIDGYLRQLDALLGLEDVKAAVEELVAEAQMAAERIRH
FT                   GVAPGTQGRHLLFLGPPGTGKTTVAGLVGGIYAALGLLSSGHVVACRPVHLAGRDAVDT
FT                   DNRVAAMVEQAMGGVLLIQEAYRLDRVPQVVEELQRQLADCGDRLLMICTSPAAEMEGF
FT                   LAGHPSFRAHFARTLEFQGLDDRQLVQLFQSYAERDLYLLDEELRVELLTRFERMRQDP
FT                   SFAYARTVRQMFEQTVARQAARLAGMDVNAATVARLTVRDLPESPLERMLGNFQRDPRG
FT                   "
FT   gene            658344..658526
FT                   /locus_tag="Tcur_0587"
FT   CDS_pept        658344..658526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96182"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96182.1"
FT                   /translation="MRQQIDLRVHDRVALDEIELYSEILSAVATAERPLTIDEIDTVLG
FT                   VRREDGTGRRESTPQ"
FT   gene            659051..659668
FT                   /locus_tag="Tcur_0588"
FT   CDS_pept        659051..659668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0588"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   afw:Anae109_4377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96183"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E8"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACY96183.1"
FT                   /translation="MRLRLTPREDSFYDMFAASANNLVTAARLLVELISDGADREAIAE
FT                   KLRACEHAGDEATHAIMHRLNETFITPFDREDIYRLASQIDDVMDDMEEAADLVVLYKI
FT                   DQLPKGVVQQVEVLERAAELTAEAMPRLRSMKELNEYWIEINRLENQGDQIYRRLLAHL
FT                   FNGSYDTLTVMKLKEVIDRLEGATDAFEHVANTVETIAVKES"
FT   gene            659665..660822
FT                   /locus_tag="Tcur_0589"
FT   CDS_pept        659665..660822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0589"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: dds:Ddes_1960
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96184"
FT                   /db_xref="GOA:D1A4E9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E9"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACY96184.1"
FT                   /translation="MTEARETVLNPPPPPGDEPPPLSEQASRVSIKAWLGLLALVLVVI
FT                   GAGALGLRSDAQTAVLVLVVVIALGFDYTNGFHDAANAIATSVSTRALTPRAALLMAAV
FT                   MNLLGALLGVEVAKTVSEVITPPEGLHGLTVVAAGVLGAITWNMITWYFGLPSSSSHAL
FT                   IGGVVGAGLASASSVSWGTVVDKVAIPMVVSPVVGFCLAYLVMVAILWIFRRAHPRKIG
FT                   RRFRIAQSLSAASMALGHGLQDAQKTMGIIVLALVTTGHADGQSVPLWVIVACASALAA
FT                   GTYAGGWRIMRTLGRRVIELDPPKGFAAEATASAILYATAYIWHAPISTTHTITSCIMG
FT                   VGATKRLSAVRWGVAGNIVMAWVLTMPMAALVAGVVYWFVHLFGA"
FT   gene            complement(660932..661708)
FT                   /locus_tag="Tcur_0590"
FT   CDS_pept        complement(660932..661708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0590"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: gur:Gura_2561 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96185"
FT                   /db_xref="GOA:D1A4F0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F0"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACY96185.1"
FT                   /translation="MAKRIEVSGLHAYYGSVCAIEDISMTIEPRSVTAFIGPSGCGKST
FT                   FLRTLNRMHEVIPGARVEGKVLLDSEDLYGPGVDPVAVRRVVGMVFQRPNPFPTMSIYD
FT                   NVAAGLKLNGVRRKSQLDEVVERSLRGAGLWNEVKDRLHRPGAGLSGGQQQRLCIARAI
FT                   AVEPQVLLMDEPCSALDPISTLAIEDLISQLKNRYTIVIVTHNMQQAARVSDRTAFFNI
FT                   SGPGKPGRLVEIGDTSKIFTNPSEKATEDYITGRFG"
FT   gene            complement(661721..662620)
FT                   /locus_tag="Tcur_0591"
FT   CDS_pept        complement(661721..662620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0591"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: vei:Veis_1291
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96186"
FT                   /db_xref="GOA:D1A4F1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F1"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACY96186.1"
FT                   /translation="MSITATGSPPGGLPKVSARRRAADLTVRVLVCAAFVLAVIPLASV
FT                   LWMVLTRGLARLDLTFLTYSMNGLSSGDEGGGANHAIVGTLQQVGLSTAMAVPLGVLTG
FT                   IYLVEYGDGKRLARVITFFVDVMTGIPSIVAGLFVMAFWLVALGFEYSGFAGSLALAIL
FT                   MLPTVVRATEEMLKLVPGDLREASYALGVPRWRTVCFVVLPTALTGIVTGVMLAVARVM
FT                   GETAPLLLLIFVTDAINANPFAGPQGSLPTFIWYQAGDPNPQAIERAWAAALTLILLIM
FT                   LLNLGARLLARLRKPVSR"
FT   gene            complement(662617..663603)
FT                   /locus_tag="Tcur_0592"
FT   CDS_pept        complement(662617..663603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0592"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: gur:Gura_2559
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96187"
FT                   /db_xref="GOA:D1A4F2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F2"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACY96187.1"
FT                   /translation="MTSEADIGRAADIAAGSRAVRRPMSTGRRGDQIFALTSRASGIAL
FT                   LAVMAAIAVFLIWKAIPALQANTANFLTEQEWNPNADPPVFGIAQLAYGTVMTSFLALL
FT                   MATPVAFGIALFISFYAPRRLAAALGYLVDLLAAVPSIVYGLWGLHYFSTKMDDVGRFL
FT                   NTYFGWIPLFGGDSVGGRSLLTASVILAIMILPIISSLTREVFLQVPTAHVEAALALGA
FT                   TRWEVIKMAVLPFGRSGMISAAMLGLGRALGETIAVAMVLSTAGGISIHILKDGGNTIA
FT                   ANIANSFAEAGETARGALIASGLVLFVITLIVNMTARAIVARHREFA"
FT   gene            complement(663713..664819)
FT                   /locus_tag="Tcur_0593"
FT   CDS_pept        complement(663713..664819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0593"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: sml:Smlt1552
FT                   putative phosphate transport system, substrate-binding
FT                   exported periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96188"
FT                   /db_xref="GOA:D1A4F3"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F3"
FT                   /inference="protein motif:TFAM:TIGR00975"
FT                   /protein_id="ACY96188.1"
FT                   /translation="MKNGSRLAALGGVVVAGALALSACGSDDNVGAGASNAPTGKIDCV
FT                   KGTVNAAGASSQKNAIEEWKKIYAQQCAGATLNYNPAGSGAGIQAFLAGQVAFAGSDSA
FT                   LDEQEAARARQRCQGNPAWNLPMVVGPVAVIYNLPGVDGLQLKPKTLAAIFAGKLKKWN
FT                   DPAIAADNPGTDLPDTDIKPIHRSDESGTTENFTDYLSNVAGDEWKWEPEKKWPTEAGG
FT                   QGAPKSDGVVTVLKQTEGGISYVEMSFAKKNGLQTAKIANGSGEYVEVSEQSVGNALDS
FT                   AEIVGQGHDLALKLDYNTSAAGAYPIFLVTYEVVCSKGLPADQAAFVKAFLKYTAGEDG
FT                   QKVLTDAGYAPLSPALAAKVRAAVEALS"
FT   sig_peptide     complement(664742..664819)
FT                   /locus_tag="Tcur_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.713 at
FT                   residue 26"
FT   gene            complement(665032..665925)
FT                   /locus_tag="Tcur_0594"
FT   CDS_pept        complement(665032..665925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0594"
FT                   /product="mycothiol biosynthesis acetyltransferase"
FT                   /note="TIGRFAM: mycothiol biosynthesis acetyltransferase;
FT                   PFAM: GCN5-related N-acetyltransferase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96189"
FT                   /db_xref="GOA:D1A4F4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1A4F4"
FT                   /inference="protein motif:TFAM:TIGR03448"
FT                   /protein_id="ACY96189.1"
FT                   /translation="MDERALVFSDGLTDPQISQVLALAEAATRHDGVAPLSEQALLTLR
FT                   AGRSRSLLSLEDGVIAGYAHLDPAPDGAGASGEVVVHPGRRRRGHGRALLRALRERARG
FT                   PLRVWAHGDLAPAAALAAAEGMARVRVLLQMRRPLQDSPLPEVTVPDGVTIRTFEPGRD
FT                   ETAWLRVNGRAFADHPEQGAWTLEDLRARQAEPWFDPAGLFLAERDGRLIGFHWTKVHP
FT                   DPIGEVYVVGVDPSAQGLGLGRVLTLIGLHHLRDRGLPAVMLYVDESNRPALRLYESLG
FT                   FTRYAVDVMYQSPPPH"
FT   gene            complement(665993..666706)
FT                   /locus_tag="Tcur_0595"
FT   CDS_pept        complement(665993..666706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0595"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: slo:Shew_3419 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96190"
FT                   /db_xref="GOA:D1A4F5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F5"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACY96190.1"
FT                   /translation="MSSLLLLTNALEPSDEVLPALGLLLHSVRVAPAEASALIDAPPAD
FT                   VVLVDARRDLVQAKSLCRLLRTTGLDCPLLAVVTEGGLAALSPEWGLDDVLLQTAGPAE
FT                   VEARLRLAIGRAAASEADDVPGEIRNGDLTIDEATYTARLRGRVLDLTFKEFELLKYLA
FT                   QHPGRVFTRAQLLQEVWGYDYFGGTRTVDVHVRRLRAKLGAEYESLIGTVRNVGYRFVP
FT                   DHRPGESETREPVRS"
FT   gene            666855..667109
FT                   /locus_tag="Tcur_0596"
FT   CDS_pept        666855..667109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0596"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96191"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F6"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACY96191.1"
FT                   /translation="MARGTIRYWAAARAAAGVEEEPYEAATLAEALHNARRGRSGDFAR
FT                   VLERSSFLIDGAPVGTRPHEGVALAEGAVIEVLPPFAGG"
FT   gene            667333..668031
FT                   /locus_tag="Tcur_0597"
FT   CDS_pept        667333..668031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96192"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96192.1"
FT                   /translation="MRKALVVFLVLLAGGLIAADRIGVLLVQREVAERLAVQYSLPQRP
FT                   EVTIHGLPFLTQAIGGEYRQVDVAIGDFTRQEVTLRDVRVRIENLRAPLSEAINGDTSG
FT                   VVAGTATASAILPYDLIKRHAPANVTRIGASGSDLEVELTGSLLGFTLNGTAVLSAEVS
FT                   RDGIRITPRSVATQGLRVPLGALRGPLSWTVPVPELPLGSRISRVEITEAGIRVGATAH
FT                   DVAVGELAGR"
FT   sig_peptide     667333..667389
FT                   /locus_tag="Tcur_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 19"
FT   gene            668065..668622
FT                   /locus_tag="Tcur_0598"
FT   CDS_pept        668065..668622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0598"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   afw:Anae109_0250 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96193"
FT                   /db_xref="GOA:D1A4F8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY96193.1"
FT                   /translation="MTAGEPDREGVRVTGVGPTADERLLRSLYAEHGGPLLGYALRLTG
FT                   GDRQQAEDIVQETLLRAWRHPEALTGRPVRPWLFTVARNLAVDAHRARRSRPPETGLHE
FT                   YAALPAGNDDIDRALESWTVAEALADLSPQHRAVILETYYRGRSVAEAAQVLGIPPGTV
FT                   KSRTYYALRALKLALEERGLAP"
FT   gene            668619..669362
FT                   /locus_tag="Tcur_0599"
FT   CDS_pept        668619..669362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0599"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_3992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96194"
FT                   /db_xref="GOA:D1A4F9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96194.1"
FT                   /translation="MSTECEEVRISLGVYVLGAIDPAERAAVDAHLSVCPSCRDELAGM
FT                   AALPALLGRVSEAQIAALAEPPGELLETLLARAASDRRPSWRRRWSARWKALWSSRWTP
FT                   LVAAAAVMLVVGALFGGLLDDRFDGSPPVTAPGPSQTGEGPSPSTTGERLQARDADTGV
FT                   SAELLLFAKNSGTQAELRLSGVSAGSRCRLEAINRQGRHDIMGSWRLDHPQATFVGSTM
FT                   FRRAEVASFQVVADDGRPLVTIPAE"
FT   gene            669411..669842
FT                   /locus_tag="Tcur_0600"
FT   CDS_pept        669411..669842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0600"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_1738 thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96195"
FT                   /db_xref="GOA:D1A4G0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96195.1"
FT                   /translation="MTGAFVAAFVLLAATVFGLVRRHRDGRLRPARGGDVPEAATDRLG
FT                   PAELGAALGERATLVQFSTAFCAPCRATRRVLAEVAAMVEGVAHIEIDAESHLDLVRRL
FT                   GVVRTPTVLVLDAAGNVRRRATGAPRKADVIAALGAVID"
FT   gene            670107..670544
FT                   /locus_tag="Tcur_0601"
FT   CDS_pept        670107..670544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0601"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0151 CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96196"
FT                   /db_xref="GOA:D1A4G1"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96196.1"
FT                   /translation="MQVDPRGQRVSAGITTAVLVVVLITGSWELLAAQAVVFAVGALIG
FT                   LRYAPYGLIYQALIRPRIGPPRQLEDAAPPRFAQGVGLVFALVGVVGYVVGIEWLGIVA
FT                   TALALGAAFLNAAFGFCLGCEMYLLIRRVIPKNRSDREVPA"
FT   gene            670541..671380
FT                   /locus_tag="Tcur_0602"
FT   CDS_pept        670541..671380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0602"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="KEGG: cja:CJA_2345 rhodanese-like domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96197"
FT                   /db_xref="GOA:D1A4G2"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G2"
FT                   /inference="protein motif:PRIAM:2.8.1.1"
FT                   /protein_id="ACY96197.1"
FT                   /translation="MSRSDVLVDADWVQQHLDDPGVVLVEVDEDVSAYDKGHIRGAIKI
FT                   DWKNELQDPVRRDFVDKTGFEELLSRKGIANDDLVILYGGNNNWFAAYAYWYFKLYGHE
FT                   KVKLLDGGRKKWELDSRELVTEVPQRPATQYKAKDQDLSIRAFRDEVVDAIGKKNLIDV
FT                   RSPDEFTGKLLAPAHLPQEQAQRPGHVPTARNIPWSKAANDDGTFKSDEELRALYEEAG
FT                   VDFSKPIIAYCRIGERSSHTWFALRELLGLSDVKNYDGSWTEYGSLVGVPIELGEAK"
FT   gene            671447..671755
FT                   /locus_tag="Tcur_0603"
FT   CDS_pept        671447..671755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96198"
FT                   /db_xref="InterPro:IPR010814"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96198.1"
FT                   /translation="MTQGCAAPAQTTRLPATVDLSNEAVIQGTVTRNGTPVPGAYARLL
FT                   DSTGEFTAEVVTGDEGVFRFFAADGDWTVRVLAAGGVSVDTQVTAKVGEVAQVEVAI"
FT   gene            complement(672159..672989)
FT                   /locus_tag="Tcur_0604"
FT   CDS_pept        complement(672159..672989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4862 adventurous gliding motility
FT                   protein AgmX"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96199"
FT                   /db_xref="GOA:D1A4G4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96199.1"
FT                   /translation="MNSGQNAPVNPQQWAPLPPPPGPVGSRRRPWLLPALALAAVLVVG
FT                   AVLAVVVRGGGGGNAAEPPAPMSTASATPTGSGTPAAQAPRFVTITAPCRLVPRPVRRS
FT                   FMPPPLNARRAGPSGRPGQDGHAAGCRWSTANPQAPRQRALTVRVVLRADQGGRAGVDK
FT                   ATTWMNAARRTMRQRAGTSVQNAGGSVLRYGTFRRVPDVGEDAFAMYAEAQSAAGRTGS
FT                   VTVWARYANAMFKVVFAGSDGGAVPLAETAAFEGATAAARAVVTALQGCTGCLG"
FT   gene            673335..674630
FT                   /locus_tag="Tcur_0605"
FT   CDS_pept        673335..674630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0605"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: dat:HRM2_26400 putative alkaline serine
FT                   protease (subtilase family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96200"
FT                   /db_xref="GOA:D1A4G5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G5"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACY96200.1"
FT                   /translation="MKARRVAWGAIALVAVQLLTCPAALAAPSPDPSQRSTPKPGGTPE
FT                   PKPSKKKSPSPQPPPQRETKQECEIKTGIPAGQLQEEPWAQKRLGFTAVWELTTGKGVT
FT                   VAVVDSGVDASHPQLKGRVRTIDVTGTGTRDCLGHGTQAAGIIAARDMRRRQVPFLGVA
FT                   PGVRLLSIKAAVQQSGNDPGWTAKAIREAADRGAKVINVSSQSPDYPSLREAVKYAQRK
FT                   DAVIVAAAGNIQDEQRGTQTPAYPAAYPGVVAVGAVGESATLSSFSNTETPVTVVAPGE
FT                   KIVSTWPGGGYNIDQGTSFATPFVSGVAALVRSYHPKLSYKQVKRRLEVTADGGSANGT
FT                   GGGMVNPLQAVTAVLDGEEEGEEAPSPQALPVYIPRPEPEDRFGRTLALSLTGGALALA
FT                   ASAVAAGIIIPAGRRRNWRPSRRQPSTEGPTG"
FT   sig_peptide     673335..673415
FT                   /locus_tag="Tcur_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(674712..675332)
FT                   /locus_tag="Tcur_0606"
FT   CDS_pept        complement(674712..675332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96201"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96201.1"
FT                   /translation="MSSAMPVPGLHLIRRGLELRSGAGELVGTVNRRPLSPFGEIRRWT
FT                   DGKGAGSVKDMVATLDVRHSDGSAWFVFDKPKRSKEATVVLADGTPVGVIRSLLRWYHL
FT                   NASFTRRYALIPATGPELLAVRPLSEQEYAITGPGGERMGGVTERLDTVLGWGGTPFGS
FT                   TVEIWDELKLNDVGLPQTVQVLCIAFLCGYHCFDPRKSGYPPK"
FT   gene            complement(675368..679315)
FT                   /locus_tag="Tcur_0607"
FT   CDS_pept        complement(675368..679315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0607"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: bra:BRADO1389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96202"
FT                   /db_xref="GOA:D1A4G7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:4N1A"
FT                   /db_xref="PDB:4NH0"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1A4G7"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACY96202.1"
FT                   /translation="MSTVLVRRKERRQPPQMPRGEILLESPPELPEVVTNSFQNVLMYL
FT                   PMAAGSAAMVFTFLNHRNTLQLVAGGMFALSMFGMMFGQLSQQSGERKTKLNSARRDYL
FT                   RYLGQVRQRVRKAAKQQREALEWNNPAPGRLWSMVMSPRLWERRSSDADFAQVRIGAGP
FT                   QRLAVQLIPPETKPVEDLEPMSAGALRRFLRAHSTVPDLPVAISLRSFARILPDGDPKA
FT                   VYGMVRALIMQLAAFHSPDDVRITVCASRERMPQWQWMKWLPHSLHPTEYDAAGQVRLL
FT                   THSLVELESMLGPEIKDRGMFGASRAPAEPFHLVIVDGGQASYDSQIASDGIDGVCVID
FT                   LTGSVAETNEATMLRLRVTPERVYVVKRDRAGKEVLSSVGRPDQASIAEAEALARQLAP
FT                   FRTSAADEPEEDVLSANMTLTSLLHIDNPYNLDPAVLWRPRPQRNRLRVPIGLDADGRP
FT                   LELDIKESAQGGMGPHGLCIGATGSGKSELLRTLVLALAMTHSPEVLNFVLVDFKGGAT
FT                   FLGMEGLRHVSAIITNLEEELPLVDRMYDALHGEMVRRQEHLRHSGNYASLRDYEKARM
FT                   EGAPLPPMPTLFIVLDEFSELLSAKPDFAELFVMIGRLGRSLGVHLLLASQRLEEGKLR
FT                   GLDTHLSYRIGLRTFSAMESRVVLGVPDAYELPPSPGNGYLKFATEPLVRFKAAYVSGP
FT                   VDEEPQTRSEGPQIVRQVLPYLTDYIRPQVVEQPQPEQRAEENKSSESLFDVVVRQLAG
FT                   HGPEPHQIWLPPLDVPPTLDELLPPLSPSAAHGYTADGWEWRGRLHAVVGLVDRPFDQR
FT                   RDPYWLDLSGGAGHVGVAGGPQTGKSTMLRTLITSLALLHTPQEVQFYCLDFGGGTLAG
FT                   LAELPHVGSVATRLDADRIRRTVAEVSALLEQREQEFTERGIDSMATYRRLRATGEYAG
FT                   DGFGDVFLVVDNWLTLRQDYEALEDSITQLAARGLGYGIHVVLSSNKWSEFRTSIRDLL
FT                   GTKLELRLGDPYESEVDRKKAANVPENRPGRGLTRDGYHFLTALPRIDGDTSAETLTEG
FT                   IATTVKTIREAWHGPTAPPVRMLPNVLPAAQLPSAAESGTRIPIGIDEDSLSPVYLDFN
FT                   TDPHFLVFGDTECGKSNLLRLITAGIIERYTPQQARLIFIDYSRSLLDVATTEHQIGYA
FT                   ASSTAASSLVRDIKGAMEARLPPPDLTPEQLRSRSWWTGAELFLVVDDYEMVATSDNPL
FT                   RPLAELLPQARDIGLHLIIARSMGGAGRALYEPIIQRIKEMASPGLVMSGNKDEGILLG
FT                   NVKPHKLPQGRGYFVERRSGTRLIQTAYRES"
FT   gene            679838..681244
FT                   /locus_tag="Tcur_0608"
FT   CDS_pept        679838..681244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0608"
FT                   /product="secretion protein snm4"
FT                   /note="TIGRFAM: secretion protein snm4; PFAM: protein of
FT                   unknown function DUF571; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96203"
FT                   /db_xref="GOA:D1A4G8"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G8"
FT                   /inference="protein motif:TFAM:TIGR02958"
FT                   /protein_id="ACY96203.1"
FT                   /translation="MSPTTGTDLCRVTVVGPQRRVDISLPTDVPFAQLFPAILHYLGEN
FT                   LAEQGLAHGGWVLQRLDEAPFSGDMTPGQAGLRDGEQLYLRPGMSQLPEPSFDDVADVV
FT                   ATGVNEQPDRWRIEWTRVFGLGVGAGAAAVAAVILLLAGPPDASWIVPSVAAAVIALLL
FT                   LAAGAAVSRAVGDSVAGAVLGFSALPHAFLGGLLGPARSTPLTELEAFHLLSGFAAVVL
FT                   VSAVAAVAVADGLPLFVGTGAAGLAGTLGAGAGMLLEGVSAAGIAAVTTVVFMTLIPLA
FT                   PTLAFRLARVTLPPPPANVEELRRDTLPVDGRTVRQRTVRADRIITGITLAVGAVGLVA
FT                   VVPLAFDDGWLGPITGGCIALALLLRSRLFRGRYQRLNLMVSGMAAFGVLAIAIAADAS
FT                   QPVVLLGAVAPLLVGAGIVVGTGLWLPGRKLSPFWGRAADVCDFTVVLALIPLSLGEAG
FT                   LYGWVRGLGG"
FT   gene            681251..682654
FT                   /locus_tag="Tcur_0609"
FT   CDS_pept        681251..682654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0609"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96204"
FT                   /db_xref="GOA:D1A4G9"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G9"
FT                   /inference="protein motif:PFAM:PF05108"
FT                   /protein_id="ACY96204.1"
FT                   /translation="MQTRKDLLQAHRLMTQRAALALILGQPDTAEAPMRRLNVAAFSGV
FT                   MITVVVMAIFGIVGILRPGGAKRLQEPGTLIIEKETGARYVWCQDPPKLCPVANYVSAR
FT                   LLAGQDAGKRRTVSRNSLRNFQRGPLIGIPEAPNTLPEAKHLVKTPWSACVRTVELPTR
FT                   GRTSLATMVVGTPVGGQSLRDDQGLVIRSAGQTWLIWKNQRLRIPEELVPALAPNPARV
FT                   TPKWLNALPPGPDYKAPSIPNLGQEVPGPEGGKARVGQFYAVETGSTTTWYVQLADGLA
FT                   PISEIEKELLRADPAISQKAYSGRPAQEIALPPYVLNSMQRSSRRISKQELQGAPPTII
FT                   PYADSTPLCVIYDDPTGERRGYVTLNGRLPDPPQSTTPFGVDQLVFPPGGAALVGSMPA
FT                   PGKGSEVNSYSLVAEGRRYQLESPEVAELLGYEISQAVPVPSAVLNLIPTGPTLDPDAA
FT                   SQQLTGGPR"
FT   gene            682952..683266
FT                   /locus_tag="Tcur_0610"
FT   CDS_pept        682952..683266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0610"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96205"
FT                   /db_xref="GOA:D1A4H0"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:4LWS"
FT                   /db_xref="PDB:4N1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1A4H0"
FT                   /inference="protein motif:PFAM:PF06013"
FT                   /protein_id="ACY96205.1"
FT                   /translation="MAPQSAVDRAAMAQAAQDIEQSANAIRGMQNQLASAKDQLRSHWE
FT                   GDASMAFEAVFNRFNEDFSRVLKALDGMHESLVQTRITYEAREEAAQQSVNRVQALLNG
FT                   "
FT   gene            683313..683606
FT                   /locus_tag="Tcur_0611"
FT   CDS_pept        683313..683606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96206"
FT                   /db_xref="GOA:D1A4H1"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="PDB:4LWS"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1A4H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96206.1"
FT                   /translation="MSDYTRANFGGLSEGEAQFSMTARALLDELTDLEGKLRAKLDRWD
FT                   GDAQAAYWNYQKEWDAAAKDMQNVVAQLGVAIREAHDNYQAAERANTSIWAG"
FT   gene            683782..684171
FT                   /locus_tag="Tcur_0612"
FT   CDS_pept        683782..684171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96207"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96207.1"
FT                   /translation="MTDHAGRPSQIPQPGSKEIEVDPGYLRNFANQMQADLDRLVKGRY
FT                   RERLQDALPNAGSLGNYQAGRSLYTTIKNGHESIGFTFQQFTTVYQQVIDALRQCAKNY
FT                   EDAERNNVASARNVYRGGSGGGTLI"
FT   gene            684205..685578
FT                   /locus_tag="Tcur_0613"
FT   CDS_pept        684205..685578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0613"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF12424 gene product from transcript GF12424-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96208"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96208.1"
FT                   /translation="MAPPQQGVIRNQQFSTGDEGISGWTNKLQIWEDHFNDLKAIVDGM
FT                   NPCELQTSSLAFRTLAEAMNDTLDLLSDVAGKLAKNWGGQDAQAAVAQMNKAYQQALEI
FT                   QNKSQQVAKATAEHADKQTEWKQAYGTGSPTDSWVRKVARWATLPAALGGPTSPAAVTS
FT                   FLANNMGAEDALNKINQGTRQSNESYPPEIKVDMPDPQVTPFDAAPASPGAGGGAPMPS
FT                   MPGGGAGGGGAGNPPGSPGLPGPGGDAGPGGGAPNPFRDGGVPGPYPLGDPPGGGFGGP
FT                   GYPGPGGGGSGYSGGGGSGSDLAGLQPGNPGTPGPGGGFGGGNGLPGGPNGPGGPPGGP
FT                   SGLLPGGPGGLPGGLPGGRGGGLPGGRGGGLPGGKPGGLPGGIGGGSPRGFNGVLGGPN
FT                   AAGRTGVGAGPGGMGMGMPMGAGAGHGGREEERERAFWLPEDEEFWNNDQEATPPVIG"
FT   gene            685592..687127
FT                   /locus_tag="Tcur_0614"
FT   CDS_pept        685592..687127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0614"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96209"
FT                   /db_xref="GOA:D1A4H4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H4"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACY96209.1"
FT                   /translation="MSGHGVGRTGTSARSARICFHLDFQLIGYLMRRRVLRRRKQSVVA
FT                   FVLAMLLAAAMAAPGGAAVHTQPHPAQWWFTTWGVEDLLWPHSKGKGVTVAVIDTGVQA
FT                   NIPELASAVLPGADFKHENGNARVDWDIVNHGHGTGMASLIAARGGRNGFYGVAPEAKI
FT                   LPIIADTDEAYSKAIPFAVDRGAKVINISQAGPGECDPRLQQAIRYAIDRDVIVVAGAG
FT                   NDGAGSNLSLSPANCKGVVAVGGSTKQNTPWHKSQRQPYVTFVAPAEGVGSVLKDGQFH
FT                   TSEGGTSSATALTSGAIALIRSKFPQMTNREVVRQLIASALDIGPPGWDDQSGAGIIRP
FT                   RLVLNGEIPKNTPNPVFEEYDKWLASQPDSKSQGQERAEEKSGSSAGGAGDSEGGINGP
FT                   LVIALAALVGGGLLIAAFVYFRVRGRRAAVAASHPQPGPYGPQSGMGPVPGQTVGGPPP
FT                   SMGAPMPPQQQWRSASPQSGGPYSGAHGQPPGPSAPGRPPGGTGPQQFPPPQG"
FT   sig_peptide     685592..685765
FT                   /locus_tag="Tcur_0614"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.629 at
FT                   residue 58"
FT   gene            687391..687765
FT                   /locus_tag="Tcur_0615"
FT   CDS_pept        687391..687765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96210"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96210.1"
FT                   /translation="MPPGEKPPPYLPSARSEEIQIAPGKLRDLATELEKDLDKLKKGHH
FT                   AENIQEYSPKDYAFGDYDAGQSLYVSVRNGRDRISETFQTFIEAYEQLIESLRRSADNY
FT                   ERAEDANKRNVGGVGGGAYR"
FT   gene            687795..689195
FT                   /locus_tag="Tcur_0616"
FT   CDS_pept        687795..689195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96211"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96211.1"
FT                   /translation="MTQVRPTYPGSGMNSPIRNEAWQESTEGLGIRDLGIFKVWEDNFE
FT                   KLKTLVNSMKPDQLESGSKHYQNLAKDMNGTVTLLHRVAQDMVKQWGGKDAQAALEQMN
FT                   KAYRQAREIQQTSQQVGQAISNHAAKQKAWKQAYGPGSQTDSWVHEVKRWAGTIFAANP
FT                   ATLPAAPATIVGGFLKNNWDARQGMLEINEGTAASNRQFPEGIRVDMPTVNPNAFQNPP
FT                   GGPGNPGGPGGAPKMPGMPNGPGGPGLPDGPGYPGPGGPGGPNTPDLPGPGGPGGPNYP
FT                   GGDGPGGINPPGGGPGGPNYPGGPNSPGGPSYPGGPNYPGGPNYPGGPNYPGGGGLGSD
FT                   LAGFDPHPRPYGTGPGGNFGPPGGGGAGLPGGGLPGGGGGLPGGMPGGAGGVGGMPGAV
FT                   GGMPGGLGSTGKARAGIGGMGGMGMGMPMGAGAGHGGRQEERERTTWIPEDEDVWTGGE
FT                   EAGPSVIG"
FT   gene            689352..690743
FT                   /locus_tag="Tcur_0617"
FT   CDS_pept        689352..690743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0617"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: nwi:Nwi_2246 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96212"
FT                   /db_xref="GOA:D1A4H7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H7"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACY96212.1"
FT                   /translation="MAVLMVVGAALPGTAATAARHLPQQWWFDAWFIDTKLWKYSKGQG
FT                   VTVAVLDSGVQADIPELSGAVLPGADFQYGTGDGRTDQDTFETNGHGTGIATLIASRGG
FT                   TSGFLGIAPEAKILPVVTQSGPAYTKGIRFAADQGAKVINLSQALSGPCPADLQEAVRY
FT                   AIERDVVIVAGAGNDGDGINSSMYPANCKGVLAVGAADSQGVLWEKTQRQSYVDLAAPG
FT                   VAAAAVLRDGRLKEYISGTSISAALTSGAIALVRSRYPNLSNREVVRRVVASARDIGEP
FT                   GKDDRSGHGLFRPYRIFEGLLPKNPPNPVFEEYDKWLATQPKSAREPETDSKESGPSPA
FT                   GAPSSGDDEVAWPAIVAAALLVGGALTVSAVIYGRVNRRRTAMAVPYGRYGPPPGPPGM
FT                   GPPPGQYPTGGPPPSMGAPMPPQQYPGAPPPGGGPHFLPPAPPQGGGGPQPPQGPPQPP
FT                   PPPQG"
FT   gene            complement(690916..692082)
FT                   /locus_tag="Tcur_0618"
FT   CDS_pept        complement(690916..692082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0618"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: mrd:Mrad2831_3216 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96213"
FT                   /db_xref="GOA:D1A4H8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4H8"
FT                   /inference="protein moti