(data stored in ACNUC7421 zone)

EMBL: CP001739

ID   CP001739; SV 1; circular; genomic DNA; STD; PRO; 4418842 BP.
XX
AC   CP001739; ABUO01000000-ABUO01000028;
XX
PR   Project:PRJNA29539;
XX
DT   20-NOV-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Sebaldella termitidis ATCC 33386, complete genome.
XX
KW   .
XX
OS   Sebaldella termitidis ATCC 33386
OC   Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4418842
RX   PUBMED; 21304705.
RA   Harmon-Smith M., Celia L., Chertkov O., Lapidus A., Copeland A.,
RA   Glavina Del Rio T., Nolan M., Lucas S., Tice H., Cheng J.F., Han C.,
RA   Detter J.C., Bruce D., Goodwin L., Pitluck S., Pati A., Liolios K.,
RA   Ivanova N., Mavromatis K., Mikhailova N., Chen A., Palaniappan K., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Brettin T., Goker M., Beck B.,
RA   Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C.,
RA   Klenk H.P., Chen F.;
RT   "Complete genome sequence of Sebaldella termitidis type strain (NCTC
RT   11300)";
RL   Stand Genomic Sci 2(2):220-227(2010).
XX
RN   [2]
RP   1-4418842
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Sims D., Meincke L., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Eisen J.A.;
RT   "The complete chromosome of Sebaldella termitidis ATCC 33386";
RL   Unpublished.
XX
RN   [3]
RP   1-4418842
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Sims D., Meincke L., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Eisen J.A.;
RT   ;
RL   Submitted (08-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1de8ed1f832ecc26261dc8db962dc776.
DR   BioSample; SAMN02598468.
DR   EnsemblGenomes-Gn; EBG00001133976.
DR   EnsemblGenomes-Gn; EBG00001133977.
DR   EnsemblGenomes-Gn; EBG00001133978.
DR   EnsemblGenomes-Gn; EBG00001133979.
DR   EnsemblGenomes-Gn; EBG00001133980.
DR   EnsemblGenomes-Gn; EBG00001133981.
DR   EnsemblGenomes-Gn; EBG00001133982.
DR   EnsemblGenomes-Gn; EBG00001133983.
DR   EnsemblGenomes-Gn; EBG00001133984.
DR   EnsemblGenomes-Gn; EBG00001133985.
DR   EnsemblGenomes-Gn; EBG00001133986.
DR   EnsemblGenomes-Gn; EBG00001133987.
DR   EnsemblGenomes-Gn; EBG00001133988.
DR   EnsemblGenomes-Gn; EBG00001133989.
DR   EnsemblGenomes-Gn; EBG00001133991.
DR   EnsemblGenomes-Gn; EBG00001133992.
DR   EnsemblGenomes-Gn; EBG00001133993.
DR   EnsemblGenomes-Gn; EBG00001133995.
DR   EnsemblGenomes-Gn; EBG00001133996.
DR   EnsemblGenomes-Gn; EBG00001133997.
DR   EnsemblGenomes-Gn; EBG00001133998.
DR   EnsemblGenomes-Gn; EBG00001133999.
DR   EnsemblGenomes-Gn; EBG00001134000.
DR   EnsemblGenomes-Gn; EBG00001134001.
DR   EnsemblGenomes-Gn; EBG00001134002.
DR   EnsemblGenomes-Gn; EBG00001134003.
DR   EnsemblGenomes-Gn; EBG00001134004.
DR   EnsemblGenomes-Gn; EBG00001134005.
DR   EnsemblGenomes-Gn; EBG00001134006.
DR   EnsemblGenomes-Gn; EBG00001134007.
DR   EnsemblGenomes-Gn; EBG00001134008.
DR   EnsemblGenomes-Gn; EBG00001134009.
DR   EnsemblGenomes-Gn; EBG00001134010.
DR   EnsemblGenomes-Gn; EBG00001134011.
DR   EnsemblGenomes-Gn; EBG00001134012.
DR   EnsemblGenomes-Gn; EBG00001134013.
DR   EnsemblGenomes-Gn; EBG00001134014.
DR   EnsemblGenomes-Gn; EBG00001134015.
DR   EnsemblGenomes-Gn; EBG00001134016.
DR   EnsemblGenomes-Gn; EBG00001134017.
DR   EnsemblGenomes-Gn; EBG00001134018.
DR   EnsemblGenomes-Gn; EBG00001134019.
DR   EnsemblGenomes-Gn; EBG00001134020.
DR   EnsemblGenomes-Gn; EBG00001134021.
DR   EnsemblGenomes-Gn; EBG00001134022.
DR   EnsemblGenomes-Gn; EBG00001134023.
DR   EnsemblGenomes-Gn; EBG00001134024.
DR   EnsemblGenomes-Gn; EBG00001134025.
DR   EnsemblGenomes-Gn; EBG00001134026.
DR   EnsemblGenomes-Gn; EBG00001134027.
DR   EnsemblGenomes-Gn; EBG00001134028.
DR   EnsemblGenomes-Gn; EBG00001134029.
DR   EnsemblGenomes-Gn; EBG00001134030.
DR   EnsemblGenomes-Gn; EBG00001134031.
DR   EnsemblGenomes-Gn; EBG00001134032.
DR   EnsemblGenomes-Gn; EBG00001134033.
DR   EnsemblGenomes-Gn; EBG00001134034.
DR   EnsemblGenomes-Gn; EBG00001134035.
DR   EnsemblGenomes-Gn; EBG00001134036.
DR   EnsemblGenomes-Gn; EBG00001134037.
DR   EnsemblGenomes-Gn; EBG00001134038.
DR   EnsemblGenomes-Gn; EBG00001134039.
DR   EnsemblGenomes-Gn; EBG00001134040.
DR   EnsemblGenomes-Gn; EBG00001134041.
DR   EnsemblGenomes-Gn; EBG00001134043.
DR   EnsemblGenomes-Gn; EBG00001134044.
DR   EnsemblGenomes-Gn; EBG00001134045.
DR   EnsemblGenomes-Gn; EBG00001134046.
DR   EnsemblGenomes-Gn; EBG00001134047.
DR   EnsemblGenomes-Gn; EBG00001134048.
DR   EnsemblGenomes-Gn; EBG00001134049.
DR   EnsemblGenomes-Gn; EBG00001134050.
DR   EnsemblGenomes-Gn; EBG00001134051.
DR   EnsemblGenomes-Gn; EBG00001134052.
DR   EnsemblGenomes-Gn; EBG00001134053.
DR   EnsemblGenomes-Gn; Sterm_R0001.
DR   EnsemblGenomes-Gn; Sterm_R0002.
DR   EnsemblGenomes-Gn; Sterm_R0003.
DR   EnsemblGenomes-Gn; Sterm_R0004.
DR   EnsemblGenomes-Gn; Sterm_R0005.
DR   EnsemblGenomes-Gn; Sterm_R0006.
DR   EnsemblGenomes-Gn; Sterm_R0007.
DR   EnsemblGenomes-Gn; Sterm_R0008.
DR   EnsemblGenomes-Gn; Sterm_R0009.
DR   EnsemblGenomes-Gn; Sterm_R0010.
DR   EnsemblGenomes-Gn; Sterm_R0011.
DR   EnsemblGenomes-Gn; Sterm_R0012.
DR   EnsemblGenomes-Gn; Sterm_R0013.
DR   EnsemblGenomes-Gn; Sterm_R0014.
DR   EnsemblGenomes-Gn; Sterm_R0015.
DR   EnsemblGenomes-Gn; Sterm_R0016.
DR   EnsemblGenomes-Gn; Sterm_R0017.
DR   EnsemblGenomes-Gn; Sterm_R0018.
DR   EnsemblGenomes-Gn; Sterm_R0019.
DR   EnsemblGenomes-Gn; Sterm_R0020.
DR   EnsemblGenomes-Gn; Sterm_R0021.
DR   EnsemblGenomes-Gn; Sterm_R0022.
DR   EnsemblGenomes-Gn; Sterm_R0023.
DR   EnsemblGenomes-Gn; Sterm_R0024.
DR   EnsemblGenomes-Gn; Sterm_R0025.
DR   EnsemblGenomes-Gn; Sterm_R0026.
DR   EnsemblGenomes-Gn; Sterm_R0027.
DR   EnsemblGenomes-Gn; Sterm_R0028.
DR   EnsemblGenomes-Gn; Sterm_R0029.
DR   EnsemblGenomes-Gn; Sterm_R0030.
DR   EnsemblGenomes-Gn; Sterm_R0031.
DR   EnsemblGenomes-Gn; Sterm_R0032.
DR   EnsemblGenomes-Gn; Sterm_R0033.
DR   EnsemblGenomes-Gn; Sterm_R0034.
DR   EnsemblGenomes-Gn; Sterm_R0035.
DR   EnsemblGenomes-Gn; Sterm_R0036.
DR   EnsemblGenomes-Gn; Sterm_R0037.
DR   EnsemblGenomes-Gn; Sterm_R0038.
DR   EnsemblGenomes-Gn; Sterm_R0039.
DR   EnsemblGenomes-Gn; Sterm_R0040.
DR   EnsemblGenomes-Gn; Sterm_R0041.
DR   EnsemblGenomes-Gn; Sterm_R0042.
DR   EnsemblGenomes-Gn; Sterm_R0043.
DR   EnsemblGenomes-Gn; Sterm_R0044.
DR   EnsemblGenomes-Gn; Sterm_R0045.
DR   EnsemblGenomes-Gn; Sterm_R0046.
DR   EnsemblGenomes-Gn; Sterm_R0047.
DR   EnsemblGenomes-Gn; Sterm_R0048.
DR   EnsemblGenomes-Gn; Sterm_R0049.
DR   EnsemblGenomes-Gn; Sterm_R0050.
DR   EnsemblGenomes-Gn; Sterm_R0051.
DR   EnsemblGenomes-Gn; Sterm_R0052.
DR   EnsemblGenomes-Gn; Sterm_R0053.
DR   EnsemblGenomes-Gn; Sterm_R0054.
DR   EnsemblGenomes-Gn; Sterm_R0055.
DR   EnsemblGenomes-Gn; Sterm_R0056.
DR   EnsemblGenomes-Gn; Sterm_R0057.
DR   EnsemblGenomes-Tr; EBT00001725215.
DR   EnsemblGenomes-Tr; EBT00001725216.
DR   EnsemblGenomes-Tr; EBT00001725217.
DR   EnsemblGenomes-Tr; EBT00001725218.
DR   EnsemblGenomes-Tr; EBT00001725219.
DR   EnsemblGenomes-Tr; EBT00001725220.
DR   EnsemblGenomes-Tr; EBT00001725221.
DR   EnsemblGenomes-Tr; EBT00001725222.
DR   EnsemblGenomes-Tr; EBT00001725223.
DR   EnsemblGenomes-Tr; EBT00001725224.
DR   EnsemblGenomes-Tr; EBT00001725225.
DR   EnsemblGenomes-Tr; EBT00001725226.
DR   EnsemblGenomes-Tr; EBT00001725227.
DR   EnsemblGenomes-Tr; EBT00001725229.
DR   EnsemblGenomes-Tr; EBT00001725230.
DR   EnsemblGenomes-Tr; EBT00001725231.
DR   EnsemblGenomes-Tr; EBT00001725233.
DR   EnsemblGenomes-Tr; EBT00001725234.
DR   EnsemblGenomes-Tr; EBT00001725235.
DR   EnsemblGenomes-Tr; EBT00001725236.
DR   EnsemblGenomes-Tr; EBT00001725237.
DR   EnsemblGenomes-Tr; EBT00001725238.
DR   EnsemblGenomes-Tr; EBT00001725239.
DR   EnsemblGenomes-Tr; EBT00001725240.
DR   EnsemblGenomes-Tr; EBT00001725241.
DR   EnsemblGenomes-Tr; EBT00001725242.
DR   EnsemblGenomes-Tr; EBT00001725243.
DR   EnsemblGenomes-Tr; EBT00001725244.
DR   EnsemblGenomes-Tr; EBT00001725245.
DR   EnsemblGenomes-Tr; EBT00001725246.
DR   EnsemblGenomes-Tr; EBT00001725247.
DR   EnsemblGenomes-Tr; EBT00001725248.
DR   EnsemblGenomes-Tr; EBT00001725249.
DR   EnsemblGenomes-Tr; EBT00001725250.
DR   EnsemblGenomes-Tr; EBT00001725251.
DR   EnsemblGenomes-Tr; EBT00001725252.
DR   EnsemblGenomes-Tr; EBT00001725253.
DR   EnsemblGenomes-Tr; EBT00001725254.
DR   EnsemblGenomes-Tr; EBT00001725255.
DR   EnsemblGenomes-Tr; EBT00001725256.
DR   EnsemblGenomes-Tr; EBT00001725257.
DR   EnsemblGenomes-Tr; EBT00001725258.
DR   EnsemblGenomes-Tr; EBT00001725259.
DR   EnsemblGenomes-Tr; EBT00001725260.
DR   EnsemblGenomes-Tr; EBT00001725261.
DR   EnsemblGenomes-Tr; EBT00001725262.
DR   EnsemblGenomes-Tr; EBT00001725264.
DR   EnsemblGenomes-Tr; EBT00001725265.
DR   EnsemblGenomes-Tr; EBT00001725266.
DR   EnsemblGenomes-Tr; EBT00001725267.
DR   EnsemblGenomes-Tr; EBT00001725268.
DR   EnsemblGenomes-Tr; EBT00001725269.
DR   EnsemblGenomes-Tr; EBT00001725270.
DR   EnsemblGenomes-Tr; EBT00001725271.
DR   EnsemblGenomes-Tr; EBT00001725272.
DR   EnsemblGenomes-Tr; EBT00001725273.
DR   EnsemblGenomes-Tr; EBT00001725275.
DR   EnsemblGenomes-Tr; EBT00001725276.
DR   EnsemblGenomes-Tr; EBT00001725277.
DR   EnsemblGenomes-Tr; EBT00001725278.
DR   EnsemblGenomes-Tr; EBT00001725279.
DR   EnsemblGenomes-Tr; EBT00001725280.
DR   EnsemblGenomes-Tr; EBT00001725281.
DR   EnsemblGenomes-Tr; EBT00001725282.
DR   EnsemblGenomes-Tr; EBT00001725283.
DR   EnsemblGenomes-Tr; EBT00001725284.
DR   EnsemblGenomes-Tr; EBT00001725285.
DR   EnsemblGenomes-Tr; EBT00001725286.
DR   EnsemblGenomes-Tr; EBT00001725287.
DR   EnsemblGenomes-Tr; EBT00001725288.
DR   EnsemblGenomes-Tr; EBT00001725289.
DR   EnsemblGenomes-Tr; EBT00001725290.
DR   EnsemblGenomes-Tr; EBT00001725291.
DR   EnsemblGenomes-Tr; EBT00001725292.
DR   EnsemblGenomes-Tr; EBT00001725293.
DR   EnsemblGenomes-Tr; Sterm_R0001-1.
DR   EnsemblGenomes-Tr; Sterm_R0002-1.
DR   EnsemblGenomes-Tr; Sterm_R0003-1.
DR   EnsemblGenomes-Tr; Sterm_R0004-1.
DR   EnsemblGenomes-Tr; Sterm_R0005-1.
DR   EnsemblGenomes-Tr; Sterm_R0006-1.
DR   EnsemblGenomes-Tr; Sterm_R0007-1.
DR   EnsemblGenomes-Tr; Sterm_R0008-1.
DR   EnsemblGenomes-Tr; Sterm_R0009-1.
DR   EnsemblGenomes-Tr; Sterm_R0010-1.
DR   EnsemblGenomes-Tr; Sterm_R0011-1.
DR   EnsemblGenomes-Tr; Sterm_R0012-1.
DR   EnsemblGenomes-Tr; Sterm_R0013-1.
DR   EnsemblGenomes-Tr; Sterm_R0014-1.
DR   EnsemblGenomes-Tr; Sterm_R0015-1.
DR   EnsemblGenomes-Tr; Sterm_R0016-1.
DR   EnsemblGenomes-Tr; Sterm_R0017-1.
DR   EnsemblGenomes-Tr; Sterm_R0018-1.
DR   EnsemblGenomes-Tr; Sterm_R0019-1.
DR   EnsemblGenomes-Tr; Sterm_R0020-1.
DR   EnsemblGenomes-Tr; Sterm_R0021-1.
DR   EnsemblGenomes-Tr; Sterm_R0022-1.
DR   EnsemblGenomes-Tr; Sterm_R0023-1.
DR   EnsemblGenomes-Tr; Sterm_R0024-1.
DR   EnsemblGenomes-Tr; Sterm_R0025-1.
DR   EnsemblGenomes-Tr; Sterm_R0026-1.
DR   EnsemblGenomes-Tr; Sterm_R0027-1.
DR   EnsemblGenomes-Tr; Sterm_R0028-1.
DR   EnsemblGenomes-Tr; Sterm_R0029-1.
DR   EnsemblGenomes-Tr; Sterm_R0030-1.
DR   EnsemblGenomes-Tr; Sterm_R0031-1.
DR   EnsemblGenomes-Tr; Sterm_R0032-1.
DR   EnsemblGenomes-Tr; Sterm_R0033-1.
DR   EnsemblGenomes-Tr; Sterm_R0034-1.
DR   EnsemblGenomes-Tr; Sterm_R0035-1.
DR   EnsemblGenomes-Tr; Sterm_R0036-1.
DR   EnsemblGenomes-Tr; Sterm_R0037-1.
DR   EnsemblGenomes-Tr; Sterm_R0038-1.
DR   EnsemblGenomes-Tr; Sterm_R0039-1.
DR   EnsemblGenomes-Tr; Sterm_R0040-1.
DR   EnsemblGenomes-Tr; Sterm_R0041-1.
DR   EnsemblGenomes-Tr; Sterm_R0042-1.
DR   EnsemblGenomes-Tr; Sterm_R0043-1.
DR   EnsemblGenomes-Tr; Sterm_R0044-1.
DR   EnsemblGenomes-Tr; Sterm_R0045-1.
DR   EnsemblGenomes-Tr; Sterm_R0046-1.
DR   EnsemblGenomes-Tr; Sterm_R0047-1.
DR   EnsemblGenomes-Tr; Sterm_R0048-1.
DR   EnsemblGenomes-Tr; Sterm_R0049-1.
DR   EnsemblGenomes-Tr; Sterm_R0050-1.
DR   EnsemblGenomes-Tr; Sterm_R0051-1.
DR   EnsemblGenomes-Tr; Sterm_R0052-1.
DR   EnsemblGenomes-Tr; Sterm_R0053-1.
DR   EnsemblGenomes-Tr; Sterm_R0054-1.
DR   EnsemblGenomes-Tr; Sterm_R0055-1.
DR   EnsemblGenomes-Tr; Sterm_R0056-1.
DR   EnsemblGenomes-Tr; Sterm_R0057-1.
DR   EuropePMC; PMC5093955; 27809782.
DR   EuropePMC; PMC5414144; 28464950.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001739.
DR   SILVA-SSU; CP001739.
DR   StrainInfo; 120712; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084069
CC   Source DNA and organism available from ATCC: ATCC 33386
CC   (www.atcc.org)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Sebaldella termitidis ATCC 33386
CC   Culture Collection ID :: ATCC 33386, NCTC 11300
CC   GOLD Stamp ID         :: Gi02490
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: termite intestine
CC   Host Name             :: Termite
CC   Body Sample Site      :: Gastrointestinal tract
CC   Body Sample SubSite   :: Gut
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Gut, Host
CC   Phenotypes            :: Uricolytic
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4418842
FT                   /organism="Sebaldella termitidis ATCC 33386"
FT                   /strain="ATCC 33386"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:526218"
FT                   /culture_collection="ATCC:33386"
FT   gene            361..1719
FT                   /locus_tag="Sterm_0001"
FT   CDS_pept        361..1719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: glo:Glov_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06889"
FT                   /db_xref="GOA:D1AIS7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIS7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACZ06889.1"
FT                   /translation="MVDPIVLWEKIIKILKYQIDEVEFNTYIKPLNVHEYKDNTLYVWV
FT                   ESTFMKEKVEQRYKLNMMEIINDILMMEASQRINIIFELKQAAEEKFENYISVMDTQKK
FT                   LINNLNQRYRFENFVVGKGNELANAACIAISQNPGIVYNPLLIYGGSGLGKTHLMHAVG
FT                   NAILDKDPNKKVLYCTSENFNNEFINSLRAGQFANVQNFRDKFRTLDVLLIDDIQFFEK
FT                   VFGQGTGSVEEEFFHTFNTLQELGKQIIMSSDRLPREIRNLSKRIESRFDSGLSVDVQK
FT                   PDYETRLAILKNIADSKSVIISDEVLEFISSSISSNIRELEGALTRVIARSTLLRKAIT
FT                   LQLVQEDLADLLKKQQSKITANKIITTVSGYYSIPLDEMKGKKRQQEITNARQIAMFLL
FT                   KDQLDLNLTTIGGLFGGRDHSTVISSIRKIETRMKEEIVFKKEIDNIKQKIVE"
FT   gene            1805..2017
FT                   /locus_tag="Sterm_0002"
FT   CDS_pept        1805..2017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0002"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   ppd:Ppro_0618 RNA-binding S4 domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06890"
FT                   /db_xref="GOA:D1AIS8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIS8"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACZ06890.1"
FT                   /translation="MKEVEIKTEFIKLDQLLKWAGMVGDGGEARYHILEGNVRVNGETE
FT                   KRRGKKIYENDIIELDGEKIKIVRG"
FT   gene            2019..3107
FT                   /locus_tag="Sterm_0003"
FT   CDS_pept        2019..3107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: geo:Geob_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06891"
FT                   /db_xref="GOA:D1AIS9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIS9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACZ06891.1"
FT                   /translation="MKLKQLSLNNFRCLENKKIEFDPDFNLIYGKNGQGKTSLIEAVYF
FT                   LATGKSFRTKKVKELTSYDKIRTIVYGSFESKLSGKTIAIDFNNDKKEYYVDKNKTKYI
FT                   DYVGILNVISFIPEDIEIIIGNPSVRRGFFNYEISQTKNIYLKTLVDFEKILKTRNKLI
FT                   KERKTNKELYHIYNEKFIEEGSKIILMRKEYVKNISRLLNLNYRKLFDANSELRLKYDS
FT                   FIDNIDKMTLEEIKEKFREETVKKHDREKRYGYTLVGPQKEDFVFELNGKNAKAFSSQG
FT                   EKKSIIFSLKIAEIDMLIKEKNEIPVFLIDDISSYFDEIRKNSILNYFKNKNIQCFITS
FT                   TEKLDIEGKKIYIDKGRILSDE"
FT   gene            3100..3960
FT                   /locus_tag="Sterm_0004"
FT   CDS_pept        3100..3960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   geo:Geob_1482 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06892"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT0"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACZ06892.1"
FT                   /translation="MNKKKLNRIGEVSISRITENDRYMIHIIRKNWKKIVGDVIAEYSF
FT                   PSFFSKGKLTVIVENNLIMSEMKMYRETILENVNEEFHGTAVSEIYIKGGKIHNNRDIY
FT                   NEHKETEETAEITAEEKEKIERLFPDVENNELAERIKNIALNSKINEKILLKKGYIECE
FT                   RCGDLFLGEEEMCIKCRNELENEKMGRIKKLIEKNPVISYRETEREIEELTEGEFYKAR
FT                   DQLAEDLTLFVSELIEQNNLKEAGETAEKYALYRTGSSEVYIINKVKEELLNRLTKFLK
FT                   LRGRI"
FT   gene            3962..4213
FT                   /locus_tag="Sterm_0005"
FT   CDS_pept        3962..4213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06893"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06893.1"
FT                   /translation="MYIYIENNNFIPLKDIILIIEHSDFVKDKKNRDYLNKYRKKIIDL
FT                   SRKEPRTIIMTNEFIYISSYTNRALKMRAEEMENLKNL"
FT   gene            4237..4917
FT                   /locus_tag="Sterm_0006"
FT   CDS_pept        4237..4917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0006"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: dvl:Dvul_0005 DNA gyrase, B subunit; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06894"
FT                   /db_xref="GOA:D1AIT2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT2"
FT                   /inference="protein motif:PRIAM:5.99.1.3"
FT                   /protein_id="ACZ06894.1"
FT                   /translation="MSEIFDAKSIAVLGIMEGIRKKPEMFIGSVSAEGLCNLVWEIIDN
FT                   CVNEALEGFCNTIKVRLLKNNIIEVSDNGRGLPVDFYEKAGKSKLEVILTGKYIRGELT
FT                   GGIYKLSRKKYKGGLVSVNGLSETLEAVVIKDGKVWYQKYHKGVPSGDIKKTGEKSEYI
FT                   HGTVIRFRADREIFGELEYDYEILLAKLKEIRGIKVILCDERNEAAGKTESFYFNGEIR
FT                   EFLK"
FT   gene            5057..6985
FT                   /locus_tag="Sterm_0007"
FT   CDS_pept        5057..6985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0007"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: glo:Glov_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06895"
FT                   /db_xref="GOA:D1AIT3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT3"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACZ06895.1"
FT                   /translation="MSDNYNAESITVLEGLEAVRKRPGMYIGSTSAKGLHHLVWEVVDN
FT                   SVDEALAGFCDTIKVRVLEDNIIEVIDNGRGIPVEMHEKMGKSTLEVVLTVLHAGGKFN
FT                   NDNYKVSGGLHGVGVSVVNALSETLEAIITKDGKVWYQKYHRGVPEEDIKQIGEAPEDA
FT                   HGTTIRFKADGEIFETLEYDYEILLTRLKEMAYLNKGLRIILSDERQKDKPKTDDLHFE
FT                   GGIRDFLSEIADDERVLDDIIYMDDSVELDNKKRVEVEIAMTYTISQREMVYSFVNNIN
FT                   THEGGTHVSGYRTALTRVLNEISKQMGLVKDKDGSFQGSDVREGLVAILSIKIPEPQFE
FT                   GQTKTKLGNSEITGVVSGIVGSSLKMYLEDHPKEASNIIEKILMSKKAREAAKKARELV
FT                   LRKSSLEVGSLPGKLADCSSKDASECEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKIL
FT                   NVEKAGIGRALENAEIRAMITAFGAGFGDEMDLEKLRYHKIIIMTDADVDGAHIRTLML
FT                   TFFYRHLRELINEGHIYIAQPPLYKVQAGKQIQYVYSDEQLQSVTKVMDQENKRYGIQR
FT                   YKGLGEMNPEQLWETTMDPEVRTLLKVSLEDATYADKMFNVLMGDKVEPRRQFIEEHAQ
FT                   YVRNLDI"
FT   gene            7000..9459
FT                   /locus_tag="Sterm_0008"
FT   CDS_pept        7000..9459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0008"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pca:Pcar_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06896"
FT                   /db_xref="GOA:D1AIT4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT4"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACZ06896.1"
FT                   /translation="MSIKETEILAEKPIYIEDEIKASYLDYSMSVIVSRALPDVRDGLK
FT                   PVHRRILFAMNELGMTYDKPYKKSARIVGEVLGKYHPHGDSAVYGAMVRLAQEFNTRYL
FT                   LINGHGNYGSIDGDGAAAMRYTEARMAKISNELLEDIDKNTIDFRKNFDESLDEPTVLP
FT                   AKLPNLLLNGATGIAVGMATNIPPHNAGEVCDGIVAMIENPDITIDELITYITGPDFPT
FT                   GGIINGRSGIIEAYKTGRGKVRVAGKIKIEESKNGKESIIVNELPYQVNKARLIERIAE
FT                   LVRNKKLTGISDLRDESDRDGIRVVIELKRGEESELILNSLYKYTDLQNTFGIIFLALV
FT                   DNAPRVLNLKEILQNYLKHRYSVVTRRTKFELDKAEKRAHILEGFKIALDNIDEVIKII
FT                   RGSQDGNEAKDKLMAGFAFSEVQAKAILDMRLQRLTGLERGKIEEEYKELMLLIEELKA
FT                   ILSDPDKIYAIIKEEVKKIKEDFSDPRRTEIRDARVEIGIEDLIKDEEVVVTLTDKGYV
FT                   KRTPIDVYRAQKRGGIGVSATNILEDDIIKDMYIAKNLDSLLIFTTKGKVHDIKVYEIP
FT                   EASKQARGRLISNIIKLQEDEMVSTIIKVREFEKDKDIFFVTRKGVVKKTNLELFASIN
FT                   KAGIKAIGLKDDDELIFAGLTSGTLKDEIFLATREGFAIRFSENDVRSMGRTASGVKGI
FT                   TLRPEDVIVAGAIIYASEDLSGKTILTISEEGYGKRTKLEEYRLQSRGGKGITNLKKNT
FT                   KTGKISDVKIVDDSSEIMLITSEGTLIRTQVNSISIIGRATSGVRIMKVRENEKVASTV
FT                   KITPEIE"
FT   gene            9477..10232
FT                   /locus_tag="Sterm_0009"
FT   CDS_pept        9477..10232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06897"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06897.1"
FT                   /translation="MLRKALFIVSNENELKAIKEFSRVFTEKYKDFVLDALYVKDILKY
FT                   EIFPSTIEGIGIDIGSTYIIEEWKELEENNFKTMKSQLKDSFANIFVEEGETVEVCLEK
FT                   LKAYDILILLKGENIGPYLKEILRVHYKPMIILPEAESYKLDKVLLLDDGGYKANRTLF
FT                   NYYNNFGESKVDVLRVNVDEKDELKDRFGENYHLIDKEGDPLKIILAEAENYDMILMGT
FT                   LKFAVMVEKITGKFGVRIIEKIKKPIFIG"
FT   gene            10503..11189
FT                   /locus_tag="Sterm_0010"
FT   CDS_pept        10503..11189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06898"
FT                   /db_xref="GOA:D1AIT6"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06898.1"
FT                   /translation="MIFYTNKGKNLLEIFSIAFFSWCIGFLIFFAGGLFLLNRMGYLET
FT                   FDDYNNKVSVYVDERIEKKDLPDFRAPGYKQARAEYDKYLREIPGKKMALSNEYKRENP
FT                   RKTIEVWHQILLIGILPLVFTLLVSKKYNGSLINSIEISGDTVTVAKKNKKIKKYDMNN
FT                   YFVQLFTTTVISWKHLFIPYKLYHVNLLDIADKKKLKDTIYLYNFNRKDLEEILELIEG
FT                   YQKRYV"
FT   gene            11398..11862
FT                   /locus_tag="Sterm_0011"
FT   CDS_pept        11398..11862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0011"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: geo:Geob_2907
FT                   phosphodiesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06899"
FT                   /db_xref="GOA:D1AIT7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT7"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACZ06899.1"
FT                   /translation="MKVLICSDSHKRLDIFQKVIDRELPEVVIFAGDHSTDALDMSYVY
FT                   SGIKFFIVRGNTDYFDRDTSDELVIELEKEKILLVHGHLFGVKSYMSELEKEAESDGVS
FT                   MCIFGHTHIPYYKEKNKIKYINPGAMQNGNYAIWEGKKIELRNVVNKYKN"
FT   gene            complement(12200..12949)
FT                   /locus_tag="Sterm_0012"
FT   CDS_pept        complement(12200..12949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0012"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   scl:sce4004 DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06900"
FT                   /db_xref="GOA:D1AIT8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT8"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACZ06900.1"
FT                   /translation="MLKEERQQKILELLDEKQKVIASDLSQLFQVSEDTIRRDLKELDQ
FT                   KKLVRRVHSGALRIGPPVTDFEKRLKISNNLKENLARKALPYIQENTVILIDGGTTNLH
FT                   LVNSLPINFKATVITNSPPIAMALAYHEQIEVLMIGGTLYKQSMVNLGIDTVEYLSNVR
FT                   ADTYIMGIYNIDDQIGISVPTISESLVKRKMASISTEIIGLVTLDKLGTVSNQIICPAD
FT                   TLTYLITENVNPNIAKLYTKQKVAVIQ"
FT   gene            13279..20109
FT                   /locus_tag="Sterm_0013"
FT   CDS_pept        13279..20109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0013"
FT                   /product="Autotransporter beta-domain protein"
FT                   /note="PFAM: Autotransporter beta- domain protein; KEGG:
FT                   elf:LF82_p222 EntS EntS/YbdA MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06901"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIT9"
FT                   /inference="protein motif:PFAM:PF03797"
FT                   /protein_id="ACZ06901.1"
FT                   /translation="MRKNKKLLVGFLAVNSILNASTGSNDNVIKNDKLFNKMVKNIESG
FT                   KSNDENYKLIEKILNKRNAELKDLYLQNDYVVKPEYLEWQWFATGFYTERGRGDNTSDN
FT                   AQYRSTTEGYYNEDGEYIVTEGKPYMPVQGVKTINLGMSIPVKGLNLGAISISPGEVKL
FT                   PNIEEVTVNITVPSTPTVGNVNLPAFTPTAPAVNTPSIFTPPALDKVSTGFAQGDPVGF
FT                   RPQINVILGNSSAAPISGTTTVTSLGTSQFSITGSGFTWNGYNDSTTTSGTVTTGTYSM
FT                   NTNSYPYTFLNVLAGSSTLSGNWIYRNQTTGASPNTARFVSVNHAYGARHLNTEFHLAG
FT                   DTSIYGRNDGHMTVGIEYQAYDALSAKAIIDSGTTLTLESGKNLFGMTLMIESPYYRDD
FT                   FTKIPIDTTCASGICRPMENLPIYSTAENRGKIVINSQESIGIDFAKYTVPSSDGSNPM
FT                   AIYVKPGNIEINGSSNYGIRVPNIFDYGNLGGAYSRTSQLGTVVYSSNGKEQNYFKETI
FT                   IDGSGGMVTVGGSQNVGISLSKKITGSTQVAGVQGLTASDSADLIGNIRNLNITVNGTE
FT                   GIGILRNANYVEKDDSTGLPFGDIVLKNINVESLSFGTEAEKSVLIRSDRSKLILEKDL
FT                   ILTSTLSAGKSDNIVMLANNSATANALDPLYTAKAENRAEINIGAGLYKTTGLLSANGG
FT                   EATNSTAGEIIVNSEESQGMAVLVNSKGFNSGIITVLGTKSVGIANMGEFTMTAGEIDA
FT                   SGDQSVGVYGADNNNKTNINGGTVKVSNNGIGFFAGDNATINISGASLEANDKGLLFYT
FT                   YKNSSALTSSGHINITGTVNATINAGGTAFYLKDDLSQITNFINSVFTGSGKLNLNMAS
FT                   SDSRLFILDSPANDIYLSSSSSSAIESLIPSSKVSITGTGYKPYAVFKGTLVVDQNVNL
FT                   DDTNDAYNRLDFMSSKTIINPGIIMSGTGNNVSAVGQRNYTGTSGRNEVIVINNGTIKQ
FT                   TGQNVIGIVTDYGNITNAGLISSTGDNSIGIYGANGTISKNTGKIEIGNTGIGIYGGNL
FT                   LTASAPGYGDQKIEIENDSEIKSAGATGGIGIYADNTALALGDSTVKLGTNSDINMVSA
FT                   ENGVGVYGKTTTVSGGGTISVGKNGIGMHLLDSTAGLSNITMNLSGDNAVGYNIAGTST
FT                   FTGSGVFNTNGNNTVLFNMQKTAPSTAYIDFSGFSVSGTGNYVGGNIENAGFYYSNSGT
FT                   VNEKSTIAAGKNSVILFDAGTNINASGSSNVIGIADGTYNGGMPFSFAGTTADKELTNR
FT                   GIISAGDKSAVLYAKNNAAMLNAGTVTVGKESVGLYGVSVNDVENKGTINVGENSKGIY
FT                   LKDGVLTGVLNSGKILSSSDTAVGIISDYNGGSTTLIKTTDEIKLTGENSVGIYTTGTG
FT                   IQNVENIGLIEIGASSDRNNPGMAIYNTGIGNTVLNTGTITAGNNSLGIYSKGGAVTES
FT                   GNLNVGNSGTGIYSDGGSVIINNLGSMNIGANAAVGVYGANNANIQNNFANIGIGNGSY
FT                   GFIAESGSNVTNTAAQILGENSVLVYGNGAGNIINTASGNISAAGSGNIVFYTTGGGTV
FT                   INDGNITADIGKSNIGIYNNGGSITNTGTVSVGDTELAYDSSGNVDVLNSRYAVGIYGE
FT                   ASKVENHGNLNIGNNAVGLYVKDNTITALNYGNIYAGTSASPKNGAIGIFSEGGAGVEN
FT                   HGNITLYGNDVIGIAGKGSAKVTNHGIITVEGQGATGIYGTLNTVVDNQGTINVSGTDS
FT                   VGIIAPKGKILNNGTINFINGAKMTAMDNEYEIPELINAGIIKVNGNFENEGMKISLKP
FT                   DLNTLQESSVAGIDFVMNSGSISADTLTITDTVKILPDFSQGTNAKVYKLENAFISSNI
FT                   ISVTGKLPVVSNSLTWEATPSVNSDGNIDIYMSKIDYHDFTDGLWYDDFGKALDENYYG
FT                   SAGDAGKIYDKLDLIENEKDFRHVMESLAGNIYANINQREEDIARSFENSMTLMQNSDN
FT                   NTKENVKINIIAGKGRTKEDTDGIVNYDYTTTGVLALREVERTYKHTFGYSLGYLHTGF
FT                   EFKDGNSSEEWVDTVQMGVHNKYKANGWNLRNDLTGRVSFHNIDRNIDWPSPTGRSEMN
FT                   GSYETYSITSDNIFGKELSVGKNTSIVPYGALRAMYVTRPDFSESGEESLKVEGNDAWS
FT                   VKPRAGVELKTAVPLSDSGWQLKGALDIAYEYELADLNEREYAKLSAVENNYHKLSKPE
FT                   DEKGTLRTRASVGVEVKDRYGIFLTGEYGVGNNSEDDYRAGLTLKAVF"
FT   sig_peptide     13279..13341
FT                   /locus_tag="Sterm_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.683 at
FT                   residue 21"
FT   gene            20328..20906
FT                   /locus_tag="Sterm_0014"
FT   CDS_pept        20328..20906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06902"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06902.1"
FT                   /translation="MKKGLIILTLISLLSAGALAQGEESYFYGGRQENVMKKNLEKNLN
FT                   LTQDQKDKLKVLREETKDKIKALSSEDQTREEFIQSLQSIKDDQKSELNEILTPAQQKM
FT                   VESKEAAVQKRREDFEKKLNLTDEQKSKISSIREEYYQKMRALDTEELTEAQHKKEMAK
FT                   LVKEEIQARDQVLTAQQKTFLKSERNKMK"
FT   sig_peptide     20328..20390
FT                   /locus_tag="Sterm_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 21"
FT   gene            20984..21382
FT                   /locus_tag="Sterm_0015"
FT   CDS_pept        20984..21382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06903"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06903.1"
FT                   /translation="MRKTIILLLALMSFFSFSKNYEKAEDKKEGVSSIYLILKEGKGNS
FT                   YDFFFEYVIDTGSLLPKLRQAAGTAYKNGNKYVCKDLRGEQITFDIRKDQVVISGSDYL
FT                   EGVYNYLSESAKEDYETVEWALEEEKGY"
FT   sig_peptide     20984..21040
FT                   /locus_tag="Sterm_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.921 at
FT                   residue 19"
FT   gene            complement(21428..21961)
FT                   /locus_tag="Sterm_0016"
FT   CDS_pept        complement(21428..21961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0016"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: dno:DNO_0925
FT                   phosphoesterase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06904"
FT                   /db_xref="GOA:D1AIU2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACZ06904.1"
FT                   /translation="MIYFTADTHFFHSNIINLCDRPFKNVDEMNKVLIRNWNSYITELD
FT                   EIYILGDFLFKGTGSQANAILNTLKGKKYLIRGNHDKFLNDENFDMSAFEWVKDYFVLN
FT                   YKKMKFVLFHYPILEWDGFFKDSVHLYGHVHNSGKDPGQNKRLSVLENKAFNVGVDVNN
FT                   FFPVSIETIIKKQQ"
FT   gene            complement(22107..23291)
FT                   /locus_tag="Sterm_0017"
FT   CDS_pept        complement(22107..23291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0017"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="KEGG: cjd:JJD26997_1065 carboxypeptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06905"
FT                   /db_xref="GOA:D1AIU3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU3"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACZ06905.1"
FT                   /translation="MTDRIKKLAEKYSSVIMGAREYFHANPGIEFQEFETTKKIIEILE
FT                   EHGIEYQKDIAVTGILAIVRGKKEGKTVLLRGDMDALPIEEESDVPYKSKVKGVMHACG
FT                   HDSHAAGLLGAALILNELKDEITGNIKFAFQPAEENQGGAKPMIDAGILENPKVDAAFG
FT                   LHVWGPYPEGKALTMKGPMMAAPDNIRIKLIGKGGHASMPNMLIDPVVMAAEVILSLQT
FT                   IVSRKVDPLEPAVISCCSIHGGSAQNVIPNEVEITGTVRTLNEEVRRKMPELMEQTIKG
FT                   ITDIYNGAYEFDYHFGFPCLVNDAKSTETLISAAGKILGNENVDIMAKPVMGGEDFAYF
FT                   TQEVPSAFIFLGVAEDMENPPVHHHPKFAFHSKNTVTSSEILTQAALDFLENSK"
FT   gene            complement(23383..24918)
FT                   /locus_tag="Sterm_0018"
FT   CDS_pept        complement(23383..24918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0018"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; C4-dicarboxylate
FT                   anaerobic carrier; short chain fatty acid transporter;
FT                   KEGG: ilo:IL1666 p-aminobenzoyl-glutamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06906"
FT                   /db_xref="GOA:D1AIU4"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU4"
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /protein_id="ACZ06906.1"
FT                   /translation="MKTKKLNFFERFLNFFENVGNKMPDPVTLSFILCILVIIISKFVA
FT                   TTGISAIHPKSGETLLAVDLLTKTGFQKIFTSIISNFQGFPPLGVVLVTMFGAGVAEKT
FT                   GFMEELLKVTTVKIPKPLVTACILFIGILANAAGDAGFIILPPLAAIIFISLKRHPLVG
FT                   MLAAYAGVAAGFAANIFISISDVLAATFTIPAAQILDKNYTGTVAMNFYFLFVSTFVLV
FT                   ITGVFVTEKIIAPRFEGVEYDYHDEKIKDALDEDTRKKALKYSLISLGIFSVIVILLCI
FT                   GDNAFFRDPETGSLTSSSSILMKSIVLLVTLAFFIPGVVYGIIVKKIRTDKDLVHLMGQ
FT                   SMSDMGLYIVLAFASAQFLAFFNESNLASIFSIKGAEGLKNLGISGIPLMILFIILSSV
FT                   INLFIGSASAKWAIMAPIFVPMFMLLGYNPALIQMAYRIGDSVTNPLSPLFPYFPILLA
FT                   VARKYDKKAGLGTLISNMIPYSLFFGIVWTLLLILFIIFNIPLGPDAGIHYSF"
FT   gene            complement(25102..26586)
FT                   /locus_tag="Sterm_0019"
FT   CDS_pept        complement(25102..26586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0019"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: gme:Gmet_2360 lysyl-tRNA
FT                   synthetase, class-2"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06907"
FT                   /db_xref="GOA:D1AIU5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU5"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACZ06907.1"
FT                   /translation="MSEQQINEKSIIGEKLKKVEELKALGIEPYGRKFDKKDDIEDILK
FT                   FDETSDKTFKTAGRIVAFRRMGKNGFGHIQDLSGKIQYYVKKDTVGEENYEIYKKLGVG
FT                   DFIGIEGTLFRTQTGELTLRASSFEVLSKNIRPLPEKFHGLTDVETRYRQRYVDLVMNN
FT                   DVKETFITRFKILRFIRNFLENKGFLEVETPMLHPIAGGANAKPFITHHNALDMDFFLR
FT                   IAPELYLKRLLVGGFEKVFEINRSFRNEGTSIKHNPEFTMLELYQAYADFEDIMNLTEE
FT                   LVSSLVEELFGTTKLTYQDTEIDFTRPWKRIKMKDAVKDATGFDLDSINSDEEALNLVK
FT                   SMNIPLEKDKAYTKYGLLNLLFEEKVEATLMNPTFITEYPKEISPLSKNKKDSVDFVDR
FT                   FEMFIYGREHANAFSELNDPVEQKERFDAQEKMKEAGDDEAHETDLDYIRALEYGMPPA
FT                   GGLGIGIDRLTMLLTDSFSIRDVLLFPALKKEDFEL"
FT   gene            complement(26657..27025)
FT                   /locus_tag="Sterm_0020"
FT   CDS_pept        complement(26657..27025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcc:BCc_201 YoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06908"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06908.1"
FT                   /translation="MYLLIKSEDQFGNKYEKSFISQKTLLDNGIIYSYSDDHGESKIFL
FT                   YENHIEIYRKGQINTKQIFKPKEMTNFLYLTKEFKKNLFLNTNFLDISEKNIYLIYDVI
FT                   DENEVINTIKLKIIELEP"
FT   gene            complement(27031..27423)
FT                   /locus_tag="Sterm_0021"
FT   CDS_pept        complement(27031..27423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06909"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU7"
FT                   /inference="similar to AA sequence:KEGG:EHI_007510"
FT                   /protein_id="ACZ06909.1"
FT                   /translation="MFSVGEDFEVMIDDVNEYFNCIANLTIKGKEYIIAENEEGTKRAF
FT                   LCDSNDDEIIVLAEDEEEDILNIWEEDYYGADKDYMFWNEEFEEYDKPTKEDLEYDESE
FT                   PDDIHEVDDLDESEEDLEDFIENLLD"
FT   gene            complement(27446..27913)
FT                   /locus_tag="Sterm_0022"
FT   CDS_pept        complement(27446..27913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0022"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   dps:DP2216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06910"
FT                   /db_xref="GOA:D1AIU8"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU8"
FT                   /inference="protein motif:PFAM:PF02590"
FT                   /protein_id="ACZ06910.1"
FT                   /translation="MLKINVTAVGKIKDSYIKDGILEFKKRLQKFSNFSIIELQEESEN
FT                   RGIESAVNTESKRILESIEGKNYYNILLDLDGIAVSSPAMAQKIMEISNFNSKVNFIIG
FT                   GSNGVNNDVRNAADFRLSFSKLTFPHQLMRLILIEQIYRWISINNNIKYHK"
FT   gene            complement(27980..29845)
FT                   /locus_tag="Sterm_0023"
FT   CDS_pept        complement(27980..29845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0023"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; KEGG: dal:Dalk_4491 DNA mismatch repair protein
FT                   MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06911"
FT                   /db_xref="GOA:D1AIU9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIU9"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACZ06911.1"
FT                   /translation="MNKIKILDESVSNIIAAGEVVENPASMIKELLENSLDAGADSVKI
FT                   EVFNGGKDVKISDNGSGMEKNDMMLSIERHATSKISTKDDIFNLMTYGFRGEALASISS
FT                   VSKMTISTKTKESNVGYKLTAYAGSIRNVEEISRNNGTEIEIRDLFYNTPARKKFLRKE
FT                   STEYNKIRDIVLKEALVNYDTAFTLIFDDKPSIKTSGKGIENTILELFGKNVLKNLKKF
FT                   EHGYLGSVEILRSSKDYIFTYVNKRYVKSNTIERAVLDGYYTKLMKGKYPFAVIFLNTD
FT                   PKEIDVNVHPSKKIVKFSNDKIIYTQIKSAMDDYFYLEERREWQPNIDLLKQNVNISAA
FT                   EPEKIENLFSDETLKGENKQFFSLETLDNRDVETRIIDERPKKAIETLITEPEDSDFIR
FT                   ENIKTDYPSYKEESKENNVSESIQKSSEENIKKPEDYKIIGQIFNMYILVENKNQLEIY
FT                   DQHIIHERILYEELKEKFYSKKLDFQNLIIPQKIELTSPDKNLVMENIEVFRDFGFDVD
FT                   EFGENEIILRSVPAFDFRDSIKNVFMDLLADLKNDIEVKDLRERIIISMSCKGAIKAGQ
FT                   KLDPDEISSFIRRLHEIGKYTCPHGRPIIINIPKDDLDKMFGRKG"
FT   gene            complement(29838..30521)
FT                   /locus_tag="Sterm_0024"
FT   CDS_pept        complement(29838..30521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0024"
FT                   /product="thymidylate kinase"
FT                   /note="PFAM: thymidylate kinase; KEGG: thymidylate
FT                   kinase-like protein; K00943 dTMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06912"
FT                   /db_xref="GOA:D1AIV0"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV0"
FT                   /inference="protein motif:PFAM:PF02223"
FT                   /protein_id="ACZ06912.1"
FT                   /translation="MGKLIIIEGSDGSGKETQTNLLYKKLKERNFNIKKISFPNYESPA
FT                   SEPLKMYLSGEFGKDVNDVNSFAASTFFAVDRYASYKQDWEKFYNNSGIVLSDRYTTSN
FT                   MVHQASKIENEEDKQIFLKWLIDLEWNKLGLPTPDIVIFLDVSPELSQKLMSDRKNKIT
FT                   GEEKKDIHETNSEYLKNSYYNALNLAKQYGWTIVSCETDGVLKNIEEINEDIIKKLSEK
FT                   GVLYE"
FT   gene            complement(30633..33161)
FT                   /locus_tag="Sterm_0025"
FT   CDS_pept        complement(30633..33161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0025"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Sel1 domain protein repeat-
FT                   containing protein; SMART: Tetratricopeptide domain
FT                   protein; Sel1 domain protein repeat-containing protein;
FT                   KEGG: TPR Domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06913"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV1"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACZ06913.1"
FT                   /translation="MKRKNLLVVIFILFFCNVIFGKNNYETGLEYISIKDYENAKIYLQ
FT                   KAYDEENSLWAAYYLGLIYDDIYNDFNLSEKYFKIAADLEIGSIYNNIGGFYIKYKKTD
FT                   LAEKYFLLSTETGDFLAPRFLGLIYEEQNKLNLAEKYYKIAADRKNFDAYVNLGFLFQK
FT                   KNDLVQSEKYFLLGSNTGDVVAARLLGHLYLKQQRYDLAEVQFKALTEKGDLLSFHALG
FT                   DVYALQNKYDLAEKYYLAGTEKGSDYSSERLVALYAKLGRQDKIENFYKNSAGKDSAAS
FT                   FYNLASLYKRENKQDLAEKYYKLSSDKGNSSAPNDLGDLYIKQGKKDLAEKYYKIGSER
FT                   KNNEATYSLALLYESDKKLNLAEKYYLLAIEQDNEYAASELASLYKDQGKLDLAEKYYK
FT                   TAIEKNYTYAYGSLAILYEEWDKPDLAEKYYLLAVENGNFYAPRHLGDFYETQNKFEPA
FT                   EKYYKIAIEKGDNDTINTLGILYENNDRPELAEKYYLLSIDYNNNDAMRNLASLYKNQN
FT                   KYELSEKYYKMAIERDNTDALNDLGLLYENWKKNELSEKYYKMAIEKDDFYAPRNLGTL
FT                   YAGQNKFASAEKYLKMSIERKNFDAYNDLGILYNNNNKPELAEKYYLLAVEKNDAYAPG
FT                   NLANFYERQNKYDLAEKYFKIAIDCKDDDAINSLGLLYENEEKLELAEKYYLLAVEKDD
FT                   FYASKNLGRIYKNQEKYDLAEKYFKVAVSVGNEEALNELGVLFYVQKKYDQAVIFYKSA
FT                   IENGDINAMFNLGLLYEDQNKMNLAITYYEKAAALGSGDAFIRLGNIFMNKNDIETARK
FT                   YFQKAKNLGNKNADYMLELLENSVTERLDS"
FT   sig_peptide     complement(33096..33161)
FT                   /locus_tag="Sterm_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.981 at
FT                   residue 22"
FT   gene            complement(33307..34998)
FT                   /locus_tag="Sterm_0026"
FT   CDS_pept        complement(33307..34998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0026"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide- disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   HI0933 family protein; biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: pla:Plav_3138
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06914"
FT                   /db_xref="GOA:D1AIV2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV2"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ACZ06914.1"
FT                   /translation="MSVEIIMPKAGMSMEEGTIIKWLKEEGEAIKEGEPIVEILTDKVN
FT                   MEVEAESSGYLLKKVRFENEVLPVFTVIGYIGEKGESVSEVKEAEKKEEVKTETKTSDE
FT                   KEYDVIVIGGGPAGYISANKASQLGAKTALVEKRELGGTCLNRGCIPTKTYIKNIEILE
FT                   EAEKAESRGLDIKVTKNISDLTKAVEFKNKVTKKLSQGVGGLLRSYGVDVYSTAGKLGE
FT                   GKKVTLEDGQVLKGKKIILAGGSKTRYLNIPGIDSDKILTSTTILDLNKVPERLVIVGG
FT                   GVIGCEFAEIFRGYGTEVTIVEAMSNLLPFNDKEISQELEKIFKKKGIKLLTDKQVTGF
FT                   KDKGKEIETVLKSGESLSSDYVLFSIGREADLSCVDGLEIKQDRGRLIVNEYMETSIAG
FT                   VYAAGDINGLSMLAHSAFKMGETAAGNALGGREEVRLDNTPKCVYTLPEIASVGLTEEE
FT                   ALKKYGKIRTGRFNFGANGRAIASSEEEGFVKVICDDNYGEILGVHVIGSKATEMISAG
FT                   VILMEMEITIEEASELIYAHPTFSEAILEACADCLGKALHLPKKKM"
FT   gene            complement(35018..36346)
FT                   /locus_tag="Sterm_0027"
FT   CDS_pept        complement(35018..36346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0027"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   dat:HRM2_47640 PdhC"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06915"
FT                   /db_xref="GOA:D1AIV3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV3"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACZ06915.1"
FT                   /translation="MSVEIIMPKAGMSMEEGTIVKWLKSEGDEIKEGEPIVEILTDKVN
FT                   MEVEAESSGFLIKKVRFEDEVLPVFTVIGYIGEKGETVSEREEKAKTAEVIKDEKKPDK
FT                   KETEENSVFFNKSLMQSDKLNRATPAARKKARDNNLNLGDIPGSGPKGRVQLADVESFA
FT                   AGSTVKATPLARKIAGQEGIDLDGISGTGAKGKIFKRDLVLNAAPEIISKEAELKPYSG
FT                   IRKVIGDRMTESQFSAPTFTLNIEVGVNKLLKLKDKIAAPLMDETGEKLTINDLLILAV
FT                   SRGVRKYPDINVSLTDKGILCHKEINVGFAVSGNGVLMVPVVKNTEDKGIRNILTEGKD
FT                   LIKKAREGKLGAAEQSGSTITLSNLGMYGVHYFNPIINQPNSCIIGVGTIEEKPVAKAG
FT                   KISVKKVIYLSATFDHRVIDGALGAEFMQYVKKLIEDPYSLLI"
FT   gene            complement(36386..37369)
FT                   /locus_tag="Sterm_0028"
FT   CDS_pept        complement(36386..37369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0028"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: dat:HRM2_47610 PdhB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06916"
FT                   /db_xref="GOA:D1AIV4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV4"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ06916.1"
FT                   /translation="MREITYAEAIREAMSEEMRRDENVYLLGEDVGIYGGAFGVSVGMI
FT                   DEFGEERVRDTPISEAVIAGAAAGSAVTGMRPIAELMFMDFSTIAMDAIVNQAAKMRYM
FT                   FGGKAQVPFVLRCPAGSGTGAAAQHSQSLEAWFCHIPGLKVVAPSTPYDVKGLLKSSIR
FT                   DNNPVIFVEQKLLYRTKGEVPEEEYTIPLGVADIKRTGKDVTVVTYGRMLPRVLEAAEE
FT                   AAKDGIDVEVIDPRTLVPLDIETIKNSVIKTGRLIVVNEAVKRGSYAGEIVSEVVESEA
FT                   FDYLDSEIIRLSGKNTPIPYNPKLEAYVVPSKEDITEAIYKAMNRK"
FT   gene            complement(37512..38474)
FT                   /locus_tag="Sterm_0029"
FT   CDS_pept        complement(37512..38474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0029"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG:
FT                   oan:Oant_4117 pyruvate dehydrogenase (acetyl-
FT                   transferring)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06917"
FT                   /db_xref="GOA:D1AIV5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV5"
FT                   /inference="protein motif:PRIAM:1.2.4.1"
FT                   /protein_id="ACZ06917.1"
FT                   /translation="MSEKKDIYREMYKRMNEARAFEQKVSWFFSRGMVHGTTHLSMGEE
FT                   ASGVAPCMALEDGDLITSTHRGHSQVIGKGVDLNKMMAELLGKATGYCKGKGGSMHIAD
FT                   IDSGNLGANGVVGGGHGLSVGAALTQQMKKTGKIVLCFFGDGAANEGSFHEALNLASIW
FT                   KLPVIFYCENNLYGMSMSMERHMNITNIADRASSYGIPGHIVDGNDAVGLYDKMLEIFK
FT                   YVREGNGPVLVESKTYRWLGHSKSDANVYRTKEEIEDWKSKDPIERMKKYLVSEKIFKE
FT                   AELTAIEEQAKADIEKAVEFANNSPDPELETALTDVYAD"
FT   gene            complement(38491..38964)
FT                   /locus_tag="Sterm_0030"
FT   CDS_pept        complement(38491..38964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06918"
FT                   /db_xref="GOA:D1AIV6"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06918.1"
FT                   /translation="MTYKYNKKKYFITVTLTSIFIVFLLIYAVIKNIFNFNINIYTFII
FT                   LASCYELFNIYIAGVKPLEIELDSHKLVLRGYHKEDVYEIKDLKYMMTKELANKRLYLR
FT                   INKYSLLKGRYWLDTKSYENSENLYLNIMELERLICPNQLKYNHRSRRVKENR"
FT   sig_peptide     complement(38878..38964)
FT                   /locus_tag="Sterm_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.808 at
FT                   residue 29"
FT   gene            complement(38983..39255)
FT                   /locus_tag="Sterm_0031"
FT   CDS_pept        complement(38983..39255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0031"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="KEGG: hsm:HSM_1033 phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06919"
FT                   /db_xref="GOA:D1AIV7"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV7"
FT                   /inference="similar to AA sequence:KEGG:HSM_1033"
FT                   /protein_id="ACZ06919.1"
FT                   /translation="MKKILVATGTSVNKMKFAVETIKNYCANKNVECEVKGVNIYEMKL
FT                   EEENPDVLVVIGPSDIKTDIPIIMGTAFITKMGMDKTCDEILSHL"
FT   gene            complement(39365..40123)
FT                   /locus_tag="Sterm_0032"
FT   CDS_pept        complement(39365..40123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0032"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ecl:EcolC_1649 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06920"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ06920.1"
FT                   /translation="MLLKDKVCVITGGANGIGKGIALCMAKEGANVAILDLNDTEGEKT
FT                   LNEIKSHNVKGLYINSDVTNPESLAEAQKKISSELGNTDVLVVNAGISFKHSFKEVSDE
FT                   EWKKVIDINLSGSFYTIKAFIDSMLDKKENDRKSIIFISSGSAFTGGGGGVHYTASKSG
FT                   QHGLMRALAKEYGKAGINVNAIAPRVIASHILDQLYPDEKSKQELIEQIPIRRIGYPED
FT                   IGNLACFLASEKSTYIHGQIILMDGGRTYQ"
FT   gene            complement(40487..40771)
FT                   /locus_tag="Sterm_0033"
FT   CDS_pept        complement(40487..40771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0033"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: sea:SeAg_B4009 putative IIB
FT                   component of PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06921"
FT                   /db_xref="GOA:D1AIV9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIV9"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACZ06921.1"
FT                   /translation="MGKKKIMVACGTGIATSTVVVNKMSTLLKERGVDVDIQQCKVAEL
FT                   PYKTDNVDLIVTTTAYTSKKDIPVIVAVSFLTGIGVDKDLDKIIEILNK"
FT   sig_peptide     complement(40703..40771)
FT                   /locus_tag="Sterm_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.541 at
FT                   residue 23"
FT   gene            complement(40793..42157)
FT                   /locus_tag="Sterm_0034"
FT   CDS_pept        complement(40793..42157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0034"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: eum:ECUMN_3966 putative phosphotransferase system
FT                   permease component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06922"
FT                   /db_xref="GOA:D1AIW0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW0"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ACZ06922.1"
FT                   /translation="MGIIQSLVDFILGLGPSTMLPIILTIFGLILGQGLAKSFRAGVTV
FT                   GVGFVGVNLVIGLLTSSLGKAAEALVTSLGLNFDIIDVGWPIGAAITFATPIAALLIPI
FT                   IFILNMILLYFNITKTMDVDLWNYWHLIFPGAMVYYATNSLILAIVLTLINATIIFKLA
FT                   DWTAPAVEHHFGLPGISLPHGETVNFAPIMYALNKVEDKIPGINKINLDGEKLKEKIGI
FT                   FGEPLILGIILGVLLGILGRYTVTDILSLGIQMGAVMVLMPKMVALLMEGLTPISEGAK
FT                   DFISKRFPGKDVYIGLDAAVVIGNPSNMTVALLMVPITIFLSVILPYNRMLPFADLAVL
FT                   PFTVIWAVAASRGDIFRGLINSIITLCMVFFMATNLGPLTTQMGHAVGFEFPAGATMIS
FT                   GIDMSCHITLWIILKLIDYKNTPMFIAGIVALVAYAGMWYWTRNDIKKQYENETE"
FT   gene            complement(42177..42821)
FT                   /locus_tag="Sterm_0035"
FT   CDS_pept        complement(42177..42821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0035"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pca:Pcar_3030 L-fuculose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06923"
FT                   /db_xref="GOA:D1AIW1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW1"
FT                   /inference="protein motif:PRIAM:5.1.3.4"
FT                   /protein_id="ACZ06923.1"
FT                   /translation="MLEKLKLEVIDAGKKLKEYKLITLTGGNVSGRDLETGYIVMTPSG
FT                   MEYDTLTPDDITVTDLDGNIIEGKRKPSSDLKTHLQIYRAKKDINGIIHTHSTFASCFA
FT                   VLKEDIPVISTTMANEVGGKVPLSKYAPVGSDELGEHIIEKIGDQKAVLLESHGVFTYG
FT                   ENVSHALTAAVMLEDSAKVYYLTRTIGKPEELPEEEIKRANELFKNVYGQK"
FT   gene            complement(42838..44199)
FT                   /locus_tag="Sterm_0036"
FT   CDS_pept        complement(42838..44199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0036"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: oan:Oant_4119 PTS system galactitol-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06924"
FT                   /db_xref="GOA:D1AIW2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW2"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ACZ06924.1"
FT                   /translation="MGILNYIVDLGPQVMMPIIITIFGLILGAKFGKALRAGLTVGVGF
FT                   IGLNLVIGLLGGSLGPAAQEMVTRLGLNLTVIDVGWPAAAAIAFASRVGALIIPIGLVV
FT                   NIVMLLTNTTQTLDIDIWDFWHFAFTGALVTGATGSIMYGIIAAVLNMIIIMVIADLTA
FT                   PGIEKYIGLPGISLPHGFSGAFVPGALVVNKILDLIPGINKIEIDTETLQKRFGVFGEP
FT                   LIIGTVIGIVIGIAAGYNLKGILVLGITLGGVLVLIPKMAAMLMEGLIPISDSAQEFVS
FT                   KRFKNRGKIYIGLDSAVGIGHPTTLSVSLVLVPITIILAAILPGNRVLPFADLAVIPFS
FT                   LVMLIPITKGNVFRTFIIGFINMAVGLLIATNLAPLHTQMAIDANFTMPPGATMISSIC
FT                   DGANPLSWLFTRLMSIPFIGVSILAVIAIGMAVYNRQRIIKENRKDASAENTEE"
FT   gene            complement(44438..44890)
FT                   /locus_tag="Sterm_0037"
FT   CDS_pept        complement(44438..44890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0037"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: oan:Oant_4120
FT                   putative PTS IIA-like nitrogen- regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06925"
FT                   /db_xref="GOA:D1AIW3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW3"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACZ06925.1"
FT                   /translation="MIIDDNLIFSNLECENSNEVLRFLSDNLEKNGYVKSSFYDGLLER
FT                   EAAYPTGLDFGEYSIAMPHTEVEHVVKSTLSIATLKKKVDFKCAEDHSKDTPVEVVCVI
FT                   AFGEKEDKIDVLTKLISFFGDKEEFYKMLASDKDNLIKIVKKHLES"
FT   gene            complement(44895..47006)
FT                   /locus_tag="Sterm_0038"
FT   CDS_pept        complement(44895..47006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0038"
FT                   /product="PTS modulated transcriptional regulator, MtlR
FT                   family"
FT                   /note="PFAM: PRD domain protein; phosphoenolpyruvate-
FT                   dependent sugar phosphotransferase system EIIA 2; Helix-
FT                   turn-helix type 11 domain protein; KEGG: asu:Asuc_0583
FT                   transcriptional antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06926"
FT                   /db_xref="GOA:D1AIW4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW4"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACZ06926.1"
FT                   /translation="MALTKREIEILNILTNSDNIDMEYLAEDFGVSLRTIRYSIENLNY
FT                   YLKKYDFPVIDKNSKGILYQHEKFSLSNFLKKIESRDYKYLDIERVEYIYIYILFNTSR
FT                   KLNIINLASLFQVSELTIKSDIKKLKDFLKSKDLSFRYNNIKGFYIDSSEIALRKEMIK
FT                   IFMDKLFNFENTANKMNLFIDYQIKDILNNYIKQIDQNFLKNYLKDIESKLVENTSNEV
FT                   FELLIIYFSIAILRINQNNIITQSDFYNTYIIRTKEYKILTENIDILEKKYDVHFNEEE
FT                   ILKLAEYFLGSHTYNYSYTFYENWIEVEILVRKLIGEVSKNCSVDISKDKLLFEGLLNH
FT                   IKPTIYRIKNDIYLPNIGFEEILENCQELFFTVKNALIDVEKYIGHKIKDDEVALFTVH
FT                   FKLAIDRIKEKVNEFSNVLFVCGSGYASSSLLAQELLDTFDINVVDLIPYYRLKDYNLK
FT                   NIDFIISTVKIPETVKVEKEVIQVNVILSEKDKILLENKGFKRKKRTIGVTEILEVIEK
FT                   EFENDDLEKIGDILTQKFSGQIYDNRKEKIIERRNKNLLDYLNKENIVIKEKETNWRNV
FT                   VKIIGNILLEDGCIEESYIQSMKNLVDECGTFMVLNQRLMLLHAENNNDVFKTGVSFLK
FT                   LNYPVTFPDNKKLMYIFGLSCLSKEEISETLNDLVTLAENDEFFSELERKNNQAEIHKT
FT                   IKKYIERKI"
FT   gene            47513..48256
FT                   /locus_tag="Sterm_0039"
FT   CDS_pept        47513..48256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0039"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: hsm:HSM_1036 DeoR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06927"
FT                   /db_xref="GOA:D1AIW5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW5"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACZ06927.1"
FT                   /translation="MKEKRIDRILQMIKLNNAVGTGELAKTLNVAESTVRRDLNQLEKI
FT                   GLLKKVHGGAVKLENQVIFEMSYSEREELNLKLKEQVAKKAAGYINDNDTIFIGPGTTT
FT                   EMVLKYIKTKNNTIITNSLSAFSKYSSLPYKLIIAPGYLRTETSAVIGTFTNNFLKKIN
FT                   VDIAFSGANCINDSQLMSSNEEEGTAQEIILNNAKKRFLLVDSTKFETKSFFTFYSAEN
FT                   LDAIITDNEINSKIKNKYKKFCKVL"
FT   gene            48275..48913
FT                   /locus_tag="Sterm_0040"
FT   CDS_pept        48275..48913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0040"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pca:Pcar_3030 L-fuculose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06928"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW6"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACZ06928.1"
FT                   /translation="MLMENERKLIVEYGKLLVTKGLTTGTGGNISIFDKEKKYFAISPS
FT                   GIDYFETEPEDVVIMDLDGKVVEGERKPSSEWMMHLIFYKKRDDVEAVVHTHSRFSSTI
FT                   SCMRWDIPALHYYVAFAGKTIPCAKYASYGTQELADNAFEGMGEGKAALLANHGLITIG
FT                   RSVKEAFLVAEMSEEMAEYYYRTKSIGEPVLLDEEEMESMLLRFKSYGQ"
FT   gene            48926..49951
FT                   /locus_tag="Sterm_0041"
FT   CDS_pept        48926..49951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0041"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pol:Bpro_1286 alcohol dehydrogenase GroES- like"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06929"
FT                   /db_xref="GOA:D1AIW7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACZ06929.1"
FT                   /translation="MKIAYFYGPEDVRIEETAIPEPGYGEVVIKNKVALTCGTDLKTYL
FT                   RGHPLWIPPAVFGHEASGVVYKVGEGVEKFKVGDRVVAHNSAPCHECIYCKTHQYSMCE
FT                   NNLFNSGAFAEYQKIPERIVRQNMFKLPDTLDFKSAALTEPFSCAVYGVDESNIKQGDY
FT                   VVINGVGPIGLMFVKLVYLKGAHIIVTDASDKRLELAKKLGAKDIININEVSDVVKAVK
FT                   DCTPQSRGVDVAIEATGLPRVWENTILMARKGGLVNLFGGTKKGETFTIDCQLFHYSQL
FT                   TIKGVFHTTPYHVERAFRLICEGVISADDFVNNEYDIDHLVDALESHRTGNVIKNAIIF
FT                   E"
FT   gene            50332..50982
FT                   /locus_tag="Sterm_0042"
FT   CDS_pept        50332..50982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06930"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06930.1"
FT                   /translation="MKRYLLAIMLILGLVISCGGSKDITLPNKNVKIEGDVLTFKGKPF
FT                   TGNIKMNLADKMDGYAGAMSFKDGHLDGLTDLKNDKENQQVKFTVVDGKFDGELIMKDA
FT                   KQRTDIVLDIKNGAIVKYLADVQGAYKYDLSFVDNLANGTMEAQGQKFEFKDGIAKGPQ
FT                   GQELKLTLDPESGDLTMEAMVNGKVAGKQTIPNVLTPQYLETFIFRAVTMTNR"
FT   sig_peptide     50332..50400
FT                   /locus_tag="Sterm_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.369 at
FT                   residue 23"
FT   gene            51123..51767
FT                   /locus_tag="Sterm_0043"
FT   CDS_pept        51123..51767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06931"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06931.1"
FT                   /translation="MKKFLLAVIFVFGFAVSFSIDITLPNKDVKIVKEVLLYKGSPFTG
FT                   NIIMNTEDQKDGYIGGISLKNGHLDGLSELKNDRQGQHMRFTVVGGKFDGELIMNDPSQ
FT                   NTYIMLDINKGAIVKYLADIQGVYKYDLNFVNNLANGSMEAQGQIFTFKNGIAKGPQGQ
FT                   ELKLTLNPATGDLEMEAFVNGKAAGKQTIPNVLTPQYLESFLFQSITDTNN"
FT   sig_peptide     51123..51182
FT                   /locus_tag="Sterm_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.768 at
FT                   residue 20"
FT   gene            51809..52177
FT                   /locus_tag="Sterm_0044"
FT   CDS_pept        51809..52177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0044"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: vvu:VV1_2490
FT                   putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06932"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIX0"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACZ06932.1"
FT                   /translation="MIKRMPTNCGDKTCPSCVIAGDFIFLAHHAGGNNEKGVEEQMKSC
FT                   LESMKKTLESAGAKMNDMVQINLHLRFIEDFDKARKVFNEYFDEENFPARMTTTTDFMD
FT                   KGCLCMLDGTAYKPGAGK"
FT   gene            52215..52607
FT                   /locus_tag="Sterm_0045"
FT   CDS_pept        52215..52607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06933"
FT                   /db_xref="GOA:D1AIX1"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06933.1"
FT                   /translation="MAKLIVKREKSFLSSARKFKVILDGEIIGYVGNGEEAGFDAAEGE
FT                   HIIQVGISMINGISRKLKINITQDEALMVVKPNPVMWVILILAVIVGANLGIGLSRGYF
FT                   SLPLLIVLIILMGVSTVFAVGLKQVK"
FT   gene            complement(52675..53064)
FT                   /locus_tag="Sterm_0046"
FT   CDS_pept        complement(52675..53064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0046"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: abu:Abu_1136 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06934"
FT                   /db_xref="GOA:D1AIX2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1AIX2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ06934.1"
FT                   /translation="MKIASFSPNLMVKNVNKSIEFYCNILGFSLVQTVPESGEPDWGMV
FT                   EKDGFFVMFQKEESIKQEYPELNSQNSGGALTFYIKISDIQEFYNKICSHMDVSHEMHK
FT                   TFYGADEFAIKDPDGFILVFSESSE"
FT   gene            complement(53141..53905)
FT                   /locus_tag="Sterm_0047"
FT   CDS_pept        complement(53141..53905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0047"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: ppr:PBPRB1303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06935"
FT                   /db_xref="GOA:D1AJM8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJM8"
FT                   /inference="protein motif:SMART:SM00342"
FT                   /protein_id="ACZ06935.1"
FT                   /translation="MNYKEFLPGKNLGHIIDSYWFLDNSSIYGESQVLPDCSMDIIFNF
FT                   GNCFHSKSNSKSIVNNNDIIITGMMTSFKSHSMEKDSRLFGVRFKPLGLNRFLNFGFHN
FT                   IKNDIIDLNSVISDSCHQKFRNIFLLAEYKDIIGFFEKIFIEHLNSRSNDIDLDVSSAL
FT                   QNIYNSENPSVNELHKIIGISQRYLEIKFKKEIGINMKEFINIERFIKTKKEILSSDKS
FT                   LTEIAVNNGYYDSSHMIKDFIRYTGSSPKNWK"
FT   gene            complement(53955..54710)
FT                   /locus_tag="Sterm_0048"
FT   CDS_pept        complement(53955..54710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06936"
FT                   /db_xref="GOA:D1AJM9"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06936.1"
FT                   /translation="MKNQLFMEKYYKKILNMDKNNSWKAELKNHSGFNKTPVGIISILL
FT                   MIFGFFFGCFLLWNAITTENSESLFKAAFISFGIAVFGFILMKIFGKNIKKKYQERITG
FT                   GKLSLAVMVTANERYLNDSFSIPSAFFYTADNAKRLDINYYRSMDEKLQKIMGGITETP
FT                   EEKAFYKKLKALESKAATGNHILDVPESIAGTSDSYIWAGSLINAAPKDYFKDYSNTIV
FT                   PFLILEKSGEKRGWYEKLPVILSSSIWTV"
FT   sig_peptide     complement(54531..54710)
FT                   /locus_tag="Sterm_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.730 at
FT                   residue 60"
FT   gene            complement(54836..56347)
FT                   /locus_tag="Sterm_0049"
FT   CDS_pept        complement(54836..56347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0049"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_3; Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein; Tetratricopeptide
FT                   domain protein; KEGG: TPR Domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06937"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN0"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACZ06937.1"
FT                   /translation="MKNKIYRNFFTIRILIVLSLLFTAAFSEESAEELFNTALKYQKNG
FT                   QLDQAEQYYKASLKLKSDVDAMYNLGILYEDKNNYTEAEKYFKMAYDAGLSKAAYKLGY
FT                   VYSKLNKKDLSERYYLQSVTKDNNIDAMYNLAVLYNSSSKKNDAIKYFKMAADKGDIDA
FT                   AYNLGLLYDDAGNFDSAEYYYKKAADVNNSNINAMYNLAILYEKQNKINDSLKYYEKTY
FT                   NRNYDPKILYKLGLLNDISGNYQNAEKYYKQAAEKAGDTDAMYNLGLLYMSQNKYNDAQ
FT                   KYFLQLYSKNKTGKTANLIGNIYERQKNYKLAEQYYNEALSLGEKNAVYNIAMLYQSQE
FT                   NYEQAQKYLENLAQNSRNPELYYNLALSYDMGKNKTEAEKNYLKAIELAPGNNDVSLKA
FT                   MNNLGLLYYEQGNKDMAVKYLKNAVDNGYYSAALDLGIIYGQLGDKENTEKYLLTALEK
FT                   GKNNGALYHLGILYYDQGKKDTAVKYLKQASANGDKDAKLMLDSM"
FT   sig_peptide     complement(56264..56347)
FT                   /locus_tag="Sterm_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 28"
FT   gene            complement(56363..57511)
FT                   /locus_tag="Sterm_0050"
FT   CDS_pept        complement(56363..57511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0050"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: hypothetical protein ; K00099 1-deoxy-D-
FT                   xylulose-5-phosphate reductoisomerase; TIGRFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06938"
FT                   /db_xref="GOA:D1AJN1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN1"
FT                   /inference="protein motif:TFAM:TIGR00243"
FT                   /protein_id="ACZ06938.1"
FT                   /translation="MQTNISILGATGSIGKNALSIIRENRDKFNITALSADKNWQALAE
FT                   NIREFKPKYVSVGTQEGYDSIKREFPNIEIFMGCEGLKNIGQLDETDILLTAVSGSIGL
FT                   PATVEAIKKEKRIALANKETMVAGGYLIRDLLKKYNSEIIPVDSEHSAVFQSLKAGSHN
FT                   EIERIILTASGGPFRGADKKFLENVTLEQALKHPNWSMGAKITIDSSTLVNKGLEVIEA
FT                   HHLFLVDYDKIDVIIHPQSIIHSMVEFRDKSVIAQMGEPDMKTPILYAFTYPERVENKL
FT                   LGNFDFMKFNNITFEKADFEVFKGLKLAYDAGKQGESYPIVYNAANEAAVDLFMNRKIN
FT                   YTDIYKIIEDELNTHKSVKSLDLDVIMDVDREIKNKIYNLYE"
FT   gene            complement(57520..58440)
FT                   /locus_tag="Sterm_0051"
FT   CDS_pept        complement(57520..58440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0051"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   pca:Pcar_1916 putative phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06939"
FT                   /db_xref="GOA:D1AJN2"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN2"
FT                   /inference="protein motif:PFAM:PF01148"
FT                   /protein_id="ACZ06939.1"
FT                   /translation="MLSRALVIVIFVPLLILIFLKGDFTFLIFTEVIIGMSVYEFYKML
FT                   KDKGFEVASRIGLFLSLLLPVLVYMKDKVLFSYNFMGFSGDIIARFDIGGFVVFALMLI
FT                   ATRQILKVKINGAMAEISYTLFGIIYISYFFSYILLIKSEFSNGRALVLMTFILIWTCD
FT                   IAAYLVGISIGGKIIKRRLAPEISPKKSFEGAIGGFIGAFIVALKFDVIFSFFAEFFCK
FT                   NIHIFSECSVHSNISFTKTEALLLALIIAFFAELGDLVESKIKREFEIKDSGTLLLGHG
FT                   GFLDRFDSALFVLPVVYYFVKYFIS"
FT   gene            complement(58430..59125)
FT                   /locus_tag="Sterm_0052"
FT   CDS_pept        complement(58430..59125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0052"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: nma:NMA0081 putative undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06940"
FT                   /db_xref="GOA:D1AJN3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN3"
FT                   /inference="protein motif:TFAM:TIGR00055"
FT                   /protein_id="ACZ06940.1"
FT                   /translation="MDRKIPEHIAIIMDGNGRWAKSRGLARVEGHKRGADTLEFVLRQS
FT                   VSFGVKYLTVYAFSTENWKRPKTEVSALMNLFSKYLDNKKDELKEQDIRLVVSGTEEGV
FT                   SKKLLKKIKETEDYLSDCNTLTFNIAFNYGGRKEITDGINKLLAEGRTSITEDEFQNYL
FT                   YQPDIPDPELVIRTSGEFRISNFLLWEIAYSEFYITNTYWPDFDKNEYEKAIEWFNNRE
FT                   RRFGGVDAK"
FT   gene            complement(59290..59616)
FT                   /locus_tag="Sterm_0053"
FT   CDS_pept        complement(59290..59616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0053"
FT                   /product="Domain of unknown function DUF1904"
FT                   /note="PFAM: Domain of unknown function DUF1904; KEGG:
FT                   bba:Bd0885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06941"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR015017"
FT                   /db_xref="PDB:4M1A"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN4"
FT                   /inference="protein motif:PFAM:PF08921"
FT                   /protein_id="ACZ06941.1"
FT                   /translation="MPHIRVRGAEKEKVRDFTAGLADELGIIAECPADWFTFEYVETTF
FT                   FFDGKEDDGLVFIEVLWFDRDSEARDKIAALFTERWKKITDKIVTIVFNPLIENMYYED
FT                   GVHF"
FT   gene            complement(59787..60812)
FT                   /locus_tag="Sterm_0054"
FT   CDS_pept        complement(59787..60812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rme:Rmet_3872 conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06942"
FT                   /db_xref="GOA:D1AJN5"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN5"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ACZ06942.1"
FT                   /translation="MKSIKKYTSGIVLTFILAYIGILLSSFIPYHLISGSVFALLAGMI
FT                   LNPYISEFGFFKPGINFVSKQILRFSIILMGLTLSFSQVLQVGKYSLIVMVFTLFTAFG
FT                   GGWLLGKIFGMNWKLSGLISAGTGICGGSAIAAIAPAIDADIKDIAYAISATFIFDIFM
FT                   VILFPIAGRYFGMSDIGYGLWAGTAVNDTSSVVAAGYAFSDAAGGFAVIVKLTRTLSII
FT                   PAVLIFSLINRHVESRKSVSESEKKKKENISLKNIFPFFILLFLVMVGIKSTGIVPENV
FT                   SSVISQISKYLMVMALGAIGLRTNFAEVSHSGFKPMLHGFIISLLVVVVSFWVQMFLGQ
FT                   I"
FT   sig_peptide     complement(60693..60812)
FT                   /locus_tag="Sterm_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.806 at
FT                   residue 40"
FT   gene            61085..61978
FT                   /locus_tag="Sterm_0055"
FT   CDS_pept        61085..61978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tgr:Tgr7_0820 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06943"
FT                   /db_xref="GOA:D1AJN6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACZ06943.1"
FT                   /translation="MLDFRHETFLALCRIKNYTKTAEFLHMTQPAVTQHIKFLENYYNV
FT                   KLFNYERKNLSLTREGELLYDYATTMSADNKRIKDILAEKDTESISLSFGTTLTVGEYV
FT                   MPGILENMLEKYPGIRITMSVNNTKVLLEKLKSGEINFVILEGSFEKTKYDSVLFSKEE
FT                   FIAVCSPDSELKNKQVTLKEILEERIILRENGSGTRDIFEHILYRHNLSIESFKRKCEA
FT                   GNISVIKELVKKNFGITFLYKAAVEKELAENQLGRINIAGFSEKYEFNFVFLKDSIYKK
FT                   DYLVWYNLMKSFGGKN"
FT   gene            62145..62285
FT                   /locus_tag="Sterm_0056"
FT   CDS_pept        62145..62285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06944"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06944.1"
FT                   /translation="MIKTKMRCKACGKLYMEIKVEGKAICDFKCKRCKTQNVQVITEKF
FT                   N"
FT   gene            62398..62814
FT                   /locus_tag="Sterm_0057"
FT   CDS_pept        62398..62814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06945"
FT                   /db_xref="GOA:D1AJN8"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06945.1"
FT                   /translation="MKKQYKEYKVIDKDLSGFLLYDEKISDSFYEIEIEAIEDICDLKI
FT                   SDLKKIVCEKIEDGNFIDFIERLCRNRLLSIVPMLVLDKREFFVYDLFYKEKETQSEIG
FT                   KKLGITRQSVNKIVKKINMKFENASGNIIEHYYK"
FT   gene            62919..64232
FT                   /locus_tag="Sterm_0058"
FT   CDS_pept        62919..64232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06946"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06946.1"
FT                   /translation="MGVIKDSINKGFTVGDVTTTDFDDEAKIKVKEYYELDKLERKKML
FT                   ELAGNVDLELAKRDIKIGILEEKIENVGENNGGSSETEMKTYYPPSENSYYLLYRKLIT
FT                   KAELDEKCKLTMDKYNNMSIYEKSNFDYTLGDQFGYELPVTLEKIEKFINGKPIGEAQK
FT                   NLMYICKNFAECIDLNTDLNLEFYKTSFSNEYINESWSYYKLFLPKLKIYISTGGELIF
FT                   SENEAFGVWKVSDKKGGIVYEGSSGCPVIIGYIAFENGDYEITISLNSNYKSHYLLKTN
FT                   VEAEEISSLPNMRKNLKLQTEIISTSISYNSVWGYTPINIGRYLSSIPLEKIQAFSIDN
FT                   TVGTQVNEVNIRLCLKEDITITADSFSDKKFEIFKNLSFSNINEVLDIELIGNNNEIVK
FT                   GMLTRLNLSIIVPKGESLTLKKGTTYKYRKSYINTFKL"
FT   gene            64536..64949
FT                   /locus_tag="Sterm_0059"
FT   CDS_pept        64536..64949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06947"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06947.1"
FT                   /translation="MILELFKEKIEKADSRIPCVIDFLKNYEYSSSDFGMFFLEPETLK
FT                   SQSINLKHDKTHERTLKLLYIAPVDVSWAPEFDIKYQITFLENLMKQLSKDEDILKEIK
FT                   NLDYVYALKPRETSENSYMKEIIFEIIITIKEK"
FT   gene            64953..65882
FT                   /locus_tag="Sterm_0060"
FT   CDS_pept        64953..65882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06948"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06948.1"
FT                   /translation="MNIEVLAALQTAKGTAKTDTMAKLSATDYGVLPSVDKKVSEALGS
FT                   GRWVRDGFVSKISVAGDVPVELTMDQLEILLAGAGFEGKVTGTDYVMTSGASIDKYLTI
FT                   GVNDLDSDMFEYSKDCQISSLALNVQLEAFIKGTANIIGMDHITENTKFSGTATAVRDE
FT                   SLICLGSKITEKTNDITSQIESLDLTIDNKLEGKGALNSVYYKSIKQSDRGSVTLGLTF
FT                   NEFNKASYMDAQDLLLANGEFKVETEFAELQDPTKKVVFEFPKCKISKNERTDLAGAGG
FT                   MSKELEAFYDETIKSPVKITFKNYTSVL"
FT   gene            66020..66505
FT                   /locus_tag="Sterm_0061"
FT   CDS_pept        66020..66505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06949"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06949.1"
FT                   /translation="MSKDIKETIHKDIKKEIKEENIKAEKIIEDQTEESETVRDKSATK
FT                   VLTYGADGDFIVVELVATFRNLYNYLNKPRHKYRYHNQGSITERISIFYELEESHDFEL
FT                   LYNQTLKITLDNKEADKTIDNFVTFLNRQGIIFKKALEELLEENSVGLESQMRNLYV"
FT   gene            66875..72079
FT                   /locus_tag="Sterm_0062"
FT   CDS_pept        66875..72079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06950"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06950.1"
FT                   /translation="MATFKEVKGSYNKGLGYIKKGEKYALKGDELQKLEYKLEKRYGEF
FT                   TAQMIKWSEEKSKELNRPYTEILEYSLVYANYLDMKGYDPKEIKELIKNQTELKIKIIN
FT                   DKGYNPTDVDGLIKGLYDQKIESLNFFGIDEKEFQKMLKKDGIIEVNLNITSDLNEKYN
FT                   TFSNKTSLTNENQILDSRINRELRPYLDGFNEIYVPLKSWINSGISSAELNNEISRIEE
FT                   NIKNIYPYISKLKDDVIEFDSFKQQEDSNPDLAMISNKKYQEIIIKYPFLENKLLNNSD
FT                   SSGLWVKNWANLESTLKEAAEQSLKDKWYDTNLLKIGKERDYILNATERNRETRSKNFH
FT                   KLYQYPIEDIIKDSDVILAARDYNDLERTEKEYNKPKELKKIIDVLIKNETFKRKFGSY
FT                   NEWDGNPLKQYENELLNTIAEDVAIFVKNQDSDNYEISRIMEKTDDELRTLKNGYENYN
FT                   PLSEYGKYIKEEFSPKFSEQMNILKERLASAVKPVEEFDSNMKVKFDTLMKDDVIRQDL
FT                   ENYKKSQKISDYEKLKKDLNQRYGLADPKGGGPMPAAYLYDVYDKNFDQIQTAIKNITE
FT                   YAGQSIQKNSTMHIKAFESSVKTSSEQRYKMEERKVNGKTYYIPVKKNDIPMSEAEKNL
FT                   MKLTQSYNNVQRGMGKNPAAPIQKTATQTVKVQRKVQQPQRTVTYREPTKWEVMSKELK
FT                   KAVKDLESKAGKMGDVILKTSDKLAKLELEKLHNFSDVMGMSESDVLFSEIGILEKQRQ
FT                   IALEVGKKEKVESLTAEIKEKKKKAENAKFYDDINGSYEQKTNQLNFKPSDEQYDDFKE
FT                   KFAGYYDGKMENLTRLLVNGLITKNQFEKNSLDLIEEKIQRLIEMKKYDEAVKLTIEKY
FT                   QAEYTKIQEDAQKDLINIREKGEVFGYRKSEIINQELEREKKLRSDSYEKNKQTEEILN
FT                   KELENLNEKLEKAIKNNDKNEMKRIREEIDDKKKEKEELGTEEKAKKDNEKISKKELEY
FT                   NTAKILEALSDGIRDIFKNINPKDFRGSLANNIDSLFEKQFNVLLDEKNPYNSYKSVIE
FT                   EKMKEAFEGYQVTGDYVLDQSEYNKRFEEFLDRLIGTGNEGLINLAGSMKMERVKTSLD
FT                   DLASTLSRAGSVLKDDFLTNLSVTAESLSGLTSIFQNTNLAGPIGEKIGGLGNFLSPFT
FT                   SVVGTVFGTVNAGVSLFRSFGIGSNKNKKHNEEEKRKANEWYENKSKENENLFSEINTL
FT                   TNSIQNLTTKLIQNIASDTSDKNIAKQKSYYNTLIGKTGDLYEGQITATGHSSKKKGLF
FT                   GGKKNSHATLSQGFDEYFGSVWKNTARDSGSLQSFYDTYLQNFDLNTLKRKLGKSKLDN
FT                   NNIEEVKLSFLRFIEDVRVMEQYSLNLPKNGILESFEGVEVADLFELRNEYQKQLEDIY
FT                   KGMGKDPEKYRDEILSTVNSLIQNDQVIVSAFQDVKSRTIEQLSSGNDVILGLATGMES
FT                   YFSKLESNFSKVFYDMKFQGFEEKFSNKFENLTNNLADFRLSGRKDFDNFLNENLNFWD
FT                   LFTDLKNTEYIENDMKHIIDTLKNQAQASGLSDEVINAMFPDEKINEKTEKIKNVLENS
FT                   IRKALETNSFEQFSMSLGESIYNNVKDSLVKAFYESQSFQTLADKYFLTEDYKNALDGA
FT                   GSFKDAYSIIQQKLNEVELKLQSEGMDFRGTNAVDGNYYGMSGKQEYKTSGILDNSKGV
FT                   EFAVTLNNYGFMSNSEFMNTLKKEMKEFLYESGKEEV"
FT   gene            complement(72153..72617)
FT                   /locus_tag="Sterm_0063"
FT   CDS_pept        complement(72153..72617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06951"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06951.1"
FT                   /translation="MKKILLLLIFLCTISFSNTIGGFGDLKWGASREEAKKYLMETYKL
FT                   KEYAVYEFDDYTQVNFENIKFLDVEMYDLVFYFNKNKQFSGWRAQTYTMRYDKRYLIDR
FT                   YKKAYNLDEEKKSNDIISLTGFPESEAFLIQIYPDKVTFYIEDFNYSFPK"
FT   sig_peptide     complement(72564..72617)
FT                   /locus_tag="Sterm_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.475 at
FT                   residue 18"
FT   gene            72845..75136
FT                   /locus_tag="Sterm_0064"
FT   CDS_pept        72845..75136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06952"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06952.1"
FT                   /translation="MVDEEYIKCSYQEENNIKHKITFFNITKNIDITDYVENETLNINK
FT                   FITNESNSISPNSVSLELKFPDFEDIDEKIITFFDESDKYFSELEGYFDENISEKIKNI
FT                   VEKDDEVVIYDIFNNTKLELFTGIVKNPVVRQEHLYKILTVEIKDKTVLGYYKRFEKDE
FT                   VYQGHYFYNSSDKEHSLLYNLAKRIGFDEDKIEIEEIKYSIGDYIRVPVAKFEKEKKIM
FT                   EELAELVKAAVGSVYVTGDGTLKITSLINQKDTRKLDYELKKGNVLSYLEEWIDEKENN
FT                   KVEVTFSENKTEPRQAVFILAGQNMDYERDDAKIKVPANTTENDIYWKIEYMTEYVNNL
FT                   ETTPEVVAYKANSDGTKTYVSYNEYDVELTNTEGKVKFLNSDGTDIFIEKFKIYGEPIK
FT                   LYENNTVSYTEKVLEDHEVELYTYENKYVQELRHAQEVAKYLYYINCREQKHYKLIVNA
FT                   APFLELEDVVNLKFEDRDKKIQLINISQTGSQTEIEAVDFNIYQPAAEHFETEKSNLFD
FT                   KDYLNNGYVEYGNIKYPTDKPPAPIGVTPEHQFLGFGVRWQALERTDIKEYVIYVKSLG
FT                   SNGLPDGRLDTKFGCGNATYKIVTAEPGSYEVKVAAISQAGIEGDLSTAVVANSIKVDG
FT                   TALNVDGDSIIVDTSNHSLVLGKVYAKNITSNSILSNMIAANQIDANHVKANTITTDKI
FT                   LFGAGDAIQKGPGGGIVIKTLDGNNLSVVGMTNIYGTSGLTVYNNLSDESSTHKTVIQG
FT                   GQIIFYERSP"
FT   gene            75120..75443
FT                   /locus_tag="Sterm_0065"
FT   CDS_pept        75120..75443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06953"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06953.1"
FT                   /translation="MSGLPDGRFVIVRRGRLLGKSLYPEYIEDRGTASFTKAFSCRTLS
FT                   TSFYISISPVHIQSTYPATSVITPTRWEANRTPNVFQFWAEAVNCCGWFNWEVYEIPDS
FT                   KKL"
FT   gene            75499..76134
FT                   /locus_tag="Sterm_0066"
FT   CDS_pept        75499..76134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06954"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06954.1"
FT                   /translation="MSWRKVNVLKKAKVFEVKTDTPFNLANYTGGCFWGETVIDLGISS
FT                   VEMGFNTIGLKTELIPLGGNWYKGEIYRVPLIIGNNYNEYTYSTANENGKGERIVGDTR
FT                   NFGPNFGGVRYVVKTEGCNPETQIILRFRISTHRNNIVNYTGAFTGNVTTTPIEYKTPP
FT                   TLIADTFTCASFEVKNSYQGYVSFFIQNFVADSVQKVDGTLNVLALEV"
FT   gene            76139..76759
FT                   /locus_tag="Sterm_0067"
FT   CDS_pept        76139..76759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06955"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06955.1"
FT                   /translation="MGNWYPVRTMKKVISNTGNSGDIIDLRGFSDGIPWKNPQIFLSLF
FT                   GYFPDTNMNKYYTQVTALGNDRFKLECYAAGYTYDTAIYPGDRMSSTILYGETHIYQGP
FT                   YYGVSMEYVADSSLGTIGQTCYESENAFKSVYTGVMEGGLSNIHVATYTANFFSETQRN
FT                   GLIKVVNTGLTYGGRFRNIAVITTPTKLQSGIPISWVAVEGDL"
FT   gene            76761..77159
FT                   /locus_tag="Sterm_0068"
FT   CDS_pept        76761..77159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06956"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06956.1"
FT                   /translation="MENEKISESISIDNLILKKSSEKEIPTEEWKYITELNLEYIDVLS
FT                   EIAYRIYDDKMFFKGKIKYKKIEDNDDVLCELKLFRTEPVNLDVSAVNTNYGEIFSINR
FT                   DGYIIDKTYLKNYNDEREINLDSFCLNI"
FT   gene            77181..77555
FT                   /locus_tag="Sterm_0069"
FT   CDS_pept        77181..77555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06957"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06957.1"
FT                   /translation="MKTVTINNNWVKISDLIEKDSVILVSDGSEINITDNTDTDTVKFS
FT                   KYKKLENFKTWKKSKLWIRSGGLNSTLDIFELKTEAITNPELGGGFPSGETSYENIGEI
FT                   EKDIIKINDKINIFKIDIEE"
FT   gene            77927..78076
FT                   /locus_tag="Sterm_0070"
FT   CDS_pept        77927..78076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06958"
FT                   /db_xref="GOA:D1AJQ1"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06958.1"
FT                   /translation="MDIAKLTDFGIIGIVLSYFIWKDMKTFETFKELKELNIRIEKLED
FT                   DNKQ"
FT   gene            78189..78626
FT                   /locus_tag="Sterm_0071"
FT   CDS_pept        78189..78626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pag:PLES_08281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06959"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ2"
FT                   /inference="similar to AA sequence:KEGG:PLES_08281"
FT                   /protein_id="ACZ06959.1"
FT                   /translation="MAVKKGTLKRENEAGTYDEINLKTSANQVKMTDGTTVQDFLDSLS
FT                   SAGGSNVKIVSDIQARDALISEKGQIVYVEDATGDSTVTKGSLAYIYDGINWRKVAEVE
FT                   TQGDVFEWANILNKPDIVDIKVSTIEPVGQIDGDIWIEEIV"
FT   gene            78637..79086
FT                   /locus_tag="Sterm_0072"
FT   CDS_pept        78637..79086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06960"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06960.1"
FT                   /translation="MANVKLKRKKTNGYEQLYPQTLAKNVITGTGNVDTDILQLRQRIN
FT                   GLEYLKPPVIIEVLAKDFSGDYQYYDAYGWEATKFYNTEANLKIVFNSTNQAKYIVIDA
FT                   TDDMGMTMNHEIHAGLYNNEFEKNEIEPGKIYDLLYYNYQYYLIY"
FT   gene            79373..79544
FT                   /pseudo
FT                   /locus_tag="Sterm_0073"
FT   gene            79615..80385
FT                   /pseudo
FT                   /locus_tag="Sterm_0074"
FT   gene            80453..80530
FT                   /pseudo
FT                   /locus_tag="Sterm_0075"
FT   gene            complement(81150..81632)
FT                   /locus_tag="Sterm_0076"
FT   CDS_pept        complement(81150..81632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0076"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenase DIM6/NTAB family"
FT                   /note="KEGG: eca:ECA1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06961"
FT                   /db_xref="GOA:D1AJQ4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ4"
FT                   /inference="protein motif:COG:COG1853"
FT                   /protein_id="ACZ06961.1"
FT                   /translation="MENINAEYEKLYYGFPTVLLSFYDKNNEPGCLVSNSVFVLGNMLV
FT                   LGLAKTSSAAESIKFSNSFCVNIPEKELLREFENSSPDSSFDVNRFYSQNFLYTKSDTI
FT                   NAPLMDICKVSIECEVLSSHEDQNYIIIISNIKSKNISRDLLHNDGSFMGRILGSL"
FT   gene            complement(81739..82296)
FT                   /locus_tag="Sterm_0077"
FT   CDS_pept        complement(81739..82296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0077"
FT                   /product="ribosome recycling factor"
FT                   /note="TIGRFAM: ribosome recycling factor; PFAM: ribosome
FT                   recycling factor; KEGG: dde:Dde_1128 ribosome recycling
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06962"
FT                   /db_xref="GOA:D1AJQ5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ5"
FT                   /inference="protein motif:TFAM:TIGR00496"
FT                   /protein_id="ACZ06962.1"
FT                   /translation="MVDTFLKETETKMEKAVESTKDKFASIRAGRANVSMLDGITVDAY
FT                   GAPSPLSQIGTLSAPEARLLTIDPWDKSLIPAIEKAIQQANLGLNPSNDGRIIRLSVPE
FT                   LTEERRKEYVKMVRKEAEEGKVAIRNIRKDVNNKLRKSEKDSEITEDDLKSGEDSVQKL
FT                   TDKFTKLVDEALDKKEKELTTV"
FT   gene            complement(82330..83040)
FT                   /locus_tag="Sterm_0078"
FT   CDS_pept        complement(82330..83040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0078"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="KEGG: pca:Pcar_1919 uridylate kinase; TIGRFAM:
FT                   uridylate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06963"
FT                   /db_xref="GOA:D1AJQ6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ6"
FT                   /inference="protein motif:TFAM:TIGR02075"
FT                   /protein_id="ACZ06963.1"
FT                   /translation="MLKYKRILLKLSGEALAGNQKFGISSDVLDNFARQLKEVHDLGVE
FT                   LAIVIGGGNIFRGIAGQEQGFDRATGDTLGILATIMNAIALQNSIEKMGVPTRVLTAVQ
FT                   MPEIAEPYIRRRAIRHLEKGRIIILAGGTGNPYFTTDSGGALRALEIGADILAKGTKVN
FT                   GVYDKDPQKFADAVKYDNISFDETLTKNLKVMDAAALSLCRENDLPVIVFNILEDGNVK
FT                   RMVNGEEIGTIVKN"
FT   gene            complement(83092..83976)
FT                   /locus_tag="Sterm_0079"
FT   CDS_pept        complement(83092..83976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0079"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   Translation elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; KEGG:
FT                   nis:NIS_1536 translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06964"
FT                   /db_xref="GOA:D1AJQ7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ7"
FT                   /inference="protein motif:TFAM:TIGR00116"
FT                   /protein_id="ACZ06964.1"
FT                   /translation="MAVTTALIKELRERTGAGMLDCKKALEENNGDIEKAIDWLREKGI
FT                   AKAAKKSGRVAAEGLVFGAVSSDRKKGVVLEFNSETDFVAKNDEFKSFGEKLVELSLTH
FT                   DVSSEDELRAVQLEGKSIDEVINELIAKIGENMNLRRLTAVKTEGFVETYIHLGGKIGV
FT                   LLEMNGEATPENIEKAKGVAMHIAAMDPGYLSPDQVTTDDLEREKEITKKQLEEEGKPA
FT                   NIIEKILEGKMRKFYEENTLVKQKYVRDDSVSIEDFIKPLTINGFTRFKVGEGIEKGDV
FT                   DFAAEVAAQIAGN"
FT   gene            complement(84024..84815)
FT                   /locus_tag="Sterm_0080"
FT   CDS_pept        complement(84024..84815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0080"
FT                   /product="ribosomal protein S2"
FT                   /note="TIGRFAM: ribosomal protein S2; PFAM: ribosomal
FT                   protein S2; KEGG: pca:Pcar_1921 30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06965"
FT                   /db_xref="GOA:D1AJQ8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ8"
FT                   /inference="protein motif:TFAM:TIGR01011"
FT                   /protein_id="ACZ06965.1"
FT                   /translation="MAVVSMKQLLEVGAHFGHQAKRWNPKMKPYIFTERNGIHILDLHQ
FT                   TLDSTEKAYNFIRDITSQGGKVLFVGTKKQAQEAIREEAVRAGGFYVNNRWLGGLLTNL
FT                   NTIKTRVQRLKDLEEMDQNGMLDESYTKKEAGLLRKEMAKLSKNLGGIKEMNKVPAALF
FT                   VVDIKKEFLALEEAKKLGIPVVALIDTNVDPDLVTYKIPANDDAIRSVKLFSEIMANAI
FT                   IEGNNGQEAAEANAAASGDMPVNEDEIAVETMAEGIKEATE"
FT   gene            complement(86101..87204)
FT                   /locus_tag="Sterm_0081"
FT   CDS_pept        complement(86101..87204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: prw:PsycPRwf_1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06966"
FT                   /db_xref="GOA:D1AJQ9"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJQ9"
FT                   /inference="similar to AA sequence:KEGG:PsycPRwf_1518"
FT                   /protein_id="ACZ06966.1"
FT                   /translation="MNELFRWSKVFTFAGAIVAYLIGSGFASGQEAMQFFTAYGPAGCF
FT                   GAVIITLLLYIWFSSVIMEDGRRLQLDSANKIFTYYCGRYLGKFFEIFTPIFLFLVFSV
FT                   MIAGAGATLNEYYGLNPQTGRIIMAVLALGTVILGLDGLVSIVSKIGPAIIIFAVIVGI
FT                   GNIVMNPSGLAKANETMASIKVTKAASNWLISGIIFPAMGCIMLAPFLAQLGKEAGSKK
FT                   EAKTGGFIGGFAFAAAVMVMAYGLMASIGDLYNKDVPSLFIADKMFPAIGILFSVILFA
FT                   GIYTTAVPMLWLSCNRLVSDEKDKKFKILALILTIIAFIGGQFSFSALVNSLYPISGYF
FT                   GIILMLCILKTQLKKKEVPSVEIKKVS"
FT   sig_peptide     complement(87115..87204)
FT                   /locus_tag="Sterm_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.918 at
FT                   residue 30"
FT   gene            complement(87452..88537)
FT                   /locus_tag="Sterm_0082"
FT   CDS_pept        complement(87452..88537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0082"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase"
FT                   /note="PFAM: NAD/NADP octopine/nopaline dehydrogenase; NAD-
FT                   dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: glo:Glov_2392 NAD/NADP octopine/nopaline
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06967"
FT                   /db_xref="GOA:D1AJR0"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR0"
FT                   /inference="protein motif:PFAM:PF02317"
FT                   /protein_id="ACZ06967.1"
FT                   /translation="MKKKKIAILGGGNGSHMMAVDMKVKGHEVRMYEMPEFKENVTQLF
FT                   NTQTIEVSGIMKEKVKVDMVTDDIKKAVDGADYILVVTPAFAHKGYAELLKGNVVENQI
FT                   IVVFPGAFAALIFKNILGSDSCPVIADANNLPYDARLTSPCKVTLFGRNKINIAFLPAE
FT                   KGAELIDMLREDLFPFEKIYTDVLECGLGIVNPALHSGPCLLNISNIESPHVDFYLYEH
FT                   GFTPSAAKIDIVLDNERKAVGKQLGYHLTPIEDFSGLNEGYTWEELYRATHGAISLTPI
FT                   SGPNDINNRYLTEDAPFGLVPWSSLGKAIGIPTPTIDAVISLYNIIHETDWRERGSTVK
FT                   DLGLEGMDLESIKKYVKTGKK"
FT   gene            complement(88736..90148)
FT                   /locus_tag="Sterm_0083"
FT   CDS_pept        complement(88736..90148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0083"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation/phosphoacceptor;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   ppd:Ppro_1972 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06968"
FT                   /db_xref="GOA:D1AJR1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR1"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACZ06968.1"
FT                   /translation="MFFILRELCKKYTDLDDSDIAELEDYAKKLSVFAEFTDTDLFIDC
FT                   LIPNSDYAVVVYQQRPVDSPTLFKNSVLGVIVGRETEPAVIRTLKTGITSKKLKAFTQD
FT                   KKSVYETVAPIPNSTGKIIGVLVSEHDVTKQVNKNKQIKLLEQTQKKLRDNLEYLKNNP
FT                   EILTEHINQSVIIFDHNGQVVYANPEARTLYKNLGYIENIQKIHMKNLILNKNHYCQLN
FT                   EDRNGFENEISIGDFTLKIRYVCLNIAGNNCTVMIITDISEMRNKEKELILKSVAVKEI
FT                   HHRVKNNLQTIASILSMQARRIDDSNMKKILNENVSYIDSIAAVHEILAEQGFEDIDIK
FT                   QLIQKLSSAILNYSSSDTRNIKIATTGDTVLVNADTASSVMLVINELLSNSLEHGFRTK
FT                   KSGNINIRISNEEVFAIFTITDDGDGFQQKTNFESLGLNIVKAIVKDKLNGKIRIHSSK
FT                   SGTVTEFSIKIK"
FT   gene            complement(90149..90877)
FT                   /locus_tag="Sterm_0084"
FT   CDS_pept        complement(90149..90877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0084"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; SMART: response regulator receiver; KEGG:
FT                   ppd:Ppro_3459 response regulator receiver/ANTAR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06969"
FT                   /db_xref="GOA:D1AJR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ06969.1"
FT                   /translation="MGKNRIVIVDDEPVIRMDFREILTLNGYFVAGEAADGFDAVELCR
FT                   REKPDLVIMDIKMSVFDGLSAAEVILSEGLSDCVILVSAYNDKEFFKKAKHAGVMNYLI
FT                   KPVREKVLIPAVEMALAKSLEIRSMKNKMTKMEEDTKNAKIIERAKYLLASSSDISEKE
FT                   AYEKLRKLSMDKRCSMAKIAESILSQDSAKAFTEKAKVYLMKKYELSEQAAYLRIKRLS
FT                   SEKKLSLSEAAAEILNNAGK"
FT   gene            91313..91960
FT                   /locus_tag="Sterm_0085"
FT   CDS_pept        91313..91960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06970"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06970.1"
FT                   /translation="MKLYRPVGLQELEKILNFGSEKFPDRQVWQPILYIVENYGYAEQI
FT                   STMWNLKDENSGFSGYILEFTISDDYMKNYDIKQVGDKTHLEYWIPAEDTKKFNNSLTS
FT                   KIKIINAFYGEKYRGLPFDGTVLEGREPDKQIRELALLMENSYEKFEETVKKCKIQILP
FT                   NLIYWLRMISDLAGAGKKEKEKVIYEIEKVLSQTYEDYNDIVIDIKSWKSGR"
FT   gene            92057..92998
FT                   /locus_tag="Sterm_0086"
FT   CDS_pept        92057..92998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0086"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator effector binding;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: vha:VIBHAR_06300 methylphosphotriester-DNA
FT                   alkyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06971"
FT                   /db_xref="GOA:D1AJR4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR4"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACZ06971.1"
FT                   /translation="MDNTKRVNMVLDYIEQQLCHELDEEAVSRIACCSFQQFLRIFSYM
FT                   TGISLHEYIRRRKLSAAAEELVKNRRNILDTAVSYGYDTHSGFSRAFKMHHNATPTEII
FT                   EGIKEPQLFERLFFLSPSSAENKTYRIEKGDLKMAKLTNIGFKSFGPYRLIGRAVDTKL
FT                   MSNDIAMLWGKFFADGSFHSLLDLCRNKENLTELPDGVAGIMHNFGEGGSIRYLAGIIF
FT                   SSAAEVPEGFDSFELPAGIIAESQITGEEYEIYSQGHELTVSAIESSGYIIDRENFYQC
FT                   EAYTDERFSNPKKDGETILTLDYYIPVLEKKK"
FT   gene            complement(93597..94865)
FT                   /locus_tag="Sterm_0087"
FT   CDS_pept        complement(93597..94865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0087"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: lhk:LHK_01898
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06972"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR5"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACZ06972.1"
FT                   /translation="MSNNNAVLARNTEKAPINSLYSQTVAFSHYNNLSAQLPVDPKSGK
FT                   LVAGGIKEQAEQCFKNIEAIVDSIDHVMNDIVRITVFVKNIKDVDAVNEVYKTFFSSYL
FT                   PTQTIVAVDALPMNALVQIEALVSNGEGTIPGAPQAGDLIKLTNNTENAPMSSLSTQTV
FT                   AFSHYNNISAQLPIDPKTGRLVIGGITEQARQCLKNIKAILESIDVPFDDIVKITVFLK
FT                   DFSDLEAVNEVYSTFFPDSSIARAVAYVPARTVVAVSDLPMGALVQIEAVVSHGDGTPP
FT                   QAIEDRHGLIIEANNTENAPKCSLSTQTVAFSHYNNISAQLPVDPKTNEIVAGGIKEQT
FT                   EQCLKNIKAIVESVDHVLEDTVKINIFLKNIEDIEAVNEIYAKFYPNGTPARRIVGVSA
FT                   LQKNALIQIDAILGNAEGTPPIK"
FT   gene            95196..95909
FT                   /locus_tag="Sterm_0088"
FT   CDS_pept        95196..95909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06973"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06973.1"
FT                   /translation="MLKIFRNADISKRYTEISLKGNEKYGDIIKLEGFENIVSDGYYGG
FT                   AQEWYRQNREARAWDEKRAEKASDSGCGFVSVANCFAYYIYKNNKEAFSNSKEDFLRLM
FT                   TDIYDFKGRIFLKFGLFESGLRKAARNFSKHTGYSVKFQKALFFENKAEFLKESLRNKR
FT                   PAVLLFGWGKGLPFTEHWVTVTEITEIKDIENNRISDHIISVSSWGKKYYFRLSETEKW
FT                   LLNTPVSLIFQKNSK"
FT   gene            complement(96405..97082)
FT                   /locus_tag="Sterm_0089"
FT   CDS_pept        complement(96405..97082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   afw:Anae109_3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06974"
FT                   /db_xref="GOA:D1AJR7"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR7"
FT                   /inference="protein motif:TFAM:TIGR02206"
FT                   /protein_id="ACZ06974.1"
FT                   /translation="MNPAYSFSYYNYEHIINLILCLVLGLIILGFPKYTKINVNKFGTV
FT                   LGYLILFLKIFETIYRIKYEHFTLPESLPLHFCNFTMIICGLYLITKSNILFNITYFFS
FT                   FGAVMALILPGVNTYYHQLFFVLFMVSHATVVIAMLYGFIWLKSKPTFSGMTVSIITVL
FT                   ILFLTSYLYNNKFGTNFMFLKVYIVPFLDFIKPFSLYIGILITAFILIIILLYIPFRKN
FT                   KRG"
FT   gene            97159..100113
FT                   /locus_tag="Sterm_0090"
FT   CDS_pept        97159..100113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0090"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   transcription factor CarD; TRCF domain protein; helicase
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; KEGG: dat:HRM2_28210 Mfd"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06975"
FT                   /db_xref="GOA:D1AJR8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR8"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACZ06975.1"
FT                   /translation="MKDLDIELNKNKLYRGSIPSFLSDGKNKKIIYISTSNRNLENYHY
FT                   SLDKDYKGNLNLFENISSNAEDMVGININLLNILKNDKEYLMLVNLQIALSSFFEDIRK
FT                   EEFQVGKTYSIKEISDFLTENNYDYNYMLEKKGEWSKRGDIVDIFPPSYENPVRMEFFD
FT                   DELESIRFFDIDTQKSISKTDRIEIYSNIPQEGRFEFIELLDEIKAEDVLVYLENDELI
FT                   EYKIEEYILLNRDNEDQIRKRYTNLLEKGEIINLMNFSHEQLKTFQDKDKLIKLSEKAD
FT                   VEIHTLNTKKLKEVYKGTKIKVVEEELLEGYIADGKFVLTERELDGVVVQKKVNTKKQI
FT                   KYKDLNQIREDDYVIHEQYGVGKYKGIEQMNNRDYLKIKYADEDILFIPIEHLDRLEKY
FT                   ISYGEEPKVYKLGTKGFKYKKKKLEEEIRAFAEELVKIQAIRASNQGFVYSKDTVWQEE
FT                   FEEEFPFVETEDQKRAIEDVKNDMESDKIMDRVICGDVGYGKTEVAMRAAFKAIVDGKQ
FT                   VALLTPTTILAEQHYERFKQRFSKYPMTIENLSRLSDTKKVREILHKLETGVLDMVIGT
FT                   HRILSEDVKFKNLNLLIIDEEQKFGVKSKEKLKKKREKIDILTLTATPIPRTLNLTLLG
FT                   IRDISVIETPPVNRVPIETIIEEQGLDIKRAVLKELARDGQIFYIYNNVKFMEDKMKEL
FT                   KSQLPEFVKIDYIHGQLPPKLIKERIKKFENGEYDILMATTIIENGIDISNVNTIFIEN
FT                   FDKLGLSQVYQLRGRVGRSNRQSYCYLIKSLISTKKSKKREETFDNIEDATASGMQLSL
FT                   EDLKIRGAGEILGEKQHGTIETFGYDLYVKMLRKEIEIQKGTYVEAAPDVNIELKDKGF
FT                   IPDSYIEADEKLNIYKRFIMLNNEKDLAGLLDEVKDRFGKFPEDFERFVDYMRLKIFAQ
FT                   NNNIKKLREKDNMIEIEFSKNISQEHINVLLLEDSKLNRKTLKINKNKLLKKIT"
FT   gene            100123..101043
FT                   /locus_tag="Sterm_0091"
FT   CDS_pept        100123..101043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0091"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: wsu:WS1281 cell binding factor 2 precursor major
FT                   antigen PEB4A"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06976"
FT                   /db_xref="GOA:D1AJR9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJR9"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACZ06976.1"
FT                   /translation="MKKALAGLLILLGLVSCTGDSNRLTTGEVVFESKDKKVKVFKEEV
FT                   DFVINQSMDPEMLDQVPKEQLDAQKKAIIKQLAFYKSIALSPEAAKLKATKDYKMALGL
FT                   QEDTLLTGLFLKDKVKDIKVTDEETKKFYDDNKSAFTRQDNIADLQLIYLPYRSDDEKA
FT                   QADRVLAEAKQNKDKFGDLAKQYSADKTSGANGGVTGPLPLDKLGADFAPIKDAAINGA
FT                   VNEVAPNLVILGGDTAVIVKVNKKELKGEVVKYEDVQKNIAFQLKQKKIAEEQAKIEKE
FT                   IVDKYDLNSIDQLKLEEKAADKDKK"
FT   sig_peptide     100123..100182
FT                   /locus_tag="Sterm_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.510 at
FT                   residue 20"
FT   gene            101366..102703
FT                   /locus_tag="Sterm_0092"
FT   CDS_pept        101366..102703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Viral A-type inclusion protein repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06977"
FT                   /db_xref="GOA:D1AJS0"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06977.1"
FT                   /translation="MKILKYLLILILFLIVVTIGVLFFSGKIIESKLNTKETQIENFKF
FT                   SLGKREITFDNISINGNKMGPGRATISLKRFFGNMFDKEIYLNEVEFSNVDFNTLFAAP
FT                   DENIDKFISKIQVPAEKTEAGAADNISEEISSLESGTNDVLNFDFITQMEDLEKLKREF
FT                   SDTQDLDTKIAKLKEISEKSEKIKKDITDKKILINEKIAELDSENIKALNTYTDQLEEL
FT                   NNTIKAGNVDNIKKITFIDRGRDIVQDLNISLKTAKVAEDFYKSNISAKKVILISADQR
FT                   MEIFNTGPDLGSTTADYKSKDAAYKITKAENSELYKIAVTRDKLSEEILYENDKITADI
FT                   KYTKINFLPDVSDIVIETKLSYNNDILNIASNNSVTDEQENFIKESIEKIKQERLAALS
FT                   EKYNTENTRINDILDQLNEKEKELDAQISKLKVLTTSSNIINTLGE"
FT   gene            102709..102957
FT                   /locus_tag="Sterm_0093"
FT   CDS_pept        102709..102957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0093"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: abu:Abu_1278 S4
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06978"
FT                   /db_xref="GOA:D1AJS1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS1"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACZ06978.1"
FT                   /translation="MRLDKFLKVTRIIKRRTIAKELADNGNIQINNEEKKSSYSVKAGD
FT                   VLDIKYFNKNIKIRVKEVPSENLRKEDIENYIEVLSS"
FT   gene            102954..103811
FT                   /locus_tag="Sterm_0094"
FT   CDS_pept        102954..103811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0094"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: hypothetical protein ; K00919 4-
FT                   diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06979"
FT                   /db_xref="GOA:D1AJS2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS2"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACZ06979.1"
FT                   /translation="MIYSNCKINLGLNILKKREDGYHELDMVMMPVDFNDVLKYEDYGE
FT                   KGDLILEVSDTRIPIDEKNIVRKAYNLYFDNSNTPRQKIKVFLDKKIPHEAGLGGGSSN
FT                   AAFILRKLNDKYKLYTNEELEKIALKVGADVPFFIRNKSARVTGIGEKIEEIENNLSSE
FT                   ILLIKPQQGMSTGQVYSYYKDNKKDLKMADIMSIVKALKENNLTQLLKNIENSLEQLIF
FT                   KKDSSFRDLKNELEDALAKKIFLSGSGSCFFAFCENGNFDTSKLDKKNVFYQKTNRLVQ
FT                   NYGK"
FT   gene            104012..104311
FT                   /locus_tag="Sterm_0095"
FT   CDS_pept        104012..104311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0095"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bba:Bd2801
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06980"
FT                   /db_xref="GOA:D1AJS3"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS3"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACZ06980.1"
FT                   /translation="MKITDIRLRLGRGAEDGGKLKAYVDVTFDESFVIHGLKIIEGQNG
FT                   LFVAMPSRRMPNGEFKDIAHPITPELRNELTDFIIKKFEEEKVNLEAAAATTAE"
FT   gene            104480..105043
FT                   /locus_tag="Sterm_0096"
FT   CDS_pept        104480..105043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0096"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06981"
FT                   /db_xref="GOA:D1AJS4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS4"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACZ06981.1"
FT                   /translation="MTEKEKRLLGLPHYLFKEPEISEEITRTKELCYEYNQLRPSDKEG
FT                   QEEMLVRIFQKEFKNIKIWAPFQCFHGKNITLGKNFFANHNFIVIDMCEVIIGDDVMIG
FT                   PNVTITTASHPKSPRQRKENIEFGAKVIIEDGVWISSGVTICPGVTIGKNSIIGAGSIV
FT                   TKSIPANVVAYGTPCRVTEKIKEK"
FT   gene            105127..105699
FT                   /locus_tag="Sterm_0097"
FT   CDS_pept        105127..105699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0097"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: nam:NAMH_1107 peptidyl-tRNA hydrolase;
FT                   TIGRFAM: peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06982"
FT                   /db_xref="GOA:D1AJS5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS5"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACZ06982.1"
FT                   /translation="MKLIVGLGNPGENYKMTRHNAGFIYVDEYLKENGFRSRDYKNKFK
FT                   GEIAELNKLGKKALFLKPLTFMNLSGESVREAVNFYKLDPAHDLFVIYDDMDLELGRIK
FT                   IRKNGRPGGHNGIKSIISHVGPEFIRIKCGIGRPGGRTDVVNYVLGKLTDEEKEVLKEN
FT                   RERINSLIDDIIDGKDADQLMAVYNQK"
FT   gene            105733..106422
FT                   /locus_tag="Sterm_0098"
FT   CDS_pept        105733..106422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0098"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hpj:jhp1141 putative ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06983"
FT                   /db_xref="GOA:D1AJS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ06983.1"
FT                   /translation="MIELVNIEKRFGNKRVLRNINLNLQEGKVYGLFGPNGVGKTTLLK
FT                   IMAGYNKKTSGEYKINGLDFTYENKDHITFISDKEIFYGWMKIKDAVKYYKDFFTDFDE
FT                   EKCLRLVKMMKLEADDKINVLSKGMKARLKVALAISRNAKLYLLDEPLGGLDPVSRKII
FT                   LDTIKTLMNQNGILIITSHLVNDVADIIDHVLFISEGEIILDTEKSKLDLENYKLEDYY
FT                   VKEYLNV"
FT   gene            106415..107269
FT                   /locus_tag="Sterm_0099"
FT   CDS_pept        106415..107269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06984"
FT                   /db_xref="GOA:D1AJS7"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06984.1"
FT                   /translation="MFKKLMKYELRKGIIPYIIIMVSLIVAFIIIAVQCSFIDFDSFNS
FT                   RSENQFVILMMGIFLVVGMAYILMIVGGVFNFVQGIMYLADEFFREKGYLTFSTPNSSY
FT                   KIIASKLLAYFIRNFVYFMVILVSVLGVLSIVFRENNEFFMIMEFIRKNPLLIILVLIY
FT                   AILGQLIHMIFIYFIMTLNVTVIDFKHKILSSFLMYFGVTIFLRIIYFFLQLYIQFNIN
FT                   TTGFLIFYKSISMNVPVYMPEYAGGNYEFIPLPVFPVLIIFLGVFFVLYFSVCKLIDKG
FT                   VNI"
FT   gene            complement(107409..107585)
FT                   /locus_tag="Sterm_0100"
FT   CDS_pept        complement(107409..107585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06985"
FT                   /db_xref="GOA:D1AJS8"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06985.1"
FT                   /translation="MTNLLFYTGIFSTVILVIQVILTLIGIGGESPEFDADTDMDFDGH
FT                   LKLLFNKLIYKLF"
FT   gene            108148..108309
FT                   /locus_tag="Sterm_0101"
FT   CDS_pept        108148..108309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06986"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06986.1"
FT                   /translation="MELLVLSVILLVVIIELIGLSINKEALFNFYNTFPSCEDYSDNFA
FT                   YGAGNNKL"
FT   gene            108462..110120
FT                   /locus_tag="Sterm_0102"
FT   CDS_pept        108462..110120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0102"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: sat:SYN_01708 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06987"
FT                   /db_xref="GOA:D1AJT0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT0"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACZ06987.1"
FT                   /translation="MRSDNLKKGDRRAPHRSLLKGLGFVNEEMDKPIIGIANSFNEIIP
FT                   GHVHLQTLVQSVKDGIRMAGGVPMEFNTIGICDGLAMNHIGMKYSLVTRQIVADSIEAT
FT                   AMATPFDAIVFIPNCDKVVPGMLMAAARLNIPSIFISGGAMLAGVYKGKKIGLSNVFEY
FT                   VGQFESGKMTAKELNMVEDMACPTCGSCSGMYTANTMNCLTEALGMGLPGNGTVPAVFS
FT                   ERLRLAKKAGMQILEILKADLKPKDIMTKEAFVNAVAVDMALGGSTNTALHLPAVAHDA
FT                   GVKLTIDDFNEIAARVPQLCKLSPSGEYFIEDLYRAGGVTAVMRRLLENGELDGTQKTV
FT                   ALKTQEELCKEAYINDEDVIKPWDKPAYAGGGLAVLKGNLAELGSVVKAGAVADEMQVH
FT                   SGPAKVYNSEEEAVDGILGGKVKSGDVVVIRYEGPKGGPGMREMLTPTSVIAGMGLDKE
FT                   VALLTDGRFSGATRGASIGHVCPEAAVGGTIAVVRDGDIIEIDIPNRTLNVKLSDEEIA
FT                   ARKAELKPYEPEVTGYLKKYALHVGSAVNGAIEEY"
FT   gene            110189..111394
FT                   /locus_tag="Sterm_0103"
FT   CDS_pept        110189..111394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0103"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: ade:Adeh_3448
FT                   L-threonine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06988"
FT                   /db_xref="GOA:D1AJT1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT1"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ACZ06988.1"
FT                   /translation="MLTLCDFVEAKERLSNVLVKTKLIYSSTFSKEFGNTVYIKPENLQ
FT                   RTGSFKIRGAYNKIFMLSEEEKKKGLIASSAGNHAQGVAFAAQKLGVKATIVMPKHTPL
FT                   IKVEATARFGAEVVLHGEVYDEAYEKAKELQEEKGYIFVHPFDDDAVIAGQGTIALEIL
FT                   KELPDVDIIMVPLGGGGLISGIAAAAKLKNPEIKIIGVEPEGAASAIKSLNEGKVTELS
FT                   ESYTIADGAAVKRIGDTTFEYIKKYVDEIITVSDYELMESFLILVEKHKLIAENAGILS
FT                   LAGLRKIKEKDKKIVSVLSGGNIDVLTISSMISKGLISRGRIFSFSVQLPDKPGQLQMV
FT                   SDILTRLNANVIKLDHNQFKNLDRFHEVELQVTVETNGEEHIQKIIKEFKNFGYEILRI
FT                   NI"
FT   gene            111508..111993
FT                   /locus_tag="Sterm_0104"
FT   CDS_pept        111508..111993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0104"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: sfu:Sfum_3025
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06989"
FT                   /db_xref="GOA:D1AJT2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT2"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACZ06989.1"
FT                   /translation="MKKYEILIIAKNTDGIIARIMSLFNRRGYHALKMTAGVTNKLGYT
FT                   RLTLTVEGDDKILDQIQKQVYKITDVVKVKIFPKENVIRRELMLLKVKANIETRAQIVQ
FT                   IAEIYRGEVVDVSPDSVTMELTGDSQKLGGFVDIMESYGVLEIARTGVLAMSRGEKL"
FT   gene            112054..113760
FT                   /locus_tag="Sterm_0105"
FT   CDS_pept        112054..113760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0105"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP- binding; KEGG: geo:Geob_1509 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06990"
FT                   /db_xref="GOA:D1AJT3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT3"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACZ06990.1"
FT                   /translation="MEDKMISGARIILECLSRLGVKNIFGYPGGSVIPIYDELYSFKGL
FT                   NHYFSRHEQGAAHEADGYARVSGEVGVCLATSGPGATNLVTGIMTAHMDSIPLLAITGQ
FT                   VVSNLLGKDAFQESDIVGITVPITKNNYLVQNIKDLPHMMKEAHYIARTGRPGPVLIDV
FT                   PKDIQLAKIPFAEFEKLYNQEIELEGYEPTYHGHPMQIKKAVKEIQNAKKPLIIAGAGI
FT                   LRANASDELKELAEKMDIPVTMTLLGLGAFPSSNELSLGMLGMHGTVYANYATAEADLI
FT                   IAAGIRFDDRITGNPDKFCKNAKIIHIDIDPAEIGKNKKPDIPIVGDLKNILTEINGKL
FT                   KDKNNKEWHEKIKEWKEEYPLIYKKQDESKLCPQEVLEKINSIVKGEAIIVTDVGQHQM
FT                   WAAQYLDYEKPNTICTSGGAGTMGFGLPAAIGAQVAKPKEKVITIVGDGGVQMNIQELM
FT                   VVKQYNLPVKIVILNNSYLGMVRQWQEMFNEKRYSFVDLEHNPDFVKLGEAYGIKSVEL
FT                   SKPEDLVQMEELLNTDGPVLINCIVEKEENVFPMIPSGTSVDQMVGKKGEI"
FT   gene            113761..114249
FT                   /locus_tag="Sterm_0106"
FT   CDS_pept        113761..114249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0106"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: dds:Ddes_1904
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06991"
FT                   /db_xref="GOA:D1AJT4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT4"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACZ06991.1"
FT                   /translation="MTRRHEILIIAKNKNGIVSRIMSLFNRRGYQVQKMTAGVTNKEGY
FT                   ARLTLTVEGDDKTLDQIQKQVYKIIDVVKVKVFPEEGVIRRELMLLKVKANHETRAQIV
FT                   QIAEIYRGKVLDVSPTSLTIELTGDVQKLRGFIDILDNYGILEIAKTGVLAMSRGEKM"
FT   gene            114273..115790
FT                   /locus_tag="Sterm_0107"
FT   CDS_pept        114273..115790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0107"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: nis:NIS_1407 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06992"
FT                   /db_xref="GOA:D1AJT5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT5"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ACZ06992.1"
FT                   /translation="MTRKIKIFDTTLRDGEQTPRVNLNSQEKLRIAKQLESLGVDIIEA
FT                   GFAISSPGDFEAVSTIAEHVKDSTIASLARAVKKDIETAARALEKANKKRIHIFLATSP
FT                   LHREYKLKMGKEEILEKIYEAVKYGKTLMDDIQFSAEDAMRTEPEYLAEAYNAAIAAGA
FT                   TTINVPDTVGYRTPTEIFERITYLRENVKGIDGVDISTHCHNDLGLAVANSIAAVEAGA
FT                   TQIECTINGLGERAGNTSLEEVVMILATRKDKYENLTTRIDTRQIYPTSKMVSLLTGVA
FT                   TQPNKAIVGANAFSHESGIHQHGVLANPETYEIITPESVGRDTNSLVLGKLSGKHAFVD
FT                   KMEKLGFSMDNEKIDELFAEFKKLADKKKYILDEDIISLVTGDAGKFEGRVKLESFEIT
FT                   RREGKPKAEVTITIDNKEQTMTAIGDGPVDAAYHAINNMLGNSYDVAEYKLDSITGDTD
FT                   AQAQVVVIIEKNGERHMGRGQSTDIVEASIIAYINAVNRLYKGEEND"
FT   gene            115783..117372
FT                   /locus_tag="Sterm_0108"
FT   CDS_pept        115783..117372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0108"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: geo:Geob_2938 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06993"
FT                   /db_xref="GOA:D1AJT6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT6"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ACZ06993.1"
FT                   /translation="MIKVEVFDTTLRDGAQARGISFSVKDKIAVTQALDAFGIDYIEAG
FT                   NPGSNPKDLEFFELVKSVELKHSKLVAFGSTRRKDVAPEEDQNLISLLQAGTEYVSIFG
FT                   KSWDFHVTDIIKTTLENNLEMIKDTLLFLKSKGKKVIFDAEHFFDGYKNNPEYALEALK
FT                   AAKDGGAEILTLCDTNGGCFPEEISRITKEVKEKLGDIKIGIHAHNDMGFGVANSIAAV
FT                   EAGALQVQGTFLGYGERCGNANLSTIIANLQLKKDYELVPREKLGLLTSTARIIAEISN
FT                   ITIEDSMPYIGKNAFAHKGGMHIDGVSKASHSFEHINPELVGNEREFLLSEVSGRSTIL
FT                   EEIRRVDKDIQRDSEATAGIIERLKELEYQGYQFEGAKATFELVIRKYLGKYKPFFDLV
FT                   YFDVKGNYIGKKYYSTAVVKVKVKDQIELTVAEGDGPVNALDQALRIALERFYPELKEM
FT                   HLIDYKVRVLKGEENATASKVRVLIESADAKNSWTTIGVSTDIIEASWIALVDSIEYKL
FT                   IQETLKRLEDFG"
FT   gene            117397..118254
FT                   /locus_tag="Sterm_0109"
FT   CDS_pept        117397..118254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0109"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hch:HCH_01549
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06994"
FT                   /db_xref="GOA:D1AJT7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACZ06994.1"
FT                   /translation="MLTKMMKTTFLIFIAALTVIILCYFYACYEFGNIKIKEIEIASAD
FT                   IPESFDGMRIMYAADFQFDARNSFNKKALNKAIDIMNNTDKDIILLGGDYTNWEGKVIP
FT                   FFTEFQKVKKPEYGIYSVTGNHDYSNHTLVLEMIEKTGIKNLDNEKTEIEKNGQKIIIA
FT                   GVEDLWFGNPDAKMVLEDADKKDFVIFLSHNPDYFEEMASSEKEKADITLSGHIHAGQA
FT                   SFFGLFSPFTGSVTRYGEKYRYGMKNFDNHKIYITSGLGGSVFGQYVRFFAQPEIVIVK
FT                   LKKI"
FT   sig_peptide     117397..117495
FT                   /locus_tag="Sterm_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.654) with cleavage site probability 0.613 at
FT                   residue 33"
FT   gene            118352..119659
FT                   /locus_tag="Sterm_0110"
FT   CDS_pept        118352..119659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0110"
FT                   /product="homoaconitate hydratase family protein"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein; 3-
FT                   isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: 3-isopropylmalate dehydratase ;
FT                   K01703 3- isopropylmalate/(R)-2-methylmalate dehydratase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06995"
FT                   /db_xref="GOA:D1AJT8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT8"
FT                   /inference="protein motif:TFAM:TIGR01343"
FT                   /protein_id="ACZ06995.1"
FT                   /translation="MGMTIVEKILAKKSGKDEVKPGENIWVNVDVLMTHDVTGPGSMAI
FT                   FKKNFGENAKVWNNEKIVLVPDHYIFTKNEHAMRNIEYVNQFAVEQELKYFYPPFTNKY
FT                   KGVCHTALAQEGHTRPGEVLFGTDSHTCTAGAFGEFATGIGNTDAAFILGTGKLWVKVP
FT                   ETMRFTFEGKFPEYVMGKDVVLKVIGDIGFDGATYKCMQFDGDAIHGFNMEERMTICNM
FT                   AIEAGGKCGIIEPDEITVEYVTEKTDKPFELIYSDKDADYSAEYKYNANEMEPIVAKPF
FT                   NPGNTDLAKNLGDVKLDRAYIGSCTGGKTTDFVAAAKILKGRKVAIETFIVPSTVKVEE
FT                   ALSKIIIDGETCMEIFEKAGCKIGPPSCAACLGGPVDTFGRTHANEVVISTTNRNFPGR
FT                   MGSMDSQVYLASPYTAAASAVTGHITDPREFLGWEK"
FT   gene            119691..120008
FT                   /locus_tag="Sterm_0111"
FT   CDS_pept        119691..120008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0111"
FT                   /product="Variant SH3 domain protein"
FT                   /note="PFAM: Variant SH3 domain protein; SH3 domain
FT                   protein; KEGG: hap:HAPS_2047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06996"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJT9"
FT                   /inference="protein motif:PFAM:PF07653"
FT                   /protein_id="ACZ06996.1"
FT                   /translation="MKVKVNKKHVSEGNFPLFKAGSTILLKDECNEFFAWYSCEIEGYS
FT                   TYIHEDYFENGKLTADYNPTELDAESGDILEVLLIKNNWLYCRTQNESYGWIPGDNVKT
FT                   I"
FT   gene            120248..120715
FT                   /locus_tag="Sterm_0112"
FT   CDS_pept        120248..120715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06997"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ06997.1"
FT                   /translation="MTMKKVILTLFICLSAIFYAACNVEPTDYFKNAFGEDTTDSMFFV
FT                   ELRQYNERNIMFIKDGKLYIRGKEFTGIDPTKFNSLDYGYYAIDNAVYYLDKKLMDYSG
FT                   KIDNLRTYEVHNTKIDNKNPDCKGEDIGMNDFYLKVLNGRVLYKNGNALGK"
FT   sig_peptide     120248..120322
FT                   /locus_tag="Sterm_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.656 at
FT                   residue 25"
FT   gene            120836..121381
FT                   /locus_tag="Sterm_0113"
FT   CDS_pept        120836..121381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0113"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   3-isopropylmalate dehydratase small subunit ; K01704
FT                   3-isopropylmalate/(R)-2-methylmalate dehydratase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06998"
FT                   /db_xref="GOA:D1AJU1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU1"
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /protein_id="ACZ06998.1"
FT                   /translation="MEKVIKGKVYVLGDNIDTDQIIPAMHLVYKIDDPEEVKLYGKYAM
FT                   SGLPADIAGDKPFIKDGEYTSEYVVMVAGKNFGCGSSREHAPLALEKAGIKAVVAEDYA
FT                   RIFYRNSVDGGFLVPFETPASIKESFATDDEVEIDVEKGTITNITKGQTFELRSLGDVK
FT                   DIIEAGGLFNYAKNNKNI"
FT   gene            121405..122463
FT                   /locus_tag="Sterm_0114"
FT   CDS_pept        121405..122463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0114"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: dvm:DvMF_1794 3-isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ06999"
FT                   /db_xref="GOA:D1AJU2"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU2"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACZ06999.1"
FT                   /translation="MDFKIAVLKGDGIGPEIVNEAIKVLDKIGEKFGHKFNYEQGYLGG
FT                   ESIDKFGKPLTDETVELCKNSDAVLLGAVGGPKWDVIDPAIRPEKGLLGIRKALELYTN
FT                   LRPAILYNALKDASPLKPEIIGDGLDMMVIRELTGGLYFGKKELTKDYAYDTMYYTRGE
FT                   IERIVKKGFEIARLRSKKLTSVEKANVLDSSKLWKEVAIEMGKDYPDVELIHMYADNAA
FT                   MQLVINPRQFDTIVTENTFGDILSDEASMLTGSIGMLPSASLGDGKVGLYEPIHGSAPD
FT                   IAGKGIANPIATILSVAMMLRYSFNLTEEADTIEKAVEAVLNEGYRTGDIYSEGTKKVG
FT                   TVEMGELIKERL"
FT   gene            122481..123671
FT                   /locus_tag="Sterm_0115"
FT   CDS_pept        122481..123671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0115"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dvm:DvMF_3003 putative transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07000"
FT                   /db_xref="GOA:D1AJU3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACZ07000.1"
FT                   /translation="MNLRFADRMNNAQKSFIREILKVVGNPEIISFAGGLPNPISFPIK
FT                   KIQEATDKILEEDGENILQYSTTEGYLPLREYISERYLKNSGVVVPPDEILITNGSQQG
FT                   LDLIGKVFLNKGDCMLMEEPGYLGAIQAFSMFEPEFKTVLMNHDGVDTEKLKESIEKYN
FT                   PKLFYAVPNFQNPSGITYSEENRKQIAGFMKGSDTILIEDDPYGELRFMGSRVPSMKKY
FT                   MNDNVILLGSFSKIVSPGMRLGWIHAGHEIMEKLIIAKQGADLHSNYFSQRVVYEYLKE
FT                   NNIEVHIEKITDLYKKQRDCMVNSIEKYFPKEVQTTKPEGGMFIWVTLPEKYSSMDLFN
FT                   IAIKKKVAFVPGDPFYTGKEGVNAFRLNYTNSTEDKIEEGIKILAEGIKELLSEKN"
FT   gene            123731..124810
FT                   /locus_tag="Sterm_0116"
FT   CDS_pept        123731..124810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0116"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: gsu:GSU1909 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07001"
FT                   /db_xref="GOA:D1AJU4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU4"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACZ07001.1"
FT                   /translation="MSKEILGKTVYYDEDCNLDLLKGKKITVVGYGSQGHAHSLNLKDS
FT                   GMDVTIGLRKESKSWADAEKAGFVVKETADAVKDADVVMILTPDESQADTYEKEVAPYL
FT                   KDGAYLGFGHGFNIHYKKLVPKDTVNVFMVAPKGPGHLVRRTFKEGSGVPCLVAVYQDP
FT                   SGDTREVALAWASGVGGGRSGIIETSFKQETETDLFGEQAVLCGGVTELIKTGFEVLVE
FT                   AGYDPINAYFECLHEMKLIVDLLYEGGFGKMRHSISNTAEFGDYLIGPKIITDDTKKVM
FT                   REVLTAIQSGKFADTFVDDYKAGAPFLKQKREEAAEHAIEKVGAELRTLMSWIDNKEEV
FT                   EVTVNIKGILEQQKEKVTK"
FT   gene            complement(125226..125885)
FT                   /locus_tag="Sterm_0117"
FT   CDS_pept        complement(125226..125885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07002"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07002.1"
FT                   /translation="MPKLDEKSVINLAEEYIKKYKLHKGFPEYKFQFIRFSPSPSLYSD
FT                   EPIWEVAYDAEGWDDLQHSIIISDTEQIALCVSGFQPVWLPKEFQEKEEKLTKREKRLK
FT                   RKGELPDYKIDSYAFTSKYPCLYVDFNEIISDDCVLLSQNSVKSDFWGNPVLLREGLKV
FT                   IGYMQDENTGGMRDDLIVSGVCTRNTTDIFLHVRWLLKFDSKIHFISDLEKEDIKI"
FT   gene            126065..126277
FT                   /locus_tag="Sterm_0118"
FT   CDS_pept        126065..126277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0118"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07003"
FT                   /db_xref="GOA:D1AJU6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU6"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACZ07003.1"
FT                   /translation="MKYKNKEYECSTAKLGERGQIVIPKAIREELGLKQGDNLILLGNK
FT                   EEGIRIINANSLEELAEIVLKEKNN"
FT   gene            126295..128736
FT                   /locus_tag="Sterm_0119"
FT   CDS_pept        126295..128736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0119"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SirA family protein;
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein;
FT                   KEGG: pca:Pcar_0429 uncharacterized NAD(FAD)- dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07004"
FT                   /db_xref="GOA:D1AJU7"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU7"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACZ07004.1"
FT                   /translation="MKIIIIGGVAGGMSAAARLRRLDEKSDIIVIEKSGYVSFANCGLP
FT                   YYIGGVIKEKDSLLLETPSTLKEKFNLDVRVKSEAVSINREKKEIKIKNIETNDEYTES
FT                   YDKLLISTGAKPFVPDIKGLEEAGYLTLRNIEDMEKISSCIDSDGYKNAVIIGGGFIGL
FT                   ETAENLKHKNINVTIIEKADQVMAPLDPEMASFIHGEIKRRNIALYLNSDITEISNSGK
FT                   KKIIKLKSGEVVETDIIIASIGVVPDSELAKNAGLKMSSKGAVEVDEYLKTSDSDIYAA
FT                   GDVIEIRNAITGQKALVPLAGPANKQGRTAADNILGREEKYTGTIGTSIMKFFNMTAAS
FT                   TGINEKYLKKQDINYKSLFIIKADHAGYYPGASDIYFKILFEPETGKIFGAQAVGEKGA
FT                   DKKIDIIATAILGNISVYKLKDLETAYAPPFNSAKDIINYASYMAENIKRDGLETVSWN
FT                   ETDKIGLIDVRTEDEYNIDHIQGAVNMPLNTLRENMGKLDKNKEYIVYCKVGQRGYNAQ
FT                   RILVNNGYKVKNLNGGFSIYKSALMPQDNRIKFENDIKNDKHRSISGLNSADKKILDVT
FT                   GLQCPGPIIKIKNKISELKTGEVLEVKATDPGFENDIKVWTRQTGNTLLNIENTDGEIL
FT                   AEIKKGESFLLSKKPDEEAVKENSTSLVIFSGDFDKVFAALVIANGALAMGNSVSIFFT
FT                   FWGLNVLRKSNYKTRSKKGIIEKCFGIMMPKGVSKLKLSNMNFFGLGRKMINKVMKTKN
FT                   IESLESLLEQYIENGGKITACTMSMDVMGIKKDELIENIEYGGVATYMENANKANHNLF
FT                   I"
FT   gene            complement(128815..129285)
FT                   /locus_tag="Sterm_0120"
FT   CDS_pept        complement(128815..129285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0120"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: YbaK / prolyl-tRNA synthetases associated domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07005"
FT                   /db_xref="GOA:D1AJU8"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU8"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACZ07005.1"
FT                   /translation="MAIEPVKEFFKKFNMEEKIMEFDTSSATVELAAQALNVIPARIAK
FT                   TLAFKKDNSCILIVTSGDVKIDNPKFKSVFEIKAKMPSAEEVLSLTGHAAGGVCPFAVS
FT                   ENIPVYLDISLKRFDTVFPACGSSNSAIELTCDELFRYSDAEKWIDVCKNKE"
FT   gene            complement(129400..130149)
FT                   /locus_tag="Sterm_0121"
FT   CDS_pept        complement(129400..130149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0121"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   cha:CHAB381_0722 inner membrane protein YfcA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07006"
FT                   /db_xref="GOA:D1AJU9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJU9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACZ07006.1"
FT                   /translation="MIFFLIGLFSTIIGSIVGIGGGLIIRPALAGMGAAKSLASFTSSI
FT                   VVLSMSSVTLITYIRKKVHIKIKKILILAAGSIIGGFLGGTLLKFVSESFIDRTYIFML
FT                   ILVLLSVVYRNKIPKMNIKNPFPQFFIGIITGGLSGFFGIGGGPFQVSTLIIFFGLDIK
FT                   EASVDSIFITFLTTISSLTKYTLNGYTDFSLAVYMIPAAILGGYIGSHLNRKINEKKIA
FT                   LIFIISVLLILTVQTYIVITRYLAFIK"
FT   sig_peptide     complement(130057..130149)
FT                   /locus_tag="Sterm_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.815 at
FT                   residue 31"
FT   gene            complement(130189..131565)
FT                   /locus_tag="Sterm_0122"
FT   CDS_pept        complement(130189..131565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0122"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: similar to
FT                   N-sulphoglucosamine sulphohydrolase precursor
FT                   (Sulfoglucosamine sulfamidase) (Sulphamidase) ; K01565 N-
FT                   sulfoglucosamine sulfohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07007"
FT                   /db_xref="GOA:D1AJV0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV0"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ07007.1"
FT                   /translation="MDNVRNYNIVYIHTHDSGTVFSPYGYDSPTENIENFAKEAVVFKK
FT                   AFCTSPTCSPSRSGLLTGMYPHSNGMLGLANRGFALKDYSWHLVSHLKKNLYKTVLCGI
FT                   QHEYGSYSDHKGGAAAIGYDFDITSENNYEYQEDYYLWDTANAENVSEWIKENGSNQNF
FT                   FLSFGMFSTHRKFPEINKEIINENFVKAPYPVPDFEETRNEHAKFLTSAYYADKCFGLI
FT                   IKALRDNNLYENTIIIFTTDHGIPYPYAKCTLFDSGLEVALIMRVPASPKNGSVTDTLV
FT                   SQVDIFATLCDLTGLEKPERLQGKSFSEFFTGKSDKHRDEIYGEINFHTSYEPVRCIRT
FT                   ENYKYIKYYDEEYLKINVSNIDVSETKKLLLENDLLSQEKYSEALYDLYNDPGERKNLI
FT                   NNHEYKGILEDLRKRLLKWQEETKDPLLSDGIKISKNWKINKKTSHEPSSKNPEDYEQL
FT                   "
FT   gene            complement(131612..131896)
FT                   /locus_tag="Sterm_0123"
FT   CDS_pept        complement(131612..131896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0123"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: asu:Asuc_0509
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07008"
FT                   /db_xref="GOA:D1AJV1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV1"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACZ07008.1"
FT                   /translation="MLKVLAACGAGMGSSQIIKMKIKKVLDKLKIESSIDHMSVGQAKS
FT                   MVNNYDIIFVAEGLKNNFNVSDDKKLIGLKNLLSEEEIEEKLKVSLNLA"
FT   gene            complement(131916..133331)
FT                   /locus_tag="Sterm_0124"
FT   CDS_pept        complement(131916..133331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0124"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: ppr:PBPRB0273 ascorbate-specific PTS system enzyme
FT                   IIC/IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07009"
FT                   /db_xref="GOA:D1AJV2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV2"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACZ07009.1"
FT                   /translation="MEIILKIFNLLFTNIIAKPQFFIGLIVFIGYLAIGRKIYDALGGF
FT                   IKAAIGFMILNVGSSGLVKNFDPILKGLSQKYQISAVVIDSNFGFNAATQALESISITT
FT                   SWTMMSLLVGFVWNILLVLLKKFTKVRTVFITGHIMVKQATMVTWIIFAVMPGFRNIYG
FT                   AILVGLLVGTYWAVFANLTVEATRNLTGNSDFAVGHQQMFGIWVTDKIAHKIGNKEKTV
FT                   ENVKLPGWLAVLNDNIIATGLLMIIFFGAVMLFIGEPLLKELDPKAFDGGITFFTYILE
FT                   KSLVFSVNIVILMTGVRMFVAELVESFVGISEKLLKGSIPAVDCAVTFGFSSPNAILYG
FT                   FIFGAVGQLIAILGLIIFKSPIMLIPGFVPLFFDNATLAVYADKKGGIRAATIIPVVSG
FT                   MIQVFGSLAAVYIFNLTQYGGWTGNLDWDTVWPVLGLFINNLQLTGVILVVILMLIIPQ
FT                   LQYIRNKDSYFIK"
FT   gene            complement(133356..134057)
FT                   /locus_tag="Sterm_0125"
FT   CDS_pept        complement(133356..134057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0125"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="TIGRFAM: L-ribulose-5-phosphate 4-epimerase; PFAM:
FT                   class II aldolase/adducin family protein; KEGG: msu:MS0046
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07010"
FT                   /db_xref="GOA:D1AJV3"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV3"
FT                   /inference="protein motif:TFAM:TIGR00760"
FT                   /protein_id="ACZ07010.1"
FT                   /translation="MLEELKERVYKANMELPEKGLILYTWGNVSGIDREKGLIVIKPSG
FT                   VEYDVMKASDMVVVDMDGRVVEGSLNPSSDTATHIELYKAFEEVGGIVHTHSTWATIWS
FT                   QSGRDIKAYGTTHADYFYGPIPCTRKMTAEEIEGEYEKETGRVIVETYRERNLNPLYVP
FT                   GVLVNSHGPFTWGKSPEEAVHNSVVLEEIGRMAASMEMFNENTKSMQQELLDKHFLRKH
FT                   GANAYYGQGKK"
FT   gene            complement(134059..134934)
FT                   /locus_tag="Sterm_0126"
FT   CDS_pept        complement(134059..134934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0126"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="KEGG: hap:HAPS_1781 putative L-xylulose 5-phosphate
FT                   3-epimerase; TIGRFAM: hexulose-6-phosphate isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07011"
FT                   /db_xref="GOA:D1AJV4"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV4"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ACZ07011.1"
FT                   /translation="MNKFDKLVMGIYEKALPKKESWSTKIDIAKQAGYDFIEISVDESD
FT                   ERLARLDWNNEEIKNMKNLLIDKDFRIPSMTFSGQKRFPMGSIDTATREKSMDLMKKAI
FT                   EISDKLGIRIIQVTGYDVYYEERSDKTRELFIQNLKKASEWASKACITLAIENMENTFL
FT                   NSVTKYMEIAKEVDSPWLKLYPDLGNLTAWTHDEVYNELEKGIKSQQIIAVHLKEAKKV
FT                   TDTFGGIFRELEFGTGDVNFVKTFETLKKAEFKGPFLVEMWNESSETPLEDIKKVRDWM
FT                   ISRMKEGGFI"
FT   gene            complement(134979..135617)
FT                   /locus_tag="Sterm_0127"
FT   CDS_pept        complement(134979..135617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0127"
FT                   /product="3-dehydro-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.85"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   eum:ECUMN_4729 3-keto-L-gulonate 6-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07012"
FT                   /db_xref="GOA:D1AJV5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV5"
FT                   /inference="protein motif:PRIAM:4.1.1.85"
FT                   /protein_id="ACZ07012.1"
FT                   /translation="MAKPLLQIALDNNTLSDAIRSISQVGHEVDIIEAGTILCLAEGME
FT                   AVRCLRALYPNKIILADTKCADAGGTVAKNCADAGADWMTVICSATIPTMKAALKEVKD
FT                   LQVELYGDWTFEHAKQWKEAGLSQAVYHQSRDALLAGETWGEKDLNKIRKLVEMGFKVS
FT                   VTGGLEKETLKLFKGIDVYTFIAGRGIREASDPAQAAREFKEEIDKYWD"
FT   gene            complement(135729..136169)
FT                   /locus_tag="Sterm_0128"
FT   CDS_pept        complement(135729..136169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0128"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: kpn:KPN_04588
FT                   L-ascorbate-specific enzyme IIA component of PTS"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07013"
FT                   /db_xref="GOA:D1AJV6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV6"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACZ07013.1"
FT                   /translation="MTLLEYLVKNDSIKVKQKAETWEDAVRITFRPLLEKGVIKEEYID
FT                   SVIERTHELGPYYILAPGLAMPHERPEKGVLKDGFSFITLEKPVVFPDGQDVDILLGFS
FT                   ATSSEVHSNESIPQIVMLFDDEAAFEKIRKAESTDEIIGLLK"
FT   gene            complement(136210..136668)
FT                   /locus_tag="Sterm_0129"
FT   CDS_pept        complement(136210..136668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0129"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: ecf:ECH74115_5711
FT                   ascorbate-specific phosphotransferase enzyme IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07014"
FT                   /db_xref="GOA:D1AJV7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV7"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACZ07014.1"
FT                   /translation="MYNLKNMAEDKLIKLNISSENPEEIIRIGGELLFRNNMVTDSYVQ
FT                   AMVEAYRELGSYIVIAPNIAMPHTSKENGALKTGVSLLTLSKPVNFGNEYNDPVFLIFC
FT                   IANAGEHEELLAILESIVKIGSDDTIKNQMRNADTIEEIEKIINNFDL"
FT   gene            complement(136661..138166)
FT                   /locus_tag="Sterm_0130"
FT   CDS_pept        complement(136661..138166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0130"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: seh:SeHA_C1020 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07015"
FT                   /db_xref="GOA:D1AJV8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV8"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACZ07015.1"
FT                   /translation="MKAIIIFFDSLNRHFLPNYGNDWVNAPNFKRLDEKTLTFDRSYVG
FT                   SMPCMPARRELHTGRHNFLHREWGPLEPFDDSMPEILKKAGVYTHMITDHFHYWEDGGA
FT                   TFHNRFSSYEMIRGQEGDHWKGEAEYKEDKEFLSIPEPHSGSGKVSSLWRYDRINRKYM
FT                   DTEEKQPQSKVFSLSCEFIEKNSSYNNWLLHIETFDPHEPFFVKDKYLEQYKDTYSGPE
FT                   FDWPRGEVKESPEAVEHIRKKYAALVSMCDKNLGMILDLMDKHNMWEDTMLIVGTDHGF
FT                   LLGEHGWWGKNLMPYYNEIANTPLFIWDPRSKKKNERRNAIVQMIDWAPTLLDYFDVAI
FT                   PETMKGKSLKETIETDVPVRKECIYGVHGGHVNMYDGNYTYMRAPAFKENKPLYNYTLM
FT                   PMHMNKLFSVDEIKDAELSEPVNYSKNVPVLKFRAEDKYKIYKYGTLIFDINNDPKQLY
FT                   PVKDKALEQNLTEKLIKNMEFHESPKDQYTRLGLNMPKEKKNV"
FT   gene            complement(138177..138497)
FT                   /locus_tag="Sterm_0131"
FT   CDS_pept        complement(138177..138497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0131"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: seg:SG0865 putative
FT                   phosphotransferase enzyme II, B component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07016"
FT                   /db_xref="GOA:D1AJV9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV9"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACZ07016.1"
FT                   /translation="MKDTVNILFVCGYGAGSSLIMKMTAEAAMKKFKINSDTKVTSVGE
FT                   VNSYFDWADIIAVSEKLAEGIVLPSNKEVKMIKIANLVDGEKMGNDIYNTVKESFPTAL
FT                   KG"
FT   gene            complement(138590..139921)
FT                   /locus_tag="Sterm_0132"
FT   CDS_pept        complement(138590..139921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0132"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: sea:SeAg_B0921 ascorbate-specific PTS system enzyme
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07017"
FT                   /db_xref="GOA:D1AJW0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW0"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACZ07017.1"
FT                   /translation="MNILKILFNFLVNDFLGNPIMLIGFLVALGYILRKETKSKTITGT
FT                   ITAMVGLNLIMFGGSQMTKYFKPITDAVNKAYGIKGYLMDPYAMRAATQEGLGSRFGLI
FT                   GYVFLVAFMVNVLLVYFGKYTKMHGIFLTGHTGFAHSQAVLWLVVYYFAFGSAATVLIS
FT                   GVLLGVYWAFSTNLAIKSSNKITNNAGFTIAHNQMVGMWFFSKIAGFFGDPEEHDAEKM
FT                   NLPGWLSIFNNNVVSVAIIMTIFIGCFMMTLGISGVQKLAGDSNWFIYILMSGINFSMY
FT                   MVLILTGVRMFIGELSASFKGIQEKLIPNAVPGVDVAAILAYSPNAATLGFLFCTLGTI
FT                   IGMGILMIFKVPYMVLTGFVPLFFDGGPIGVVANKYGGWRAVAISGVLLGLIHVFGTVW
FT                   MLKISGLEDGIGWAGMFDWSTVWPAITELLRMIAKIFSLGPFAG"
FT   gene            complement(140039..141103)
FT                   /locus_tag="Sterm_0133"
FT   CDS_pept        complement(140039..141103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0133"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="KEGG: sec:SC4256 putative L-ascorbate 6-phosphate
FT                   lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07018"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW1"
FT                   /inference="similar to AA sequence:KEGG:SC4256"
FT                   /protein_id="ACZ07018.1"
FT                   /translation="MSKVEEITRESWILNTFPEWGTWLNEEIEEEAVEKGTFAMWWLGC
FT                   TGIWVKSEGNTNIVIDFWCGTGKRTKKNKLMKKQHQMQRMVGGVKLQPNLRTSVFVLDP
FT                   FAIKELDAVLATHDHADHIDPNVAAAVLKNCDPSVPFIGPQACVDLWISWGVPAERCKA
FT                   VKPGDTVKIKDIELVVLESFDRTELVTAPEGVILKDKMPQDMDRLAVNYLVKTPGGNLY
FT                   HSGDSHYSNYYAKHGNEHKVDVALGSYGENPRGMTDKMTSVDILRMGESLKTQVVIPFH
FT                   HDIWSNFQADPYEIMMLWKMKKDRLKYEFKPYIWQVGGKFIFPNDKDKLEFHFERGFED
FT                   CFTIEPDLPFKSML"
FT   gene            complement(141150..143216)
FT                   /locus_tag="Sterm_0134"
FT   CDS_pept        complement(141150..143216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0134"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; phosphoenolpyruvate-
FT                   dependent sugar phosphotransferase system EIIA 2; KEGG:
FT                   asu:Asuc_0583 transcriptional antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07019"
FT                   /db_xref="GOA:D1AJW2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW2"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACZ07019.1"
FT                   /translation="MLNQREMNILKYLIKKPSSKYKELAEIFQISERSIRYNIDKINLF
FT                   LQKNKLEEIQIKNGNLFFNTDQELTGINSSLNNSYILNQKERTEILKLLFCFSRDINLT
FT                   KAADYLKVSRTTIKSDFEILKNEIKAVNFNIKYRQNKGFYISGSRKHLRSFKLETFSKF
FT                   ISIYIKELYLSNFDKIIYELFQKNIPEKSGQQINNFIRELEKKLSLNFSNNSYEILYSL
FT                   ILCFFVNDKNNSISKQSDYDSINNFFLESTKEYEIIKNTSKEFSGLIGIKFSKHRITEI
FT                   TDYILGISLCNFDISLVNNWINVEFLVQSLIANFNKYLEIDISGDKTLFNCLLYHIKPT
FT                   LYRINKKIKLENTAFRELIINQDPTLEIVKNAVNDMEKALNIEFTEEELALLAYHFKAS
FT                   IERNTYVYPKRVILVCGLGYGSSRLLEQNLKEHYNLDIIDVLPYHQLEEALKNYNNIEL
FT                   IFTTINIKNNYGIPVIKISPLLKKEDIEEIEKYNILKNDNKISLAKLMNVIEKNINLNT
FT                   KDKKELIAGIRENFSHKIIDDSEIKPENFNNLINENNIEILDRLESWSDAIKVSGELLI
FT                   KQNYVTKDYIQEMKELVEKFGSYIVVADGIAIPHGSIGKNVIKDGAALLVLKEAVKFDD
FT                   GEMVNIFIPFATRGKKFHSKLLNEIFDIIKRKNLKDKILSLKTKQEIIKYLNR"
FT   gene            143825..146557
FT                   /locus_tag="Sterm_0135"
FT   CDS_pept        143825..146557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0135"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: Autotransporter beta- domain protein;
FT                   peptidase S8 and S53 subtilisin kexin sedolisin; KEGG:
FT                   har:HEAR0231 peptidase S8"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07020"
FT                   /db_xref="GOA:D1AJW3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW3"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07020.1"
FT                   /translation="MKRILLLPLILTSILSCGSSGGGGGSGGGGSGATATPVAPSIPFN
FT                   PGDPHNVQETRSEGYDGAGVTVGIIDTRFNVTNAEFKDSSGNSRLSEDASFVGVNNIHG
FT                   SLVAEVIGGKTIGMAPDVKMYGAAAGAVCSDGTNRCISPKVRMYEDLYNSGVRIFNQSF
FT                   GIDSLSVTDAKKTDFPLSDPVINFYAEKAGTDSLFIWANGNAGKDQPQIESGLPYLYPE
FT                   LQKGWIAVTAVDSQTGEISSYANKCGVAQNWCIAAVGDYTFHVSNVTGEGTSFASPAVT
FT                   GAAALVQQKYPWMNGDLIRQSILSTATDVGAAGVDAVYGWGLLNASKAANGPALFDKRL
FT                   ALGDYVNVSFDNYTSTFSNNISGDAGLTKSGSGTLILSGNNTYTGKNIVNGGILKVNGQ
FT                   VLSQVDIQSNGTLLVDGGIIQNNVLNHGGTMINEGNGTTIHGIYMASSEAVTEHAMGAE
FT                   FKVHGRVILNNSKLYIKTPGAGHNIYKYINSSEGISGRVLSASEGIESTFGSVVVPVLL
FT                   NSEITQDSNNIDLKITRKNVAEFSAAEYNSDSTRNNSSENLEKVFQVLDNSEANELFRV
FT                   QAALIQQSSSHTFAVTLDSISGQIYASAQALTFQQMQAVNKDLSNRLSMAGYNKDNTGV
FT                   WFNALGGAGQLYESGYAKADTHFYGGQLGVDKNITDNIILGAAAAFTEAKADFDRYAGK
FT                   AKSQNVGISLYGKYTFAGDNMYMLGRVGAAYITSDVDRDVVIGNYAEKLSADHDDYAFS
FT                   GYGELGYKFMVTENIGLTPFAGLMYESVRRGSFSEDDSLFGLKADSKTYNQSSGLVGVK
FT                   AETTFNWMAGKTTLQSYLTWQGAFNDEDLSFDAAYTGMPDQKFKVEGIGLADNTTWFGI
FT                   GALTEITAVWSWYANYDMQIEKSRIMNNVFSVGARYSFH"
FT   sig_peptide     143825..143932
FT                   /locus_tag="Sterm_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.372 at
FT                   residue 36"
FT   gene            complement(146716..147222)
FT                   /locus_tag="Sterm_0136"
FT   CDS_pept        complement(146716..147222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0136"
FT                   /product="protein of unknown function DUF1706"
FT                   /note="PFAM: protein of unknown function DUF1706; KEGG:
FT                   hhe:HH1054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07021"
FT                   /db_xref="InterPro:IPR012550"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW4"
FT                   /inference="protein motif:PFAM:PF08020"
FT                   /protein_id="ACZ07021.1"
FT                   /translation="MARPATKDELLALSNKNYLKLTELVNSLSEEEQKMKFPFEDRDKN
FT                   IRDVLGHLHEWHLMMIKWYTAGMKGEKPVIPAEGFTWKTLPDLNAVIWEKYQNVNLEDV
FT                   KKKLNDSHNEIEALIKSHTNDELFTKKLYPWTKTTSLGSYFISSTSSHYDWAYKKIQKF
FT                   TKSLK"
FT   gene            complement(147595..147891)
FT                   /locus_tag="Sterm_0137"
FT   CDS_pept        complement(147595..147891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07022"
FT                   /db_xref="GOA:D1AJW5"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07022.1"
FT                   /translation="MSKFIKNILNIILPVISIFIAYFLLKTKIRIIYFHGYCSLLNDRT
FT                   LITHFSKCGTGYSETPDMMFKDIYILFILYLICIINLYFYKKRLKKFGNSDNI"
FT   gene            147913..148488
FT                   /locus_tag="Sterm_0138"
FT   CDS_pept        147913..148488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07023"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07023.1"
FT                   /translation="MKRGVFISITYISRRGESINFEVIKVNIGKQHYNLPVRMENQGAG
FT                   HRVSRISVLMNCRSVSDIVYSYLQPTHNKIFQRLTNIYYSKFNEEFAPGWLKLYHETCG
FT                   HMNLYIENLLAEETAVTHGIRFFRWMNREEMLRSSEIADVGFEDNNSAYFNSTSVVVGG
FT                   RREKYYRMSSRANLRNFAGIDYDIEINI"
FT   gene            complement(148657..149172)
FT                   /locus_tag="Sterm_0139"
FT   CDS_pept        complement(148657..149172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sea:SeAg_B2063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07024"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07024.1"
FT                   /translation="MKINKPDFNECVLLFEPEQEALDLFFEKYKEEMNRHSLEKDLPPD
FT                   IIFSYLFGVVVDWREYDSDIIKYFSEYIPEKNVSAEETDKGLKVMYDGSSFDIRLSFSG
FT                   ADRYITIRSFNEIISSDYEIRLFDSSFYSDTHVFLILPKSWWNDLDNRFGEKVSGIFTV
FT                   ITEGLDFP"
FT   gene            complement(149185..149973)
FT                   /locus_tag="Sterm_0140"
FT   CDS_pept        complement(149185..149973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0140"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: aha:AHA_0035 Cof family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07025"
FT                   /db_xref="GOA:D1AJW8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW8"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ07025.1"
FT                   /translation="MIKAVFSDLDGTLLNENGTVSEETKEMIEKLKKAGIKFFIATGRS
FT                   FLAMKRFYDHLELDTEIVNYNGAVIHNSDGGKIFELTLDDSVARELIDYGRKNNLYYHG
FT                   FSNEKWYLEDYNDTAKAYGAKSQLQENIINFDNMPKLDFNKMMFINDAETTKIVDSYVI
FT                   EKYKNKIYKGLSSPTFLEIMNPDVSKGNAVKFLLEKYGFQPDEVIAFGDAENDLEMLFS
FT                   VKYGVAMENANDEVKSKVNYIAPKNTENGVALFLEDFLKL"
FT   gene            150270..151334
FT                   /locus_tag="Sterm_0141"
FT   CDS_pept        150270..151334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0141"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="KEGG: sec:SC4256 putative L-ascorbate 6-phosphate
FT                   lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07026"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJW9"
FT                   /inference="similar to AA sequence:KEGG:SC4256"
FT                   /protein_id="ACZ07026.1"
FT                   /translation="MSKVEEITRESWILNTFPEWGTWLNEEIEEEAVEKGTFAMWWLGC
FT                   TGIWVKSEGNTNIVIDFWCGTGKRTKKNKLMKKQHQMQRMVGGLKLQPNLRTSVFVLDP
FT                   FAIKELDAVLATHDHADHIDPNVAAAVLKNCDPSVPFIGPQACVDLWISWGVPAERCKA
FT                   VKPGDTVKIKDIELVVLESFDRTELVTAPEGVILKDKMPQDMDRLAVNYLVKTPGGNLY
FT                   HSGDSHYSNYYAKHGNEHKVDVALGSYGENPRGMTDKMTSVDILRMGESLKTQVVIPFH
FT                   HDIWSNFQADPYEIMMLWKMKKDRLKYEFKPYIWQVGGKFIFPNDKDKLEFHFERGFED
FT                   CFTIEPDLPFKSML"
FT   gene            151414..152838
FT                   /locus_tag="Sterm_0142"
FT   CDS_pept        151414..152838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0142"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: vcj:VCD_000008 PTS system 3-keto-L-gulonate/L-
FT                   ascorbate specific IIC component (SgaT)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07027"
FT                   /db_xref="GOA:D1AJX0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX0"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACZ07027.1"
FT                   /translation="MGYLELVWQIFVDNILGKPEFFIGIIVFIGYLLLKKPVYEAFAGF
FT                   IKGTVGYMILNVGSGGLVTTFRPILAGLNGRFGLNAAVIDPYFGLNAVNTALESIGLAS
FT                   SWTMISLLIGFVLNIVLVLFRPVTKIRTLFITGHIMVQQATTATWIIFYAFPQYRNGIG
FT                   AVLIGVFVGVYWAVASNLTVGATQRLTDNAGFAIGHQQMFAVWFADKVAAKIGNPKKRL
FT                   DDINLPNWLSIFHDNIIATGTLMLIFFGSIMILLGEPYLREIDKTFVASMAFPTYIISK
FT                   SLMFSVYLAILMMGVRMFVAELTASFQGISSRILPGVLPAVDCAAVYGFGSPNAVLFGF
FT                   VCGAIGQFVTIAGLLIFKSPILIITGFVPVFFDNATIAVFADKRGGARAAAILSFASGI
FT                   LQVLGGALAIIIFGLAGFGGWHGNIDQSTVWVIQGLVINKLHLVGYIIVIASMLAIPWI
FT                   QFKRSSSPESYNENLE"
FT   gene            152867..153145
FT                   /locus_tag="Sterm_0143"
FT   CDS_pept        152867..153145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0143"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: kpe:KPK_5080 ascorbate-specific
FT                   phosphotransferase enzyme IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07028"
FT                   /db_xref="GOA:D1AJX1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX1"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACZ07028.1"
FT                   /translation="MMKVLAVCGNGMGTSMIMKMKVGNVLKRLNIPAQVDSCSMGEAKS
FT                   AIGNYDLILASVHIAKELDSAKAKIIGLLNLLDEKELEEKLKEAGIA"
FT   gene            153164..153604
FT                   /locus_tag="Sterm_0144"
FT   CDS_pept        153164..153604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0144"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: kpn:KPN_04588
FT                   L-ascorbate-specific enzyme IIA component of PTS"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07029"
FT                   /db_xref="GOA:D1AJX2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX2"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACZ07029.1"
FT                   /translation="MTLLESLIENNSILLKQKAETWEEAVNKCIKPLVDAGAVEQRYLD
FT                   AIIKKTNELGPFYILAPGLAMPHDRPESGVIKDSFSFVTLEKPVVFPDGQEVDILIGLA
FT                   ATSSDIHNEEAIPQIVMLFDDEAAFEKIRKAESTDEIIGLLK"
FT   gene            153716..154354
FT                   /locus_tag="Sterm_0145"
FT   CDS_pept        153716..154354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0145"
FT                   /product="3-dehydro-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.85"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   eum:ECUMN_4729 3-keto-L-gulonate 6-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07030"
FT                   /db_xref="GOA:D1AJV5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJV5"
FT                   /inference="protein motif:PRIAM:4.1.1.85"
FT                   /protein_id="ACZ07030.1"
FT                   /translation="MAKPLLQIALDNNTLSDAIRSISQVGHEVDIIEAGTILCLAEGME
FT                   AVRCLRALYPNKIILADTKCADAGGTVAKNCADAGADWMTVICSATIPTMKAALKEVKD
FT                   LQVELYGDWTFEHAKQWKEAGLSQAVYHQSRDALLAGETWGEKDLNKIRKLVEMGFKVS
FT                   VTGGLEKETLKLFKGIDVYTFIAGRGIREASDPAQAAREFKEEIDKYWD"
FT   gene            154563..155438
FT                   /locus_tag="Sterm_0146"
FT   CDS_pept        154563..155438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0146"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="KEGG: hap:HAPS_1781 putative L-xylulose 5-phosphate
FT                   3-epimerase; TIGRFAM: hexulose-6-phosphate isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07031"
FT                   /db_xref="GOA:D1AJX4"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX4"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ACZ07031.1"
FT                   /translation="MNKFDKLVMGIYEKALPKKESWSTKIDIAKQAGYDFIEISVDESD
FT                   ERLARLDWSNEEIKNMKNLLIDKDFRIPSMTFSGQKRFPMGSIDTATREKSMDLMKKAI
FT                   EISDKLGIRIIQVTGYDVYYEERSDKTRELFIQNLKKASEWASKACITLAIENMENTFL
FT                   NSVTKYMEIAKEVDSPWLKLYPDLGNLTAWTHDEVYNELEKGIKSQQIIAVHLKEAKKV
FT                   TDTFGGIFRELEFGTGNVNFVKTFETLKKAEFKGPFLVEMWNESSETPLEDIKKVRDWM
FT                   ISRMKEGGFI"
FT   gene            155440..156138
FT                   /locus_tag="Sterm_0147"
FT   CDS_pept        155440..156138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0147"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /note="TIGRFAM: L-ribulose-5-phosphate 4-epimerase; PFAM:
FT                   class II aldolase/adducin family protein; KEGG: msu:MS0046
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07032"
FT                   /db_xref="GOA:D1AJX5"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX5"
FT                   /inference="protein motif:TFAM:TIGR00760"
FT                   /protein_id="ACZ07032.1"
FT                   /translation="MLEELKERVYKANMELPEKGLILYTWGNVSGIDREKGLIVIKPSG
FT                   VEYDVMKASDMVVVDMDGRVVEGSLNPSSDTATHIELYKAFEEVGGIVHTHSTWATIWS
FT                   QSGRDIKAYGTTHADYFYGPIPCTRKMTAEEIEGEYEKETGRVIVETYRERNLNPLYVP
FT                   GVLVNSHGPFTWGKSPEEAVHNSVVLEEIGRMAASMEMFNENTKSMQQELLDKHFLRKH
FT                   GANAYYGQKK"
FT   gene            156371..156775
FT                   /locus_tag="Sterm_0148"
FT   CDS_pept        156371..156775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0148"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: rlt:Rleg2_3945
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07033"
FT                   /db_xref="GOA:D1AJX6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACZ07033.1"
FT                   /translation="MDKIDLRTNPNLIIVLGEYIRSKRVEKGIGLREMAEHLSISPAYL
FT                   SNLESGKHPMINPLLLKKISRKLNIDHLKLFKMIGYTDKDTEELKKEITSELLDEIDDV
FT                   EIGKILGKLMEMSPDELQLVKQYIEFISKK"
FT   gene            156922..157416
FT                   /locus_tag="Sterm_0149"
FT   CDS_pept        156922..157416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0149"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: abu:Abu_0978 HAD-superfamily
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07034"
FT                   /db_xref="GOA:D1AJX7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX7"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ACZ07034.1"
FT                   /translation="MIKLIILDVDGTLTKGGILIGNSGEEFKEFNVKDGYMIASARKKC
FT                   GKIFAIITGRNSKIVSIRAKELGITHLYQGIDDKIVVYEQLKKELNITDEETAYIGDDL
FT                   NDFEVMKRVGLVGAPADACREILETADFVSSKNGGEGAVREFLEYILKKENSWNKIVQS
FT                   N"
FT   gene            157426..159927
FT                   /locus_tag="Sterm_0150"
FT   CDS_pept        157426..159927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0150"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: Dak phosphatase;
FT                   DegV family protein; KEGG: dvm:DvMF_0600 DegV family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07035"
FT                   /db_xref="GOA:D1AJX8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX8"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ACZ07035.1"
FT                   /translation="MRIRYIDAKRLRMLLIAGSKWLVMHEEVLNELNVYPVPDGDTGSN
FT                   MSMTISSVEKELTKVDEKSSMNEVSEAVEEAILMGARGNSGTILSQIITGFLKGIGDKD
FT                   RLYAADVVTALESAKEVAYKAVNQPVEGTILTVIRKVAESAREYVKTSDDLVGLLENIK
FT                   DTAQEAVEQTPEELPKLKEAGVVDAGAKGLFYMLEGFYMLITQADLIEEIEPTEVKNAD
FT                   FSSTIANIDHDPDSIKFQYCTEFIIGSSSFDTDKFKAEILELGDSAVFAQSSKKFKVHV
FT                   HTNNPGQALELALKNGDLEKVKIENMKLQHENLYVKQPDEEGAKIFVSDKVTLSEKGHI
FT                   IVADTENLKNEFLKNGADVVILGGQSKNPSVQDILNALEKLDKKIIYIYPNNKNIISTA
FT                   KLACGKSDKNAVVMETRTMLEGNFYIKDRNDEIEKLMEEEKRNVSIEVTKAVRDTKVDD
FT                   LEIKQGNYIALINGKIKYAENDLKTLVSNVLDQNITKDTMTITVAEGSEKDEQCKKLIE
FT                   EKSARLYKTFINGNQENYYYYIYLENKNPNMPEIAILTDSTSDLVPEEVMNLPISIVPL
FT                   KVEFDGNLYKDIFEISRTQVWEEILKTNTGLKTSQPAPQDFLKAYKRLFEKGYKKILSI
FT                   HISSKLSGTSQSAQVAKNLLEEKDNIEILDSLTTTSALGHLVTEAAKKSLKRESAQSIV
FT                   SWVENTRSKARFLIALNDLKFLEKGGRIGKATSYIGSALHLKPIIGVRNGEVIPEKKVI
FT                   GEMGVMNYIRKTIKQETENQSVYLYVVWAGVARSLDVADKIAKEYEKNPKVTVVNIKLV
FT                   GPVIGSHVGSGFGIITYPKLS"
FT   gene            160086..161000
FT                   /locus_tag="Sterm_0151"
FT   CDS_pept        160086..161000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0151"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: CBS domain containing protein;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; KEGG: sat:SYN_00943 nitrogen regulatory IIA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07036"
FT                   /db_xref="GOA:D1AJX9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJX9"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACZ07036.1"
FT                   /translation="MRISNFISKELVFLNTESENVEELINNILDKAAEVDEEVRNNLDK
FT                   AKKAVLKREDETSTALGHGIVLPHGRIDGYDDTTVISGTLKKPMKAIVRNKEESIELFF
FT                   IILSGLTKNRTVLKLMSLVSYLGHQNEFLEKVKGVKSEDEFIELIQEYENDIKQTVTSE
FT                   DLMDTTVRPVSLSEPLESVAARFIRENKTGLPVVDGTGCFVGEITERELIEFGMPKYAS
FT                   LVSGLSFMTVGEPFEEYFLNAGKVTVRELYRKSKNLVDKQASIMEICFNMITEGRTRLY
FT                   VVENDKYFGMIERRDIIKKFLHI"
FT   gene            161031..162290
FT                   /locus_tag="Sterm_0152"
FT   CDS_pept        161031..162290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0152"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; Arsenical pump membrane
FT                   protein; KEGG: dps:DP2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07037"
FT                   /db_xref="GOA:D1AJY0"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY0"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ACZ07037.1"
FT                   /translation="MLVAIIIFCLAYILIIFEKFPISVLAMLGAIVMVMTGVLGAEEAF
FT                   RAIDLNVIFLLVGMMIMVSILAETGLFEWIAIKATQLVKGEPIPLLVLLMLATAVFSAF
FT                   LDNVTTILLIVPVTIVMLENLKLDTKPFIIGEILASNIGGTATLIGDPPNILIGSEAGF
FT                   SFNDFIINLGPVIIINLIVTIFLLYFFYCRKLKVSRELKAHIMELSPDRALKDKKLMYQ
FT                   SLVILLLVIAGFVSHEITHIEPSIIALAGAMALILVSKKEPEEIFEKVEWPTLFFFMGL
FT                   FIMVEGLVEVGVIQMLAEATLSLTKGDFQKTALFIGILSSSVSPIIDNIPYTTTMLPLI
FT                   KNLETAFPNVDALWWSLALGACLGGNATLIGASANVVAANISKKNGKVISFIEYLKYGL
FT                   PLTFVTIVIAMIYLNFRYLR"
FT   sig_peptide     161031..161153
FT                   /locus_tag="Sterm_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.547 at
FT                   residue 41"
FT   gene            162374..163069
FT                   /locus_tag="Sterm_0153"
FT   CDS_pept        162374..163069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0153"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: fph:Fphi_0269
FT                   biotin-(acetyl-CoA-carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07038"
FT                   /db_xref="GOA:D1AJY1"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY1"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACZ07038.1"
FT                   /translation="MRIEHLELTDSTNEVLKRKRHKQEYDIVYADNQTASKGRRGNKWI
FT                   SDKGAALFSFLVKDNDYGEKTSLLVGYAVYKILDGILESDKLTFKWPNDIHYNGRKISG
FT                   ILIEKCEDFLIVGIGINVNNTDFGVYGETALSLKLITGKEYDVKNIIVKTVEETKQRLE
FT                   KIAEEWEAVIDFLNEKHSLNNKLVENNQKEQYEVIKINYDGSLKVKKDGEKNYTDIYSD
FT                   EIKGIKIKN"
FT   gene            163539..165040
FT                   /locus_tag="Sterm_R0001"
FT   rRNA            163539..165040
FT                   /locus_tag="Sterm_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            165119..165195
FT                   /locus_tag="Sterm_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            165119..165195
FT                   /locus_tag="Sterm_R0002"
FT                   /product="tRNA-Ile"
FT   gene            165214..165289
FT                   /locus_tag="Sterm_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            165214..165289
FT                   /locus_tag="Sterm_R0003"
FT                   /product="tRNA-Ala"
FT   gene            165370..168294
FT                   /locus_tag="Sterm_R0004"
FT   rRNA            165370..168294
FT                   /locus_tag="Sterm_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            168370..168483
FT                   /locus_tag="Sterm_R0005"
FT   rRNA            168370..168483
FT                   /locus_tag="Sterm_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            168495..168571
FT                   /locus_tag="Sterm_R0006"
FT                   /note="tRNA-Asn1"
FT   tRNA            168495..168571
FT                   /locus_tag="Sterm_R0006"
FT                   /product="tRNA-Asn"
FT   gene            168696..169121
FT                   /locus_tag="Sterm_0154"
FT   CDS_pept        168696..169121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07039"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07039.1"
FT                   /translation="MKEISKLFKNVDKLVFMSSSMGNSEMDWNYSGTGKTSVICEDNKI
FT                   FFLDRITIDDRLSYEDKKMWILNDNDVLEFWHYRNNEYEKIFTFSKWEPNTLIAGEYIC
FT                   GDDVYMGRVEADNSDIIFIIEIKSKKKNELIKYKYFK"
FT   gene            169131..169673
FT                   /locus_tag="Sterm_0155"
FT   CDS_pept        169131..169673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0155"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; KEGG: apa:APP7_0902
FT                   D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07040"
FT                   /db_xref="GOA:D1AJY3"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY3"
FT                   /inference="protein motif:TFAM:TIGR00213"
FT                   /protein_id="ACZ07040.1"
FT                   /translation="MNKYILLDRDGTINIEKDYLYKIEDFEYEYGVIEALEIFQKKGYK
FT                   LAVITNQSGIGRGYYSEEDFLKLTSFVENDLKKKGIIIEKTYYCPHHTDGKGNYKTECE
FT                   CRKPGTLLFEKAVKELDIDTRNTYMLGDKASDLIPADKLGIKPVFLRTGHGREESLKGL
FT                   DFDFLSFDNILDFAKTL"
FT   gene            169924..171231
FT                   /locus_tag="Sterm_0156"
FT   CDS_pept        169924..171231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0156"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate/D-alanyl-D-alanyl
FT                   ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-
FT                   diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur ligase
FT                   middle domain protein; cytoplasmic peptidoglycan synthetase
FT                   domain protein; KEGG: gme:Gmet_0408
FT                   UDP-N-acetylmuramoyl-tripeptide- -D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07041"
FT                   /db_xref="GOA:D1AJY4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY4"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACZ07041.1"
FT                   /translation="MKKNYIFKMTLEEFGISNFLDILEINNVLINSGEVRENDVFIAIR
FT                   GGNSYIQEAAEKGAYVIYDDKTKKTPYPKAFLVNDSIKFLQKFAENWRNILDLKIIGIT
FT                   GSNGKTTVKDIIYQLLSTKYKGKKTEGNLNNHIGLPVSLLRAENSDDFLVLEMGMSGFG
FT                   EIDLLAAIAKPDYGIITNIGDSHLEFLGSRENVFKAKSEIIKHVKAKMFLNGDDPFLGD
FT                   LPGIKVSADGKSTADYRAKNINLSGDGTKFDLNEGLTLETNLIGEHNILNLLFGIAISE
FT                   EFGIKTEDLADEFKNIKLTAMRFQKIENGNIIYINDAYNASPISMEKAILTFSDIYNDR
FT                   YKVVILGDMLELGEKDAEFHEELEKILRNTKQNEILLYGSLMKNLYEKIKDMNVFHFDE
FT                   KSFIREKLRGHNSEKLAVLLKGSRGMRLEEIIEEGN"
FT   gene            171236..172324
FT                   /locus_tag="Sterm_0157"
FT   CDS_pept        171236..172324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0157"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferas
FT                   e"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: fta:FTA_1703 phospho-N-acetylmuramoyl-
FT                   pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide- transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07042"
FT                   /db_xref="GOA:D1AJY5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY5"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACZ07042.1"
FT                   /translation="MLYLLHQLFFEDLKILRIFKSITIRASISFFLALLFVLILGKPFI
FT                   AWLKKKKYGDTVREEGPQSHFSKSGTPTMGGLLIIGAILFATAICGNFSNKFIVFLFFI
FT                   TILFSTIGFYDDYLKLTKHKKGLSSKKKILGQLIITILTFIFIYKYGLISPRVDFSIVN
FT                   PIIKNSYFYITPALFFVFMAVVIIGSSNAVNLTDGLDGLVTGPIIIVCATLAIITYLTG
FT                   HIEYADYLNLFYVKDAGEMLVYLVSIIGASIGFLWYNFYPAQVFMGDTGSLTLGGVLGI
FT                   VVIFIKQELLLPVAGFIFIVEALSVMIQVWHYKKFGKRVFRMAPIHHHFELLGIPETKV
FT                   TIRFWIISILMALLTFLILKLR"
FT   gene            172341..173678
FT                   /locus_tag="Sterm_0158"
FT   CDS_pept        172341..173678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0158"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   geo:Geob_0778 UDP-N-acetylmuramoylalanine/D- glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07043"
FT                   /db_xref="GOA:D1AJY6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY6"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACZ07043.1"
FT                   /translation="MKNAIVFGAGLSGHGAKELLEKKGYNVFLIDDKTGIKSEEGIKII
FT                   DEQKIEFIVKSPGIPWDAELLEKADSLRISVISEIDLAYRYMDKKTKIISITGTNGKTT
FT                   TATKIYELLKEAGFDAELAGNAGFSFAKLVSDGKEPDYVVLELSSYQLENDPEVHSHIA
FT                   GIINLTPDHLTRYNSLDDYYKTKFNIFDHQNENDYALINLDDKEILRIISENKDIDDKI
FT                   KAKRIFLSGEKKADVFQKDGMINVTDHNSQLIPLMKTSELSLKGKHNLENILFIISVGM
FT                   ILNVDIEVMKSFLSSTKPLEHRLENFFEKGKTVFINDSKGTNSESTIKAIEAFGKSTVL
FT                   ICGGYDKQASNKELIDKIAEKVEFVYLIGQTSDILEKELKDQKYTQYKNLKTLENVLND
FT                   IKDNLDFSKEQVVLFSPATSSFDQFKNFEDRGRIFKELTNQIIGDR"
FT   gene            173679..174788
FT                   /locus_tag="Sterm_0159"
FT   CDS_pept        173679..174788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0159"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: gbm:Gbem_0490 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07044"
FT                   /db_xref="GOA:D1AJY7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACZ07044.1"
FT                   /translation="MKEKRTLSITFIISIMILIVIGIAMMFSVSFTSGLHEYRNYYYFI
FT                   IRQLIWITAGGFFMIVASRINYKRYKKIRGLFFIGGFALLVLVLIIGKEVNGAKRWLVL
FT                   GPIVIQPSEVAKIAFIIYLSGALEYYKDKKYKSLEILIAAVVPLFIFIVLIFMEKSFSS
FT                   AVILFVIGFSMIFVSKVKIEQLIVFFFGFMALGAFGIMHSEYRRRRIFNYLTGFNKDGN
FT                   DVGYQARQSLIAIGSGRVIGRHYGNGLQKYFYLPERHTDYIFSTYAEEFGFIGCFVLIG
FT                   IYFFILLIMIMTINKTKDYFGKYLVFGIMVLFITQALANMFVVTGVIPSTGITLPLISY
FT                   GGSSTIVIMAALGIVINVINNIDEVNEDE"
FT   sig_peptide     173679..173777
FT                   /locus_tag="Sterm_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.653 at
FT                   residue 33"
FT   gene            174781..175848
FT                   /locus_tag="Sterm_0160"
FT   CDS_pept        174781..175848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0160"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: hypothetical protein ; K02563 UDP-N-
FT                   acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide)
FT                   pyrophosphoryl-undecaprenol N- acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07045"
FT                   /db_xref="GOA:D1AJY8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY8"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACZ07045.1"
FT                   /translation="MNKKEKVVLTTGGTGGHIYPALAIAKKLKDKNIDVLFIGTSHRME
FT                   KTIVPNEGYRFIGLDIVPLKSVSAVFKILKGTLRSIRILRREKATKVIGFGNYISIPVI
FT                   LAAKFLRIPYYLQEQNSIMGLANKKFYKGSKKVFLAFRNTLNSIPGKYREKFIVTGNPL
FT                   REEFYHKEKAKEREKLGITEEEKVLFIIGGSLGAKNINEAVLKKWDKIQEMKNLRLFWG
FT                   TGKDLFEEVISKITDYGSAVVLPYFDNAADIMSAADMVLCRAGASTVSELIQLEKPSIV
FT                   IPYDFVGQKENAEEIEFVNGTKIFENKNVSDAIDEALLEIKQPDILDFMSENLKTLKKG
FT                   NAVCSIVKHIDLEEK"
FT   gene            175845..177191
FT                   /locus_tag="Sterm_0161"
FT   CDS_pept        175845..177191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0161"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   Mur ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: pca:Pcar_2201
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07046"
FT                   /db_xref="GOA:D1AJY9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJY9"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACZ07046.1"
FT                   /translation="MSEGVKTIFFSGINGIGMSGLAKIMVTKGYNVYGSDIAEKPVSKQ
FT                   LRDMGVGMFIGQEAKNLEGKNIDLFIYSSAIKENNPEYKYAVNNNIKKIKRGELLALLM
FT                   NDSKGIAVAGTHGKTTTSSMLGITMLEKDPCIVVGGIIPEIGSNSKVGNSEYFIAEADE
FT                   SDNSFLYLTPSYSIVTNVEADHLENHGSYENIKKSFEEFIDKTSDIVVLNKDCHEIKKL
FT                   NLKNKNIIWYSINDESADIYAANIEYKNRESHYEVVKNGESLGKFRLSIPGEHNISNSL
FT                   GVIYLAHEFLCDMDKVKEYLYNFRGANRRYQILYDKSIKIIDDYAHHPTEITATINAAK
FT                   KIETGKITVVFQPHRYSRTNFFLNEFAESLKLADEVYLLPIYSAEEENIYNISSEKLAE
FT                   LIGGNTRVYSEEEISDRVLNDNSSENVYLFMGAGSISRIANTIKNKLPL"
FT   gene            177276..178127
FT                   /locus_tag="Sterm_0162"
FT   CDS_pept        177276..178127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0162"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: sat:SYN_01748 UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07047"
FT                   /db_xref="GOA:D1AJZ0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ0"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACZ07047.1"
FT                   /translation="MKILANVEMKNYSNMKIGGKAKELIFIEKEEELKEVLKTRDKVFL
FT                   IGNGTNTLISDKDLDISFISLKEFNYMKVIEKNENYDIVCIGSGANLDDLIDFMEANDY
FT                   AGLENITGIPGSVGGLVNMNGGAYGTEIFDCIDKIKICDLDGNIKVFEKSELNYNYRTT
FT                   DIKENKWIVVEVYFKFSKGFDKECSQDKKDKREERHPLELPNLGSTFKNPDQNFAAQLI
FT                   SDAGLKEYRVGNAMVSPKHPNFIVNLGEAGFEDVMGVIEHVKEIIKEKNNIDLQTEIII
FT                   VK"
FT   gene            178227..178952
FT                   /locus_tag="Sterm_0163"
FT   CDS_pept        178227..178952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0163"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein FtsQ-type; cell division protein FtsQ; KEGG:
FT                   fph:Fphi_0662 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07048"
FT                   /db_xref="GOA:D1AJZ1"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ1"
FT                   /inference="protein motif:PFAM:PF08478"
FT                   /protein_id="ACZ07048.1"
FT                   /translation="MLKFLKFLVFLLMLTILIKGLFIFASKDFFKVVNVKVEGDNELIK
FT                   FDITEKILQIKDNTNLVYINTKKMEKYLSEDVRVKSVKIKKVYPSELIVRIEGNKPYSY
FT                   LRQKNNFYVINSDGEIFANINEITDKNLPVINAENKEDLETILQVLSKIKNEGFFSNIS
FT                   EVRKVKSDYEILLNDGTLIKTTIVVDTAKYDNCFKLYKSLINENKKVEYIDLRFKDINL
FT                   KEKDLLQTNLEGKNGRDPK"
FT   gene            178933..180042
FT                   /locus_tag="Sterm_0164"
FT   CDS_pept        178933..180042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0164"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   sat:SYN_00437 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07049"
FT                   /db_xref="GOA:D1AJZ2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ2"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACZ07049.1"
FT                   /translation="MEEILNRATIKVIGVGGAGGNAINDMIETGIHGVEFIAANTDSQD
FT                   LEDSKAGMKIHLGDRATKGLGAGADPERGREAALESKEKIRQVLEETDMLFITAGMGGG
FT                   TGTGAAPIIAEVARELEILTVAIVTKPFAFEGPQRKKNADMGIENLRKYVDTMIAIPND
FT                   KLFELPNLNITLMNAFKEANNVLKAGVRGISELITKQGFVNLDFADIRATMKDSGVAML
FT                   GFGESEGEDRARAATEQALNSPLLEKSIEGARKILLNITGGYDLGLNEVQQISSLIRET
FT                   AGEANANLIFGTVLDDSVRGLKISIVATDFIDKNYDNLGEIFNNIKKEEEEEVKNTAAA
FT                   AAKKEEADGKLFNNDSGFILPQFLKKKED"
FT   gene            180284..180568
FT                   /locus_tag="Sterm_0165"
FT   CDS_pept        180284..180568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0165"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: sun:SUN_0428 30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07050"
FT                   /db_xref="GOA:D1AJZ3"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ3"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACZ07050.1"
FT                   /translation="MRNYEIMFIVSTQLTEEEKQTGIKFVEDTLKASGADSVKTEIWGD
FT                   RKLAYPINKKDNGYYVLTTFQMDGTRLTEVEGKLNINESLMKYMIVKND"
FT   gene            180720..181130
FT                   /locus_tag="Sterm_0166"
FT   CDS_pept        180720..181130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0166"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: gsu:GSU3117 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07051"
FT                   /db_xref="GOA:D1AJZ4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ4"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACZ07051.1"
FT                   /translation="MNLVTLIGRLTRDPELKYSQSGKAFCKFSIAVTREFNRDEADFIN
FT                   CVAWDKRAETIAEYLRKGRRIALQGRLSVRSYEQNGETKWMTEVIVDKFDFIDTAAASG
FT                   GSSYEDKKSSNEPGFSNEVVSEDTIDDDDFPF"
FT   gene            181149..181373
FT                   /locus_tag="Sterm_0167"
FT   CDS_pept        181149..181373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0167"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: ngk:NGK_1338 30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07052"
FT                   /db_xref="GOA:D1AJZ5"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ5"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACZ07052.1"
FT                   /translation="MAEFKRRKRRPKVKFKVEDINYKNVELLKNFMNDKGKISPARVTG
FT                   LDAKIQRKIAAAIKRSRQIALLPYTKIER"
FT   gene            181417..181950
FT                   /locus_tag="Sterm_0168"
FT   CDS_pept        181417..181950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07053"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07053.1"
FT                   /translation="MKKFFIMLLMLLFVFSCGKEKQPEKVEAKETVQENLFKNIDVDKL
FT                   SRRLEKKIEVNGMKVDSFEDLNSDGKVFYYSTINGNKNEIITINYENLTPTAIVGKVTG
FT                   KDESNMETFRKLSLSVIMASDTKLTDEDAQIIYEELLNKLENATSSTVVTKNNLTYGIE
FT                   VIFGTEDELIIYAK"
FT   sig_peptide     181417..181473
FT                   /locus_tag="Sterm_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.640 at
FT                   residue 19"
FT   gene            complement(182048..182575)
FT                   /locus_tag="Sterm_0169"
FT   CDS_pept        complement(182048..182575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0169"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; KEGG:
FT                   hac:Hac_0304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07054"
FT                   /db_xref="GOA:D1AJZ7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ7"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACZ07054.1"
FT                   /translation="MFKWLNGELQNILDKDPAANNKLQVFLLYPSIHAVIHHKISHFLY
FT                   KKKIIFLARLISQISRFFTGIEIHPGAQIEKHLFMDHGMGIVIGETSIIGENVTIYHGV
FT                   TLGGVSLDKGKRHPTIGNNVIIGAGAKVLGNITIGDNSKIGANSVILKDIPKDSVAVGV
FT                   PGKIITKSSSDS"
FT   gene            complement(182589..183503)
FT                   /locus_tag="Sterm_0170"
FT   CDS_pept        complement(182589..183503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0170"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase A; cysteine synthase;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gme:Gmet_2988 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07055"
FT                   /db_xref="GOA:D1AJZ8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ8"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ACZ07055.1"
FT                   /translation="MLYENLLDIIGNTPIVKINNIFDTDSHADVYLKLENFNPGGSVKD
FT                   RAALGIIEKAEKEGKLKPGSTIIEPTSGNMGISLAFIGSLKGYKTIIVMPDTMSIERRN
FT                   ILKALNAELILTDGARGMKGAIEKAESLASKNKNYFMPEQFSNPANVEAHYETTGEEIL
FT                   RDLPDVDVFIAGVGSGGTLSGVGRRLKEHSLDIQVVAVEPLTSAVISGEKPGKHQIQGL
FT                   GAGFIPDTLDMKVIDRIIPVSDNKAFEFVKLIARKCGLFLGVSTGANVAAAYEIAKNME
FT                   KGKKVLTIASDTGEKYLSLNIYK"
FT   gene            183739..184353
FT                   /locus_tag="Sterm_0171"
FT   CDS_pept        183739..184353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nam:NAMH_1592 YheB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07056"
FT                   /db_xref="GOA:D1AJZ9"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D1AJZ9"
FT                   /inference="protein motif:COG:COG4399"
FT                   /protein_id="ACZ07056.1"
FT                   /translation="MDRIAEFLLMVGVGALIGWFTNYLAIRLLFRPYNEINLVIFKLQG
FT                   LIPKRRHEIAVNIAEVIETELISIREIGDKLDTSSFEYDDLDDFLDRLVKEKIKAELLE
FT                   KNPFLKMFMNDGILNKMRDYIKKLILDNKEELFQLLLKSIEKNVDLKGHIIEKMDNFSL
FT                   REIEDIIIKISKKELKHIEILGGILGGIIAVFQYLIITIIR"
FT   gene            184364..185383
FT                   /locus_tag="Sterm_0172"
FT   CDS_pept        184364..185383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0172"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: sat:SYN_02971 Holliday junction DNA helicase
FT                   B; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA
FT                   ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07057"
FT                   /db_xref="GOA:D1AKP1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP1"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ACZ07057.1"
FT                   /translation="MEDIDRILTDKELSEDNVQKSLRPRTFNEYIGQKLLKEKMSIFIR
FT                   AAQSRNEAMDHILLYGPPGLGKTTLAGVIANEMGVNLKITTGPVLEKAGDLAAILTSLE
FT                   ENDILFIDEIHRLNTSVEEILYPAMEDGELDILIGKGPSARSIRIELPKFTLIGATTKA
FT                   GQLSTPLRDRFGVTHKMEYYNIEELKEILVRGIAILGIKAEENGIEEIAMRSRGTPRIA
FT                   NRLLKRARDYAEIKGTGVLNQKSVKGVLDLLGIDEKGLDELDRSILKSIIVNYDGGPVG
FT                   IETLSLLLGEDKRTIEEVYEPYLVKIGFIKRTQRGRVVTNRGYVHLGLEERTDQTKLF"
FT   gene            185836..186546
FT                   /locus_tag="Sterm_0173"
FT   CDS_pept        185836..186546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0173"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   dol:Dole_1732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07058"
FT                   /db_xref="GOA:D1AKP2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP2"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACZ07058.1"
FT                   /translation="MLTIIIRNEDFISESNVEITEKNDINHVKNVYRYKTGDTIRLIDG
FT                   KFEYKAVIAEIGNKRILLRVTEKHEDSYSLRVELDIALGILKNDKMNMALQKLTEIGIN
FT                   KIIPLKTDRVVVKLSDSKEKWNTVTEEALKQCRGVKIPEIERILTLKDIEFSAYDKVLF
FT                   AYENSSENKPVFTILSGEEKRILYLIGPEGGFTEEETKYIREQGALEISLGKRIYRAET
FT                   AAIVMGGILADVYK"
FT   gene            186533..187825
FT                   /locus_tag="Sterm_0174"
FT   CDS_pept        186533..187825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0174"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: sat:SYN_00797 tRNA 2-methylthioadenosine
FT                   synthase -like protein; TIGRFAM: MiaB-like tRNA modifying
FT                   enzyme; RNA modification enzyme, MiaB family; PFAM: Protein
FT                   of unknown function UPF0004 ; Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07059"
FT                   /db_xref="GOA:D1AKP3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP3"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ACZ07059.1"
FT                   /translation="MSISKKVAFYTLGCKVNQYETEIIKKDFLENGYNEVEFEDRADVY
FT                   VINTCTVTSIADKKNKKMLRRAKKINPDSVVIATGCYAQTNVEDLKEIKEVDYIIGNVK
FT                   KEEVYKIFSKKLSNYQVDNIFDQKEYSSQKYAVSRDKARAFVKIQDGCTKFCSYCKIPY
FT                   ARGMSRSRQPESVLEEIKFLGEAGYKEIVVTGINLSEYGSDFGENINFDYILEKILKIE
FT                   EIDRVRVSSVYPDTLSEKFISLLKENKKLMPHLHVSIQSLDDKILKLMKRNYRAEFVVE
FT                   LLKKVQEEVPDSAITADIITGFPQEEEENFWNTFENMKKINFSDFHIFPYSDREKTAAA
FT                   AFTGKIEPEVKKERVKILEKLKKSKIKEFREKFLDTVQKVYIEEIKAGKAYGYTENYLR
FT                   VEVNSVSHKVADIVEVKIMSSAGDLLKGEVI"
FT   gene            187822..188787
FT                   /locus_tag="Sterm_0175"
FT   CDS_pept        187822..188787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07060"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07060.1"
FT                   /translation="MKKIILILVSLFMIFGCIEYESKDVADKNRIFKSDNNFYVYYNGK
FT                   FIEIPKGTYIANDKKIENYYIKKIVNKSELLNDLNKYFPDKIEYVTKGEKPKESIKLPV
FT                   ITSDGKTYIDSVKLEKLLVELPTRVAQNDKENIVAEEKPVSLEGKKIEILNANGIDGFA
FT                   SSLGDALMAKFKIVYNAENYTQEENYSYIINNKLDDNAANELLSSLSIKYIKKMKPGQI
FT                   KPDADLVIITGKDTETGFKTEIMSAAENSAITEKLKAYTPVFTKADKYKDIDLKKLTGI
FT                   QINYNPEDYYTAYKLGKLLNTTNLVEDASLKDSIIILTKD"
FT   gene            188797..189102
FT                   /locus_tag="Sterm_0176"
FT   CDS_pept        188797..189102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0176"
FT                   /product="Iojap-related protein"
FT                   /note="PFAM: Iojap-related protein; KEGG: rcm:A1E_05185
FT                   iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07061"
FT                   /db_xref="GOA:D1AKP5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP5"
FT                   /inference="protein motif:PFAM:PF02410"
FT                   /protein_id="ACZ07061.1"
FT                   /translation="MENSVKKAIEIIESKKGDNIKVYDVQGKSPFMDYVVVCDGSSSVK
FT                   MEAIATELKKEISTYKSMEGAGESQWILIDFGDFIVNIFNGEKREYYNIDELYQSS"
FT   gene            189112..189594
FT                   /locus_tag="Sterm_0177"
FT   CDS_pept        189112..189594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07062"
FT                   /db_xref="GOA:D1AKP6"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07062.1"
FT                   /translation="MRKIFYAIVYFLIFIEPLTGGHIKTFISLPFAMAFLVFLEQTKKE
FT                   EQGIHYVLIVLILTLGGGMFFWKSAIFLILYYLIDILGRKLPLEYLLKDFVMVFIVNLV
FT                   FLILINLKNVAFMDFISLSCIAVIGIQTVYSLIYLLILKKSEGLMIDKYEKTNGYR"
FT   gene            189581..191347
FT                   /locus_tag="Sterm_0178"
FT   CDS_pept        189581..191347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0178"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: gsu:GSU2079 penicillin-binding protein 2;
FT                   TIGRFAM: penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07063"
FT                   /db_xref="GOA:D1AKP7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP7"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACZ07063.1"
FT                   /translation="MDIDDEGRSIAFLVIVGFISMVLIGRLVYLQIIQNDLFKQKAQRN
FT                   SLKSKVMKASRGLILDRDGKVLTRNNVGYQVVYILGKKREANPDDVLLISELTGMSVTD
FT                   LKKRIKNQPRAGYENEVIAVEDLDKDIALRMAEKITDSERIEVREYNKRFYPEDMLASH
FT                   IIGYMKPIDDKEWEVLKSDESYNRNDYIGKRGVEKQYDKVLKGIDGEEIVEVDAHRNVK
FT                   SIRDRNDSVAGKNIYLSIDLDLQRYMTEQFKNDKGAFIAMEAKTGKIIVAVSNPEYSLN
FT                   FMSSRFSSEEWDKLINDPNKPLNNKFSGSAYPPGSTFKVVTGMAILEAGISPQQTMYST
FT                   GSFQIGRTIFRDSHRGGHGTTNFYKAIRESVNTYFYTFSREVGIEKVAKTATDFGLGER
FT                   AGIDIPGEEKGVVPTPEWKMKRFNQKWLPGDLVNMSIGQGYVLTTPLQVLMVYQGIANK
FT                   GVMYKPTVVDKFVSFDGKVENKEPEVLRKLPFKPENIEIMREALKEPVNKPGGTARILY
FT                   FPNIPVSAKTGTAQNTGFKDHHSWLAGYFPSDNPEIVFISLVEGGGYGGVASGDLVRKF
FT                   IIKYNEKYNIAQ"
FT   gene            191369..193144
FT                   /locus_tag="Sterm_0179"
FT   CDS_pept        191369..193144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0179"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; RNA-
FT                   metabolising metallo-beta-lactamase; KEGG: gme:Gmet_0366
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07064"
FT                   /db_xref="GOA:D1AKP8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ07064.1"
FT                   /translation="MKFNYVEGKKGDKAEKEEKTEKIEKNTKKGAASEKQAKEEKVYII
FT                   PLGGMEEVGKNMTAFQYKDEIVIVDAGLTFPEDEHLGIDVIIPDFTYLENNKDKIKSLL
FT                   LTHGHEDHIGAIPYLFQKLGSTDITIYGGKLTLELAKAKFEKKDAVIPKMKVVKGRTKL
FT                   KLSKYFSVEFISVTHSIADCYAICIKTPAGIIVHSGDFKVDLTPVDGEGFDFARLAQLG
FT                   EEGVDLLLSDSTNAAIPGFTPSEKSVGESLREEFGKAKGRIIIAAFASHIHRLQQIVDI
FT                   AQIYNRKIAIDGRSMVKVFDIASRLGYLKFPKNMIVDLHKSDKLPPEKAIILCTGTQGE
FT                   PLAALSRIANGTHKYISLREGDTVIISATPIPGNEKAVYKNINHLLKKNANVVFEKVVG
FT                   IHVSGHGCQEEQKIMLSLVKPKFFMPVHGEYMMLKKHKELAVATGVESDNVILAENGNK
FT                   IELTKSHCRVAGKVQSGMTLIDGFGIGDVGNIVLKDRQNLADDGIVIITVSQYKNGKFN
FT                   KQIELVTRGFIYNRESENLILETKELIKLELESIETKEIKEISKVKQLLKSKVGEFLYK
FT                   KTNREPIILPIIMEV"
FT   gene            193145..193465
FT                   /locus_tag="Sterm_0180"
FT   CDS_pept        193145..193465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0180"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   pin:Ping_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07065"
FT                   /db_xref="GOA:D1AKP9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKP9"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ACZ07065.1"
FT                   /translation="MKLSSKQRALLKKMAHDLEPVVRIGKGEVDGDLLESISNVINKRE
FT                   LIKVKVLQNSELDNMKDLGFELAEKTSSVFVDKIGKVIILFKPKKENGVITQEILKKRK
FT                   GK"
FT   gene            193466..193927
FT                   /locus_tag="Sterm_0181"
FT   CDS_pept        193466..193927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0181"
FT                   /product="acid phosphatase/vanadium-dependent
FT                   haloperoxidase related protein"
FT                   /note="PFAM: acid phosphatase/vanadium-dependent
FT                   haloperoxidase related; KEGG: CGL83; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07066"
FT                   /db_xref="GOA:D1AKQ0"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ0"
FT                   /inference="protein motif:PFAM:PF02681"
FT                   /protein_id="ACZ07066.1"
FT                   /translation="MSTGIIFGNRILDVAVIACFAAQFYKVFSPLFKGRGASWVRLFQT
FT                   GGMPSSHASTVVALATSLALLKGMRSVEFAISMVFSSIVLYDATGIRRAAGEHAKALNR
FT                   LVKSIEHKDDFEKIEANFKEFLGHTPLEVFWGCVLGLIIGIAFRGYLLG"
FT   gene            193942..195747
FT                   /locus_tag="Sterm_0182"
FT   CDS_pept        193942..195747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0182"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: pca:Pcar_1667 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07067"
FT                   /db_xref="GOA:D1AKQ1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ1"
FT                   /inference="protein motif:TFAM:TIGR00204"
FT                   /protein_id="ACZ07067.1"
FT                   /translation="MEDLKKMSLKELEDLCGDIRSEIIEVVCKNGGHLGPNLGVVELST
FT                   ALHYVYNSPVDKIVWDVGHQSYVHKMLTGRRDRFHTIRKRGGLGPFTDPNESIHDQFIS
FT                   GHAGSALSVSAGLAAANPDKNVAVVIGDASFANGTTLEALNDINGKLKNLTIIINDNEM
FT                   SIGENVGAISGILNKVINSSFYLKLRKDLRYVLSRYNLTKPIVKPTERVEQSLRSIVTP
FT                   GGFFNILGYDYIGPIDGHNLEKLIKILEENSKERTRVIHIKTKKGMGYDPAEADPESFH
FT                   GIGPFDKNTGETIGKSQIYSDVFGAKMEEIFAADEKTVALSSGMIKGTGLKNVWKKYPE
FT                   RVHDTGMTEGHTVTFAAALAKEGLKPYVAIYSTFLQRAYSHLIHDVAILKLPVRFILDR
FT                   AGVVADDGKTHQGIFDIAYLLTIPDIDIAAPTSKEEFSKILDMSLDIKKPLAVRIPKDT
FT                   PLDYEFPAYEYGKWNKVSDGSRYMIIACGAMFAEIMKIKDKLDEKIDAAIVSAAWIRPF
FT                   DKEFINREFPKYEKVLILEDGIEKSGFGTEILEYVNDSDIDTKIIRKGIRQMFLPHGKR
FT                   SELLNDENLTGESLLEDILTKVLGK"
FT   gene            195744..196490
FT                   /locus_tag="Sterm_0183"
FT   CDS_pept        195744..196490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0183"
FT                   /product="hemolysin A"
FT                   /note="KEGG: gur:Gura_2037 hemolysin A; TIGRFAM: hemolysin
FT                   A; PFAM: RNA-binding S4 domain protein; ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07068"
FT                   /db_xref="GOA:D1AKQ2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ2"
FT                   /inference="protein motif:TFAM:TIGR00478"
FT                   /protein_id="ACZ07068.1"
FT                   /translation="MKRRLDVFLVEEGYFDSREKAKREIMLGNVIINEQAVTKAGTMIK
FT                   DNQELNIRIKEKLKYVSRGGLKLERALEYWNLDFNNKKILDIGASTGGFTDCALQNGAD
FT                   FVFGVDVGKNQLDWKLRNDKRVKSLEEMHIKNLSPDDINNEKTDYIVIDVSFISLTSVF
FT                   RYFKQFLKEDGKVIALIKPQFEVGKDKIGKNGIVKEEEYRSEAIKSVVKEASECGFKII
FT                   EVIESPITGTKGNIEYLSLFEMIASS"
FT   gene            196921..198249
FT                   /locus_tag="Sterm_0184"
FT   CDS_pept        196921..198249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0184"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: tdn:Suden_0492 peptidase S41A, C-terminal
FT                   protease; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   peptidase S41; PDZ/DHR/GLGF domain protein; SMART:
FT                   peptidase S41; PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07069"
FT                   /db_xref="GOA:D1AKQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ3"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACZ07069.1"
FT                   /translation="MKNKKYVLLTAIMAILLSLPILCSTTAAKKTDTKTDNTTQQQTAV
FT                   SEPAGYFKDSGNLNKLTNMINIIQQKFVGKKNPTKQELYEYAMTGLVNGLDDPYSEYLT
FT                   KKDLESFTEDLDGEYVGVGMSIDKKKDAPLVVVSPFVGSPAAKAGMKIGDKVTKVDKTD
FT                   IIPLNATETVNLLKGKQGTKVDVEVVREGVKNPFTVTIIRDTIKLEMVESKMLPDQIGY
FT                   VSLLKFGNHTGAELKKHIEQLQAQGMKGLILDLRSNPGGSLKEAQDISSLFLTQDLVVY
FT                   LKYKNGQETRYNRTMPSLGNFPLIILVNGGSASASEIVTGAIKDYKRGTIIGQKTFGKG
FT                   IVQEVIPLEGGDAIKLTVAQYFTPNGNYIHEKGIEPDIKVDMEEVLSIKGYANDSEEAR
FT                   ENRMKEIRTYLEKEKGKEETDKIISAGDVQLKRATEEMEKKIK"
FT   sig_peptide     196921..197007
FT                   /locus_tag="Sterm_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.515 at
FT                   residue 29"
FT   gene            198258..198932
FT                   /locus_tag="Sterm_0185"
FT   CDS_pept        198258..198932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0185"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: geo:Geob_1497
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07070"
FT                   /db_xref="GOA:D1AKQ4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ4"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACZ07070.1"
FT                   /translation="MLYIVGTPIGNMEDITYRAVKTLKSADYIFSEDTRVSRKLLAHYE
FT                   IENTLYQYHEHNKSHQIENIINLLKDGKNIALITDAGTPCISDPGYELVDIAHQNDIKV
FT                   VTIPGASSVIAGASISGLNLRRMAYEGFLPKKKGRQTLFNKLKEEERTIIILESPNRIL
FT                   RTLKDINEYLGNRYVVITRELTKIYEEVIRGNVTDLIEKIEKKPLKGEIVLLIKSKKEE
FT                   EE"
FT   gene            198929..199786
FT                   /locus_tag="Sterm_0186"
FT   CDS_pept        198929..199786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0186"
FT                   /product="GTP-binding protein HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   sfr:Sfri_1486 ribosomal biogenesis GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07071"
FT                   /db_xref="GOA:D1AKQ5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ5"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACZ07071.1"
FT                   /translation="MSINWYPGHMKKTKETIAENLKIVDLVIEVLDARIPLSSKNPDIS
FT                   KLAKNKKRLTVLNKVDLADEREVENWKEYFIRNDISDYVLAISAEKGTNLNELKRIVDE
FT                   IYIEKLEKAKKKGLRKTEVRALIAGIPNVGKSKLINKFAGKTKARVGDKPGFTRGKQWV
FT                   KASEKLELLDTPGVLWPKFDDPEVGYSLAITGSIKDDILPIEEVVSVFIDRMRKTGKLD
FT                   QLVKAYNLETDIENKENHEILDILEERLGIIKKEETNYNKVSRFLLRDYRSGKLGKFSL
FT                   ETTQ"
FT   gene            complement(199995..200864)
FT                   /locus_tag="Sterm_0187"
FT   CDS_pept        complement(199995..200864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0187"
FT                   /product="protein of unknown function DUF368"
FT                   /note="PFAM: protein of unknown function DUF368; KEGG:
FT                   pcr:Pcryo_2147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07072"
FT                   /db_xref="GOA:D1AKQ6"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ6"
FT                   /inference="protein motif:PFAM:PF04018"
FT                   /protein_id="ACZ07072.1"
FT                   /translation="MFSNFAKGIIIGIGAILPGISGGSLAVIFGVYEKLIHSVSSFFKD
FT                   PKKNLVFLAVIGFGACIGIVLFSNIQKFLFTYYEIPTMLSLCGLFLGTIPGLFRHANKN
FT                   GFSALCLVPFLIAFMISVFFSLSGSSSIEIESVNFYLNFKSFMYIFIIGFIMAGSLVIP
FT                   GISGTVLLMLIGAYGFFLNIVADIKYIFLFPFVSKSMHSEIVNNILILIPLCAGLGAGV
FT                   FFFSKLMDFLFKKSYSLTYYAVLGFMLGSVPELIPGYSGSLSVYITGIILFLAGLAVSL
FT                   KFNAKYAG"
FT   sig_peptide     complement(200784..200864)
FT                   /locus_tag="Sterm_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.957 at
FT                   residue 27"
FT   gene            complement(200939..203635)
FT                   /locus_tag="Sterm_0188"
FT   CDS_pept        complement(200939..203635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0188"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="TIGRFAM: calcium-translocating P-type ATPase, PMCA-
FT                   type; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase-associated domain protein;
FT                   cation transporting ATPase domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: sat:SYN_01009
FT                   calcium-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07073"
FT                   /db_xref="GOA:D1AKQ7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005782"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ7"
FT                   /inference="protein motif:TFAM:TIGR01517"
FT                   /protein_id="ACZ07073.1"
FT                   /translation="MEKKNWYNLSVEDTVNLLDTNLTDGLTEAQAAERVETYGYNELKQ
FT                   GKKKTFLQKFLAQFKDTMIIILILAAVISGVVGILESKEPVISVLDFLEKISDSFIILL
FT                   IVIVNAVIGVLQENKAEKSLEALKKLSSPVSKVLRDGQILMLPGKELVPGDIVILDTGD
FT                   YIPADLRLFEAANLKIEEASLTGESVPVEKITSVIEETDIPLGDRDNLAFSASLVSYGR
FT                   GKGIVAETGMNTEVGKIAAILDSTEVTQTPLQKRLDKLGKMLGIAAIVICVLMFIIGSS
FT                   YGKEPMHLFLSAVSLAVAAIPEGLPAIATIVLAIGVQRMVTKHAIVKRLPCVETLGSTT
FT                   VVCSDKTGTLTQNKMTVEKIYFNNNTVDVENISSLTNELKLLITSIVLCNDSKIIIEEE
FT                   KTKITGDPTETALVDLGLKFELDKDELESTEIRVDEIPFDSERKLMSTVNKDSKTNTIK
FT                   VYTKGAVDELLKRCNRILINNEVRELTEKDTAEILKANTSMAENALRVLGTAYKDTNSE
FT                   SADNAETELIYVGMVGMIDPPRPEVKSAIEKCKTAGIKTVMITGDHKITASAIATALGI
FT                   LENDDEAITGADVEKMTDQELENRVKHISVYARVSPEHKVRIVKAWQKHGDIVAMTGDG
FT                   VNDAPALKTADIGAAMGIVGTDVSKEAADIILTDDNFATIISAVEEGRRIYDNILKAIQ
FT                   FLISSNIGEIIVLFFATLVNWVEPLIPIHILWVNLITDSLPALALSFDPAEENIMKRSP
FT                   VPANTGIFTKGMIYRIGYQGAMIGILTLIAYRIGIHEDPSNTILGQTMAFAVLSLSQLV
FT                   HVFNIRSKTNSIFKSGIFNNMYLVYAVLCSFILMIAVLFIPFLQDIFNVVTLSGRDIMI
FT                   VVVLSIMPVLIVEILKLFKINSFKDEN"
FT   gene            complement(203656..204807)
FT                   /locus_tag="Sterm_0189"
FT   CDS_pept        complement(203656..204807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0189"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="TIGRFAM: sporulation integral membrane protein YtvI;
FT                   PFAM: protein of unknown function UPF0118; KEGG:
FT                   btr:Btr_1340 permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07074"
FT                   /db_xref="GOA:D1AKQ8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ8"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ACZ07074.1"
FT                   /translation="MYNYYKSALFKKALFFGRILLVFLLIFIAFKIAVFLSPFVLAVLF
FT                   SMIVTKIAKFLNSKVKLPKKISTAIALMIVFATVVGLISLIVTKLILEIYSLSFNISTY
FT                   AQEIRLWIDNFMNFMNRGTIILDRIPEQILNQLKGSVSDIISMATSKISVILNNILSFI
FT                   TSLPNVVIYFFVTVIATVFMSLDKQNIILFVEKQLPASWLNKIYTLKNDLLSVVGGYLK
FT                   AQAMLITICFFELLIGLNLFHFMGLNVQYPLTFAIIICAIDALPILGAGAFMIPWIVVS
FT                   LIVKDFKMAVALLILYVIVTAVRQLLEPKLYSQNIGVHPLITLLSMYTGLKLAGFIGII
FT                   MGPAVVIILKNVFHEELERGFFKGMFGKKEKIDTETENNNTNT"
FT   sig_peptide     complement(204679..204807)
FT                   /locus_tag="Sterm_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.668 at
FT                   residue 43"
FT   gene            205182..205622
FT                   /locus_tag="Sterm_0190"
FT   CDS_pept        205182..205622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07075"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKQ9"
FT                   /inference="similar to AA sequence:KEGG:GSU2727"
FT                   /protein_id="ACZ07075.1"
FT                   /translation="MDYKKLSREERDRLLKSELTSEKIKFMEKYKLFSTGDLRWYTDKN
FT                   NTPERIYFSHKFLKNNGIMEILFRKYQFCFAKLKYFRENIEKYEAFKYDPKEGFVKTEM
FT                   WDAEFFKHKKSGRFIDLRYLQQITELNIFLSFVSWLEDESNG"
FT   gene            205777..207138
FT                   /locus_tag="Sterm_0191"
FT   CDS_pept        205777..207138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0191"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: sat:SYN_02959 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07076"
FT                   /db_xref="GOA:D1AKR0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR0"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ACZ07076.1"
FT                   /translation="MARKYFGTDGMRGEANKDLTIDLVTNLGLALGYYLKKNNNKTTKP
FT                   KIILGTDTRISGYMIRSALASGLTSMGIHIDFVGVLPTPGVSYLTRHLGADAGIMISAS
FT                   HNPVKDNGIKIFSKNGYKLPDEVEEEIEGYMENREEMLKHQVSGDDLGRFKYVEDDMRE
FT                   YLNFLTSTLKTDFRGMKIVVDTANGAAYRVAPKIFHRLKADVTVINNIPNGKNINVNCG
FT                   STHPELLQEVVKVYNADLGLAYDGDADRLIAVDDKGNIVDGDLIISVIAKNFQNKGILN
FT                   SNKIVTTVQSNMGFEKNLDKNGIGLIRANVGDRYVLEKMKEHGLNLGGEQSGHIIMLDY
FT                   NTTGDGVLSSIQLVAAIKESGKKLSELVEDIKLWPQKLVNTVVSKEKKQTWTENKELID
FT                   FIKQKEKEIEGKGRILVRASGTEPLIRVMVEGETQETVDTYIEALVGKVKELLL"
FT   gene            207172..208029
FT                   /locus_tag="Sterm_0192"
FT   CDS_pept        207172..208029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07077"
FT                   /db_xref="GOA:D1AKR1"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07077.1"
FT                   /translation="MSSRLRGLQSGVLRIILLFLWLAVVLFIIGLLGNVFNLTVMNNEL
FT                   WTIFGIILGILVVLGFLHVVISLNIISNAIAAYSGYGEPEYRRVDYKKIFMASGILIVL
FT                   VLGVQSIVKIQVEKKNLEVLKQQATDIGSSAITAKIVTQIDEDAQMRDLYFSRDLLLLT
FT                   MKENSLTLLIPKIRDGNKVFYQVTPWDYDSRDERKISEALERPYIPDKSVKEKFDKMLK
FT                   DRKSFEVKSGGNMTIFYPVEKNGELKSILIINSKSDINYEFLKERSASASEPAVNTPEK
FT                   KTEK"
FT   gene            208279..208464
FT                   /locus_tag="Sterm_0193"
FT   CDS_pept        208279..208464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07078"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07078.1"
FT                   /translation="METGNKVRYTGEDNEVTMLKKNDTGTILLSHGDGYFEVEFLDEEG
FT                   IVKVLETLSEEVLEKI"
FT   gene            208497..209198
FT                   /locus_tag="Sterm_0194"
FT   CDS_pept        208497..209198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0194"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: ara:Arad_15034
FT                   S-adenosylmethionine-dependent methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07079"
FT                   /db_xref="GOA:D1AKR3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR3"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACZ07079.1"
FT                   /translation="MHREFANIYDVFMESVDYENWYMYLRKYIKNPGTVLDLGCGTGEF
FT                   LVKFLKDGFTCIGVDISEVMLEIARDKTKESSDIELYQGDIRKFRTEKPAEYIVCNFDT
FT                   VNYFDKFSDLEDFLDCSYENLTEDGILIFDVVTEEIFDEMFENGVFLDEKENYLTIWRY
FT                   DKEGENYIINIKLFIREKENLFRNYEEVHVKTIFDLEEIANKALETGFDIVDIRNDEEF
FT                   GENRFFFILKK"
FT   gene            209220..209462
FT                   /locus_tag="Sterm_0195"
FT   CDS_pept        209220..209462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07080"
FT                   /db_xref="GOA:D1AKR4"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07080.1"
FT                   /translation="MKDNEKAKKHKERQRTLKYMSVGMNMIYTLCTPMVLMGCLYYFVI
FT                   EKKFGRQPVVFIIMIGLGLISGYYSFYKLVKEIGK"
FT   gene            209628..210035
FT                   /locus_tag="Sterm_0196"
FT   CDS_pept        209628..210035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0196"
FT                   /product="ATP synthase I"
FT                   /note="PFAM: ATP synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07081"
FT                   /db_xref="GOA:D1AKR5"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR5"
FT                   /inference="protein motif:PFAM:PF05468"
FT                   /protein_id="ACZ07081.1"
FT                   /translation="MLEYFSKDIIKMLKIAIVITVIVLLAGVILQIKALYFACFLGCLV
FT                   SVFNIISLYRDCQRIMYFPDKIKTKVYSQFFRRFVIYGIVLFIVGYITQKYKFGKLELN
FT                   MLFCGLGLLNFKISLYLSVMFKSKKIGDDTV"
FT   gene            210032..210937
FT                   /locus_tag="Sterm_0197"
FT   CDS_pept        210032..210937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0197"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   dol:Dole_0801 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07082"
FT                   /db_xref="GOA:D1AKR6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR6"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACZ07082.1"
FT                   /translation="MKKMMRVVGILLAAMLVINLILWGLQYILPIRYVTPPLIEGPKVF
FT                   WSLTIGGLVFNINQTIVTTWIVMAILITVLAIGTRNLSVENPGRFQVVLEMLYSFIENM
FT                   FLANFGKYKKTFVSFITALFSFIFLCNLISFFLPFIPLVEKLPGGGYSISPFLRSPTAD
FT                   MNTTVGLALLVVVIFLSCAIKTEGVTGYLKGLASPTPVLLVINIIGEIAKPINTSMRLF
FT                   GNMFAGIIIMGLLYGLTINVAGHLFAFAPGWVAFLHLYFDLFTGTIQSFVFVVLSSVYI
FT                   SETLSDKDDEEEVPLVAAAH"
FT   sig_peptide     210032..210106
FT                   /locus_tag="Sterm_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.901 at
FT                   residue 25"
FT   gene            211092..211328
FT                   /locus_tag="Sterm_0198"
FT   CDS_pept        211092..211328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0198"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   dal:Dalk_4311 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07083"
FT                   /db_xref="GOA:D1AKR7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR7"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACZ07083.1"
FT                   /translation="MADLMQAAALLGAGVAMIGGIGAGVGQGFATGKAVEAVSRQPEAK
FT                   QDILQVLFIGCAIAESTGIYSLVIAFLLIFMKG"
FT   sig_peptide     211092..211184
FT                   /locus_tag="Sterm_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.276 at
FT                   residue 31"
FT   gene            211359..211853
FT                   /locus_tag="Sterm_0199"
FT   CDS_pept        211359..211853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0199"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   vsp:VS_3156 ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07084"
FT                   /db_xref="GOA:D1AKR8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR8"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACZ07084.1"
FT                   /translation="MENGSNLITLDLSMLLQIINFLILVYVFWRLFGKKIGPILDERKK
FT                   IVTSKLLEAEEERTNARKATAEASELKREAKKRANEILIRAEISADERKERIIKEANQS
FT                   REKMLTTAEIDIEKMKQNASKELQKEVSSLAVTLAEKILKENIDKDGDKIINNFIEEVG
FT                   E"
FT   gene            211859..212386
FT                   /locus_tag="Sterm_0200"
FT   CDS_pept        211859..212386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0200"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: dps:DP0831 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07085"
FT                   /db_xref="GOA:D1AKR9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKR9"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACZ07085.1"
FT                   /translation="MYEADIAKRYAEAVYGVAKEKDKVKEIYDMLNSLMELYINDSEFR
FT                   NFMLHPLIENSEKKDFLGKIFTDADDITMNIIDYLVDKDRIEIIRYIVSEYLKLYYLEN
FT                   NEVEVTGIFSKELSEEQFDLLKSKLEKKVGKKIILKIEVNKDIIGGGIVKMGDQIIDGS
FT                   IKRQIENIKNTF"
FT   gene            212403..213908
FT                   /locus_tag="Sterm_0201"
FT   CDS_pept        212403..213908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0201"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: gur:Gura_4261 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07086"
FT                   /db_xref="GOA:D1AKS0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS0"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACZ07086.1"
FT                   /translation="MKIRPEEVSKIIKTEIENYKTSLDIASVGTVVEVGDGIARVYGLQ
FT                   NAMQGELLEFPNNVMGMVLNLEENNVGAVLLGDFSLIKEGDTVRSTGKITQVPAGEAML
FT                   GRVVDPLGNPIDGKGPIEASRFMELERKAYGIIDRQPVTEPLQTGIKAIDGMIPIGKGQ
FT                   RELIIGDRQTGKTAVAVDAIVNQKGNDVYCIYVAIGQKRSTVAGLHQKLIDSGAMEYTT
FT                   IVAATASESASLQYLAPYAGVSMAEYFMEQGKHVLIVYDDLSKHAVAYREMSLLLKRPP
FT                   GREAYPGDIFYLHSRLLERAAKLSDELGAGSITALPIVETQAGDVSAYIPTNIISITDG
FT                   QIFLESDLFNAGFRPAINAGISVSRVGGSAQIKAMKQVASQVKLELAQYTELLAFAQFG
FT                   SDLDKATRDQLNRGAKIMEVLKQPQYDPYPVEEQVVSFFAVTGGYLDAVEKENVTTFEK
FT                   ELLKSMRNNTDILVRIKEKKALDDGLKKELADFIKNFKDNFEQ"
FT   gene            213922..214782
FT                   /locus_tag="Sterm_0202"
FT   CDS_pept        213922..214782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0202"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   glo:Glov_3171 F0F1 ATP synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07087"
FT                   /db_xref="GOA:D1AKS1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS1"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACZ07087.1"
FT                   /translation="MSANMKEIKGRIESIKSTSQITNAMNVVSSTKFKKFQTLTLSTRK
FT                   YSEAIEETLGNVAGSLKSVHHVLFDGKREVKRIGVIMMTSDRGLCGSFNSNTFKELEKL
FT                   VASYGEKGVKVSVIAVGRKSRDYCKRRGINVDAEYIQLIPETMFEKAKGISENIAEFYL
FT                   SDIYDEVHIIYSKFISAIQYELKVERLLPLERREAKTNKEYIFEPSIEDVLRSLLPKSL
FT                   NIKIYQSLLENTASEHSARMTAMQSASDNAKDILDELTLDYNRVRQSIITQELTEIIGG
FT                   SNALK"
FT   gene            214801..216198
FT                   /locus_tag="Sterm_0203"
FT   CDS_pept        214801..216198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0203"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: atp2; F1-ATPase beta subunit (PMID 6228552) ;
FT                   K02133 F-type H+-transporting ATPase subunit beta; TIGRFAM:
FT                   ATP synthase F1, beta subunit; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07088"
FT                   /db_xref="GOA:D1AKS2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS2"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACZ07088.1"
FT                   /translation="MENKGTLLQIIGPVIDARFEEKLPAIYNALIIKFEDGRQLVAEVQ
FT                   QHLGNNVVRAVAMDGTDGLKRGLEVIDTGNPIKVPVGRETLGRIFNVLGEVVDKGPAVK
FT                   TEEYHSIHREAPSFEEQGTGTEILETGIKVVDLLAPYLKGGKIGLFGGAGVGKTVLIQE
FT                   LINNIAKGHGGLSVFAGVGERTREGRDLYNEMKESGVIDKTALIYGQMNEPPGARLRVG
FT                   LTALTMAEYFRDREGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPNLATEMGTL
FT                   QERITSTKKGSITSVQAVYVPADDFTDPAPATTFSHLDATTVLSRSISSLGIYPAVDPL
FT                   ESTSRILEPEIVGVEHYNTAREVQRLLQRYKELQDIIAILGMDELSDEDKLTVNRARKI
FT                   QRFFSQPFHVAEQFTGLEGKYVPLKETIRGFKEILEGKHDSLPEQAFLFVGSIEEAEAK
FT                   AREVAGE"
FT   gene            216201..216605
FT                   /locus_tag="Sterm_0204"
FT   CDS_pept        216201..216605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0204"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: lip:LI0404 F0F1 ATP synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07089"
FT                   /db_xref="GOA:D1AKS3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS3"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACZ07089.1"
FT                   /translation="MAKSFNIEAITPSGVTFSTTAEFLKLRTVNGDIGIMADHMPLVTE
FT                   LSYGEMIVKQEKGEEVRYYIDGGFMEVNKERVLILGDEIIESSQIDIERAQREKEVEES
FT                   KLSKLKEEEDIARANKKIQENLMKIKIGSR"
FT   gene            216691..217719
FT                   /locus_tag="Sterm_0205"
FT   CDS_pept        216691..217719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07090"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07090.1"
FT                   /translation="MGQRAVLIIAENEKYEIYYDHWCANTLDSYLFWGPEEAVSFIRKH
FT                   DPEKGYWLNDVWCEGAVLVDLDKKKLLFFGGEDIIYEIPLRRVYLELLAEMWKGYEIKW
FT                   AYHGITDLARYAGYDWKSLMDKSKREECEIINSFDSDSGGFYITGVFSITDKNNIRKVF
FT                   PLYSYDNRLIFCDNEKIIEYVNKLGDRSKVFEEERHKDYTFPSYGMHIDMTSKTSFFWE
FT                   SDTTNADYYDNLENLWDGWEIQYFYDDYQKHAVLIENEHIFPEIDHRKCVDRIRNIVCG
FT                   ENNNPADTVKDIVDALKNLGKEKIEINPAVYAADSFDMPKDSRVDIFEKISAEYLKKIR
FT                   KK"
FT   gene            complement(218014..218553)
FT                   /locus_tag="Sterm_0206"
FT   CDS_pept        complement(218014..218553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07091"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07091.1"
FT                   /translation="MGLFLDLGILKNCDKIKAKKILDAWAKDRTSDISPDECQLDEQNG
FT                   DTVILLNADSNFEGNAQFFKYASSKTNDAVMSLYIYDGDYWGYNLFDNGQEIDKFNPLP
FT                   DYFDDIDESEIEAYKGNSDIVAQYFNINKDSIENYLIFWTDELMDEGTAYENDEFGYED
FT                   WQLVDFMEKLGYKYFE"
FT   gene            218774..219235
FT                   /locus_tag="Sterm_0207"
FT   CDS_pept        218774..219235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0207"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: net:Neut_1073 6-aminohexanoate-dimer hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07092"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS6"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ACZ07092.1"
FT                   /translation="MKKFFLAAISVFFLFSCSNTTTLQNNGATGTGTTVKQKDIADTSW
FT                   KLTAISGEKITPKMMNGQEVGVITLDITADKISGSAGVNRYFGTYTLNGKNITLSGMGS
FT                   TRMMGPQDLMEKESKYLSALGNVTGFEFKDNNTLVLKAGADTLTFTKVK"
FT   sig_peptide     218774..218836
FT                   /locus_tag="Sterm_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.230 at
FT                   residue 21"
FT   gene            complement(219402..220703)
FT                   /locus_tag="Sterm_0208"
FT   CDS_pept        complement(219402..220703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0208"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mxa:MXAN_4404 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07093"
FT                   /db_xref="GOA:D1AKS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ07093.1"
FT                   /translation="MIKNIKTTILELHSFIILWITQALSSLGSAMTNFAVVIWSYQQQG
FT                   SALTTALLAICSYAPYVLLSIFAGALSDRWNKKITMLVSDSFAALCSILLLILLMTDNL
FT                   QIWHLYLINTLNGLMNTVQQPASDVAVSLLTPKKHYQKVSGMRSFSNSLVTILTPVAAT
FT                   ALLSFTSIKVVILADLITFSLAFVSLLFFIKIPKVKKHSIIKKETVWQSAKSGLYYLKN
FT                   NRGILNLILFLAVINFTASIFNAALPAMILSRANGGEMALGIVNACTGIATMSGSILVT
FT                   VLPSPKSRVRVICNSLLFSMSTENFILAFGNSTLIWSIGAFLGWIFIPFMSANMDVLFR
FT                   MKIPIEMQGRVYSARNTLQFFTIPLGYLCGGFLVDYVFEPFMSAQAEGNLWVSLFGAEK
FT                   GSGAAMLFFIIGVFGMLSCLPFRADKHIWSLEKN"
FT   sig_peptide     complement(220596..220703)
FT                   /locus_tag="Sterm_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.417 at
FT                   residue 36"
FT   gene            complement(221052..221903)
FT                   /locus_tag="Sterm_0209"
FT   CDS_pept        complement(221052..221903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0209"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   spe:Spro_3358 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07094"
FT                   /db_xref="GOA:D1AKS8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS8"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACZ07094.1"
FT                   /translation="MKKLFISLILILSCFIYGEEKVLYNKVITNSNPKIRVATYNIAAG
FT                   ANNFKVDLKLTAETIKKINPDIIAIQEVDRNTERSGRTDQIKVLSELTGYNYVYGKTID
FT                   FQGGEYGIAVLSKHPIVSNEIIKLPYTNTDTKKEEEPRIALVTKVDVPGFEVPVTFINT
FT                   HLDWHEDPNIRLQQVRTINEVTLDMRGIKILAGDFNDTLNSVIGREMERYWTTVFDGKT
FT                   DHRTWPAVNPEVAIDQIFLNNAQVWKVEKVYVPNTGTEKDTDWKTVSDHIPVIVDLKLL
FT                   EQ"
FT   sig_peptide     complement(221847..221903)
FT                   /locus_tag="Sterm_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.923 at
FT                   residue 19"
FT   gene            complement(222141..222422)
FT                   /locus_tag="Sterm_0210"
FT   CDS_pept        complement(222141..222422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0210"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: asu:Asuc_0608 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07095"
FT                   /db_xref="GOA:D1AKS9"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKS9"
FT                   /inference="similar to AA sequence:KEGG:Asuc_0608"
FT                   /protein_id="ACZ07095.1"
FT                   /translation="MTRIKHLENKGFFIFDDDEKETLAELTYKKNGDILIFDHTYVSDK
FT                   LRNQGIAGKLLNTAVIYARENKFKIKPVCSYVVKKFESPEFDDVNIDK"
FT   gene            complement(222447..223235)
FT                   /locus_tag="Sterm_0211"
FT   CDS_pept        complement(222447..223235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0211"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07096"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT0"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ACZ07096.1"
FT                   /translation="MKKFIISIILALVVLWFLKPFNIVILGSDARPWQPLKGSRSDSIM
FT                   LINVNPLLAKIKIVSIPRDSYTPIDCEKNGKTDKITHALAFGGSACSVRALENMLNTKI
FT                   QYHVLLRFEDVINITTLVGGVDIISNHTFTQDGQSFVKGKAYNIEGERALAYARHRKTD
FT                   SDYKRGDRQKQIFSGLQAKVISPSGFSKIPSILAYCKEHMEIRFNPLRFISMLPAIAIH
FT                   GSNYETFELEGDGKMMKGVWYFIPDQNSLKKIKKEFKVWI"
FT   gene            complement(223232..223831)
FT                   /locus_tag="Sterm_0212"
FT   CDS_pept        complement(223232..223831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0212"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: shn:Shewana3_0416 dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07097"
FT                   /db_xref="GOA:D1AKT1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT1"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ACZ07097.1"
FT                   /translation="MVLGITGGIATGKTAVSNILQEMGFDIIDMDIISREVIKLPEIIE
FT                   MLTKEFGTDILNNGGIDRKKLRNAVFDSREKVDRLDSIMHPAIIKISKEKIKELKDMKK
FT                   KLIVVVIPLLFEVNLEYLADKILLVAASREKQTERIIKRDNTNRTDAENIINSQMSLDE
FT                   KRKKSDYIIENNGNLSELRRKVLEFLNNLNYTGENI"
FT   gene            224277..226313
FT                   /locus_tag="Sterm_0213"
FT   CDS_pept        224277..226313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0213"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; phosphoenolpyruvate-
FT                   dependent sugar phosphotransferase system EIIA 2; M trans-
FT                   acting positive regulator; KEGG: eca:ECA0343 PTS system
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07098"
FT                   /db_xref="GOA:D1AKT2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT2"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACZ07098.1"
FT                   /translation="MYINNRLLEIVDFLKENKDTTIRETAEHLNILEQAVRYEINKLDF
FT                   ILELNNMPLLVKNKNGGLGIEDSLDLERLRGILDGMNKDSKEERQSFLKAKLFFEKKIN
FT                   ITKLSKSLGVSRTTVKSDILEFAREMEKYDLQLENNQLHGDEGKIRNLIFREFFREISE
FT                   LYYQDFSNDKKIPAENIFFEYLTEADIKAVKKFIREISRDLKNKDNNFYEYFFSYMVIS
FT                   YLRIKQKKTITNVENKKFLQSIEEYKMISKDIGPLEESLGVKYGKNEKMILADYMLGFH
FT                   SYAYNTLIFDKWLEIELLVKELIKNVSSRTNTDILSDDELLEGLLNHIKPAIYRMKNSI
FT                   FTEEDIYFDEVKEYKELLEIVGESLKPLAELIGSGFSNSEKALFTLHFLASIERNTKKT
FT                   VKNILLICSGGYGTSRLVADRMEKEYEVKVIDVISYFELFDTNIENVDIIISTIKTKER
FT                   DFNGIPVVTVSPFFTMNDQKILSSYNLVKRQVNETEIIEILDIINKNIDNEIKLKNELS
FT                   KVVFLDKKKNEDRGLQDFITKEEVSILDSVKDWQESIKTAGNLLLKNKKITEKYIDEII
FT                   HITETFGAHFVFQNEVAIPHGDASKNVNISSVSILKLRKAVLFPGEKKVSLIFFISAKR
FT                   KKDHVKSIEDIIKLMKNTEFIEKTNTVKNTEEFLELIKLYLMP"
FT   gene            226380..226841
FT                   /locus_tag="Sterm_0214"
FT   CDS_pept        226380..226841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0214"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: oan:Oant_4120
FT                   putative PTS IIA-like nitrogen- regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07099"
FT                   /db_xref="GOA:D1AKT3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT3"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACZ07099.1"
FT                   /translation="MLNNFLDNRCIELKSNYDSYEDLITNVSRELLKYGYVKESFLENI
FT                   LGREKQYPTGFELGGKYNIAIPHTDMENVLKPVIYIVVLDRPVMFKSAEDGKSDISVDI
FT                   VFVISLNEKDKHIVVLEELMKIFSKNDLIEKIKNSEDKDELIRLIYEEE"
FT   gene            226844..227134
FT                   /locus_tag="Sterm_0215"
FT   CDS_pept        226844..227134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0215"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system lactose/cellobiose-
FT                   specific IIB subunit; KEGG: hso:HS_1143 galactitol-specific
FT                   PTS system component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07100"
FT                   /db_xref="GOA:D1AKT4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT4"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACZ07100.1"
FT                   /translation="MKKILVCCGSSMVTSTVALNNIKEACQKAGIDASFGQCKFAEVPF
FT                   QIKTFNPDVIVPTGPLDESSAGGIPVVKGISFVTGVGIDKTIAEILDILKS"
FT   sig_peptide     226844..226906
FT                   /locus_tag="Sterm_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.638 at
FT                   residue 21"
FT   gene            227147..228412
FT                   /locus_tag="Sterm_0216"
FT   CDS_pept        227147..228412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0216"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: sew:SeSA_A3992 PTS system, galactitol- specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07101"
FT                   /db_xref="GOA:D1AKT5"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT5"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ACZ07101.1"
FT                   /translation="MEMVIKGLQFIASLGPMVMMPIIIFVIGLIFRLKISTLFRSSILV
FT                   GVGFAGVNMAVGFFISGVSEPIQKMVGFWGLRTDIMDVGWPARAAATWSFPMAAVVILA
FT                   VLGVNVLMLVIKKTRCVMVDFWSYNHFIFTAALVWYSTHNAILAITGAVLTAVITFKLA
FT                   DWTAPLAESYFGLPGVSFPTSNSVNFAPIAWLMEKIYNKIPGFRDLNANPEHIQKRFGV
FT                   FGEPLFMGIVLGSLIGILAKESVGNIMIIAMTTASAMILVPKMMQVIMEGLMPFANGIR
FT                   EILNNKFQGNNFTIGIDAALTIANPSVIAVGILMVPTTLIMATVLPGNRLLPLPDIAYM
FT                   SMWVAAWPVAFHKGNIIRGYITTVICTALMLLVATNMAYIHTQLAIAGGFEIPAGTLIS
FT                   TEDAGTHLLSWVLWKLSLLFKF"
FT   gene            228442..229353
FT                   /locus_tag="Sterm_0217"
FT   CDS_pept        228442..229353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0217"
FT                   /product="aryldialkylphosphatase"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: spe:Spro_4493
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07102"
FT                   /db_xref="GOA:D1AKT6"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT6"
FT                   /inference="protein motif:PFAM:PF02126"
FT                   /protein_id="ACZ07102.1"
FT                   /translation="MKSVRTVCGKISGDSMGYTLAHEHLIVSPELSDKKYDDYRLLDIN
FT                   LMCMEVEKFKQKSGKTIVEMTPLNYGRDPLKYREIAIRENINIICCTGFHKEEFLPELA
FT                   FKLTETDLINMLLEEINNGMDGTDICPGVIKCGTSYNNITETEVKIIKAAAKVHILTGI
FT                   PVSTHCDKGTMMLEQGELLVKNGVKPENILLGHTDVQKDLNIQLEALKRGFNILTDHVG
FT                   RELDNIDEDRIRKIEIMIREGFGGQLFLSGDMGKKDYVTAYGGRPGLDYILGVFKDKFV
FT                   REIGREYFDKITIDNPKRFFSF"
FT   gene            229401..230546
FT                   /locus_tag="Sterm_0218"
FT   CDS_pept        229401..230546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0218"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: vvy:VVA1580 galactonate dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07103"
FT                   /db_xref="GOA:D1AKT7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT7"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACZ07103.1"
FT                   /translation="MKISSFKIYEVKPRWIFIKIITDEGIEGWGEMISGTKTETVTACA
FT                   NEMCKKLLGRDPFDIEALWQELYRSFFRGGPVNMTVISGIETALWDIKGKYYNMPVYEF
FT                   LGGKVRDKLKVYSWIGGDRPNNVAEEAKQRFDQGFTAVKMNATEELHYIDSYEKVDQVL
FT                   ERMNSIKELLGNKIQVGIDFHGRVHKPMAKILIKELEPFRPMFIEEPVLPENWDAIIDT
FT                   AKNSPIPIATGERLSTRWEFKRLFNNNSVDIIQPDVALAGGILETRKIAAAAEMYDIAV
FT                   APHAPYGPVALAATLQLDMCTPNVFIQEQSLGIHYNKGFDLIDFVKNKEIFMFKDGYLD
FT                   VPEKPGLGIEIDEELVKKVSAEGLVWTNPKWKNYDGTIAEW"
FT   gene            230568..231176
FT                   /locus_tag="Sterm_0219"
FT   CDS_pept        230568..231176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0219"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: ppr:PBPRA1276 keto-hydroxyglutarate-
FT                   aldolase/keto-deoxy-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07104"
FT                   /db_xref="GOA:D1AKT8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT8"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ACZ07104.1"
FT                   /translation="MNKSKITGILRNVKKEDVLKVGEILIKHNIKDFEVTYNTKDSLEI
FT                   VKMLKKEFPEARIGMGTILNVEELKKAEESGAEFILTPSVNEEVLRYSGKNNIDLITGV
FT                   FSPSEVALALRYGFNYLKLFPAIDLPDSYINNLMGPFDKVEFMAVGGVEKDNITDFFKA
FT                   GFKSVGMGSSLIKKSYLESKDWEKLEKHVKEIAEIIETV"
FT   gene            complement(231259..231894)
FT                   /locus_tag="Sterm_0220"
FT   CDS_pept        complement(231259..231894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asu:Asuc_2100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07105"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKT9"
FT                   /inference="similar to AA sequence:KEGG:Asuc_2100"
FT                   /protein_id="ACZ07105.1"
FT                   /translation="MKIAVIGANGKAGSLIVKEALERGHEVTAVVRDSSKVNNTQVKIL
FT                   EKDLFDLTYDDLKENDAVIDAFAVWAEDQLYQHKTSLAHLSDILAEKPVRLLVVGGAGS
FT                   LYVDPEHKLRLMDTPDFPDMFKPLASNMGEAFDALRTRKDVNWTYLSPSADFSAEGVRT
FT                   GKYKAGGEELMTNSKGLSTISYADYAIAMLDEAELPKHLQERFTVVSE"
FT   gene            232042..232362
FT                   /locus_tag="Sterm_0221"
FT   CDS_pept        232042..232362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0221"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: hhe:HH1056
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07106"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU0"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACZ07106.1"
FT                   /translation="MKKELPACPVEVTLQLIGDKWKVLILRDLMDGTKRFGVLKKGING
FT                   VSQKVLTANLRMMETSGLVSRKVYAEVPPRVEYTLTKTGYSLKPVLDVMTVWGEEYKEK
FT                   ME"
FT   gene            complement(232416..232904)
FT                   /locus_tag="Sterm_0222"
FT   CDS_pept        complement(232416..232904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC2611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07107"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07107.1"
FT                   /translation="MKKILFFIVTLFLLNGVMSLADSMCGPNGVFNPGDNQCYPASGGG
FT                   YTETADDKYYAAIAVDPSTGEYAWGASYRSKNSLKTDVLSNCGSPNCKFLGTIRYKQCG
FT                   SLAYSKADNIYGYDTIIYWTKGDSTKKERAEEKSIKKCEKNGGKKCVVQISVCDIGKL"
FT   sig_peptide     complement(232839..232904)
FT                   /locus_tag="Sterm_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.896 at
FT                   residue 22"
FT   gene            233155..234477
FT                   /locus_tag="Sterm_0223"
FT   CDS_pept        233155..234477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0223"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: glo:Glov_2126 GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07108"
FT                   /db_xref="GOA:D1AKU2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU2"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACZ07108.1"
FT                   /translation="MKPIVAIVGRPNVGKSTLFNKLIGERLSIVKDVPGVTRDRLYRDV
FT                   EWSGKEFTLVDTGGLEPKTQDFIMSKIKDQAQVAIDEADVVVFLVDGKYGITGLDEEVA
FT                   AVLRKKDKKVIVAVNKIDNYIKNQDRIYEFFGLGFEEVIGISGEHKVNLGDLLDAIIGK
FT                   FEKMNTVQEEEVLSIAVLGRPNAGKSSLVNKILNKERSIVSDIAGTTRDSIDSDFRYKN
FT                   RKYRIIDTAGIRRKSKIDDSIEYYSVLRAIKAINRADVCVLMLDSTELVTEQDKRVAGL
FT                   IHDEKKPLIIAINKWDLIEKDNSTVKQFTELVKTELPFLSYAPVITMSALTGQRVMPIL
FT                   DQINDVFEEYNKKISTGVLNQVLGEMIAVNPVPTRKGRAVKINYVTQIGVAPPRFVFFA
FT                   NDPELVHFSYKRYLENKFREYFGFEGSPIEFIFNKKSERNF"
FT   gene            234477..235514
FT                   /locus_tag="Sterm_0224"
FT   CDS_pept        234477..235514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0224"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   msu:MS1958 PerM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07109"
FT                   /db_xref="GOA:D1AKU3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU3"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACZ07109.1"
FT                   /translation="MNIEKTKDKLVTLVLCLVCLFLITKVLPYFVPFLNVILSALIPFI
FT                   LAFVITYVLEPAVEFLEKKLNFKRMSAFMIVYFVVMFVFIAMVLALIPEVVNQFNSMIS
FT                   FIINHQGEIQLKVSKYIEHSHINISEIVYKLKEWFFRYIFSLLNSGISLIKAFFSIVFM
FT                   TPIFLFLLMKDYRSLKMKLKLRILEADRRDIIIIMRNIDVVLGKYVKGKLIDCFLVGTL
FT                   VYIIFSILGLKFALLFSFIIGVTNLIPYVGPVIGAIPACLFALLQSFNIFIGVLIAIVF
FT                   IQTLESVFLVPYITSKTVEIHEITTLLVLLIGGSLFGIIGALLAIPVYLVIKVIYEYYK
FT                   NNKGV"
FT   gene            235516..236553
FT                   /locus_tag="Sterm_0225"
FT   CDS_pept        235516..236553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0225"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmw:Mmwyl1_2087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07110"
FT                   /db_xref="GOA:D1AKU4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU4"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACZ07110.1"
FT                   /translation="MRKYREVREILIILVLVLLALYLFFQNYKYVQKPVNIVIGALVPF
FT                   ISSFIIVYCLMPFIDVLSKKLRINKKISIVIVFSIFILFLLYIVISILPLVIKQFNGLI
FT                   RYFVNNQGQIQKEINEFLDGTNIDLKSVVGKVREYLFSNSMNLINSSIALFSGLFSFMF
FT                   MTPIFTVMLLFSYDSIKTGLRKSLIRNKKRNILPLLKDIDDAVGKYIKVTLLDCFIIGT
FT                   LSSIVFYFLKVDYMQLFSIIIGVGNLIPFIGPFISIVPVLIYAATKSLNLFISILVIIT
FT                   VLQGIEANIVKPWLTSKSVNIHPITTLLVILIGGSLFGIIGAFIAIPVYIIIKLIFQFY
FT                   RKKIK"
FT   gene            236691..237161
FT                   /locus_tag="Sterm_0226"
FT   CDS_pept        236691..237161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0226"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cff:CFF8240_1561 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07111"
FT                   /db_xref="GOA:D1AKU5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACZ07111.1"
FT                   /translation="MSKCRKESKFDDCLYFTISRLFRIANKYAEDAFSDLEICPTHGYL
FT                   MILLDEQREGLSVSEIADKLAIAPSTVTRFVDKLTEKGLVEREKEGKKSYTKITKKGIA
FT                   EMDSVFQAWQRINDKFIRKISNLPYLKGISKDMGQLADYLEEGEKFEIDFTI"
FT   gene            237300..238340
FT                   /locus_tag="Sterm_0227"
FT   CDS_pept        237300..238340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0227"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: kpn:KPN_03804 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07112"
FT                   /db_xref="GOA:D1AKU6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ07112.1"
FT                   /translation="MKLKTAFIGFGKSTTRYHLPYVLRRDNIEVTAIYSRKRKPELEEN
FT                   YKEYNIEFTDNLQDILNNKEILLVSVCSPLQTHYEFAKRCLEAGKNVLVEKPFTETTEE
FT                   AKELFDLAKEKGLVIMPYQNRRFDSDFLLFKEALKNKNLGEIVEIESHFDRFRPEEAVK
FT                   PGTPVDGVFWGLGSHALDQMISIFGKPKKIYYDIRSLRDKTKPDDYYHVELFYDNIKVI
FT                   VKSSHLVLLEYPKFIIQGKNGSFIKYGIDKQEEYLKAGTMPWEKGFGEEPEENYGQFAY
FT                   IDNGGRMRKDIMHTISGDYGRIYDNLYEAIINKKKKLISDEEALMLLEILTIGIKCPNP
FT                   KIIDFK"
FT   gene            complement(238530..249647)
FT                   /locus_tag="Sterm_0228"
FT   CDS_pept        complement(238530..249647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0228"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: bur:Bcep18194_B0441 outer membrane protein,
FT                   haemagluttinin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07113"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU7"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07113.1"
FT                   /translation="MWKNKKKLLFLIAVSSLLSAQSTINSISDHNKLYNVMTEDLTYQK
FT                   NYEIIEKILTAKNKELKDLYKQSDYIVKPEYLEWQVFFTGFYENTHRGGNSTQKDFHVS
FT                   YLSEYSLEIPEAKREIISSIQKSLKNASVVYKSSIIVNENTPASINLSPLQSIAFPEIN
FT                   IGNFEPVIINLFTPKMPETVNVEVLASPSVISVGTPQLNKFVVLMPNTIQIQTPEVSDI
FT                   PEVKKPSTPQVPTVSANEFNPVTFNITPPVLASPPVFNIKLGSFCNFMITNCNSKGIDG
FT                   GPFGGNPISFGSNGTNYNISAGSIGNLGGGALTNGNPAIRYSWGSTASYNSTLLKVYFD
FT                   YGSVTSNPGGSATLTANLTIDSVNNLTAAQKTTEINNGRSWNAQSFLVGGSRIATLDNV
FT                   YNASLINNGTMNLVGPLVIGFEVQTDAAYSKNQGKREVINRKTITDAEEAGSAALNTIL
FT                   PVGSNLNLNLPPFAGGGTITVARDSSGFTGYKIGLMLTYEDADSNSSNSYVFTNEPTGL
FT                   IDFRGEKSIGMQIYAPGSENVPIKVTNQGVINIGGIESYGLKLSSRANSTNMVFSNTGI
FT                   INVSGNNGTESSRSSGMAVIEDINLTGTKSIRAYTNAVKNSGTINVSGGYGNSGMILKV
FT                   AAPDNIINSGIININGTSNIGMRVDYGSVNTGNAGSPTAQNNNIINVKDNRNLGIIANG
FT                   RGSTANTAVGNNGSTGIVNVSGNNSVGLFSTNGGKTINTALGTISVSGTSSLGIVVADS
FT                   TSAGTNSGIINISGNSSAGVYNVGTFNMDGGSITASSPRSVAIYSKPLSTTSITGGTIN
FT                   VNNGAAALSAENSTISMAGPVVTVNSGGLFFYKNGTGAVSGTGTVNINNGGTAFYITGG
FT                   NVPDISTLITSGNLTLNMSSGSTLVGWDQPVGVLSLNSLTGTLGTPSIANAVINDLSSS
FT                   TYKYFVINKADIIVDKNISLSGAGNHYFPRISLVSSSIRIANGYTITGTENSQLGIAQR
FT                   NYTGSSGTGAVVLTNDGTIYLSGNDSTGIAGDYTSINNNGIITISGNKSTGIFTANGSI
FT                   TANNGTINVNTAGANSSGVGIYGTNQFDSTPVSYGTGRINITNNGIIKYNGENSSSGAG
FT                   IYVHNDNLLTDSTVTLNTGSNINMSSSSTGVGIFTSNSIININGGVIEAGNTTGIYAIN
FT                   GSRINASGGSIRVDGGGVGVYLSGDSQYNETSSQTAQFVITGDNASLFSPETGSIFNIS
FT                   PANIDNTTNMLTTPYKFIVGSIGDINYTYDSSLNIGNVENATIFGTSGGTILLDTLSSL
FT                   VSNGVNTIGAGAGEAKDSLISYPGGAYEIINNGIITLTGKHSTAIYTKAGAKALNSGTA
FT                   GNLISIGKNSAGMYTEGIDSLAQNDGNIIIGEGSAGLYSSASKSALTEAGTVNNGNITA
FT                   QEITPGIFSNSVTGIYITAGNEGYQKNGIINFKGEGSTGIFNEGNFNMSGGTVSLQSLG
FT                   GVAVYSKGQRAVTEISGGAIEVQDGSVALYADNSTIKVSGGTFYIGAEGLLMYNYLSGG
FT                   SAALGQLNISNTPIAVIDNGGMAFYVEGESLSGISGILNNLVSTASTGTMFLNMKNGSS
FT                   LLRWNKPVNTLILSGIPSVGTVNGIDHTTLTAPGTDYKEYSVNLGDLIIDKNITLKFLG
FT                   NAYDGVEMSRSKVTLAAGYTITDSQDGQAAIAQTNYKKAVPSAGDINDIIITNNGTISL
FT                   TKKTATGIAVDYGLINNSSTGIISITGDDSAGILAANGSIVTNNGIINISGKESAGIYA
FT                   RNYFDGTAATSAAVLGYGDNSININNNGKLEILASSALNSEVYGIYLDNSGAVPANKSL
FT                   LTLGTNSKIIVGNSNPASVNKNIGISLINSALLDNGGNITIGIHGIGIYAKDSILEGSG
FT                   GVKSLGQDSVGYYFEGIVNSLLQMGSIELNGNDLAVYNIEDYTSAGINTFNTGNIELTS
FT                   TDGGTFIVGMIGKNRSLAMNNEIIIRKSLNNSLNGTVISGDRASLLLDTSFRITSEENK
FT                   IIGAASKELYTGGSWSDTLNPNYELVFKGKINLKNESVGLYASEGSRILNDTLGEIKIG
FT                   EASVGMYAVNQTVSSKALNRGKILLNGSESSGLRADGTSLSVNSGTIKSLQDSSGNYYE
FT                   NVQGMVVTTGASAENSGEITLNGNNSVGIYNNSGNVNMTSGSIIVSGNHNVGIYSKNSP
FT                   SGTNVSGGIIEASGGTAGSAVALYAENSKIKLDNGTLLKAGNNGILFYTSFSGATPTGS
FT                   FDLLSGIIQAEIGAGGIGFYQKGDSSDLGLQTFLNTIFTGSGALNIKLTDQSSKLFVIE
FT                   STGGVSNLSSLVPGTLGMLSGTRVSVDSASAPGYNIFLINKGELNIDQNVNLDNVYDAY
FT                   NKSEFISSKITLASGITITGTDDNQYAIVQKNSPGGLRSDILLNNNGGTVILSGNQSVG
FT                   ITADFGEIINSGTIEISGSDSIALLGANGTKIKNTGIIDISSSGVGIYGTNLLSTSAPS
FT                   YGNKKIEIENDGLITLNSTNERAYGIYAGNLDTAIPITDSAIILGGNSIIDMSNSINGV
FT                   GVFAQRSVLTVNGIINTGDGGIGIYTENTETEINSLNLNLSGNKGVGLYITGDKDLTAN
FT                   GNIDIDITGTDNTVFYFNSAGSINSLGEKLRIVNTAPGASFILGVLQTAQFNFINSYHN
FT                   TVELGNSSVTGITGQNSTIRFGTNVTVNGSGDGQTAIAVNGQSLASFIAGYTGYEAVNE
FT                   SNINLQNNSTGIYAKNGASVYNSGTLNVGDNSAGISGKDAGSKIENTGNITVGKGSDAL
FT                   YLKNGNTVINYGDLNGIKSDIIGIHIDNISGNVDNYGNIKLLGDQSVGIYTKGDNPLVI
FT                   NHYGTITVGDSTDILNSSTGIYYSSSNPGIINSNNIIAGNKSVGIYNLESTVNQNGILK
FT                   IGNESIGIYFGGGTAVFNAGSTLETGNQSVGVYSRQAGTIDINTTNDIKIGDNSFGFVF
FT                   KNGGILNTASTAAKVELGDSSTYIHAEGPSRITNNLDILMKSNASNGFVILNGDLTNNG
FT                   AITGISGTGNTGIYSENGTVSNKGSITLGDSLVVLNADNSVNTTASNYSIGIYGINSKI
FT                   TNGAGIDINVGKNGVGIYSDSSEANIDNQPVIINNGNIKSASNGAFGIYTINSNAINNG
FT                   LIELTGNDSTGIALQNSTITNNGTIIMRGDNSVGIHALSGSVVDNKGSIQIYGANSTGI
FT                   LTASGTIVLNSGSIYIDSLVTGTSEEIKADEDAAIYINPILKTSGLVVVNDNFKLEGLN
FT                   LIITPDPSTLQLGDTTVPHDFIIYTSKDPYLQANSLTITDSITVAPTYTKGTTANTYKI
FT                   ENVILTKDGTIATPTGAVIMKSGSLTWDITTVKNSKGGYDIYAERKDYNLFTKGLWFEE
FT                   FGRTLEENYLTSSGTDEKGEIYDKIDQITNENAFRNNISALSGEIYANINQREKTIADI
FT                   LTSSLDLLQNSKNNTKENVKINVITGKGTVKENTSGVTDYDYETAGALALREVERTYRH
FT                   TFGYSLGYVHTGFEFQDGNDSEEWVDTIQLGIHSKYKSGDWIVKNDFTGRLSNHNIDRN
FT                   IDWDSSERSELNGSFQTYSLTSNNILGREFGINKNSNIMPYAGLEIMYVIRPTFEEEGL
FT                   ERLKIDKNDAWSVKPKAGIKLDSSIPLGTKTAWKLKGVLDIAYEYELADLNKREKARLI
FT                   AIEDGYHDLAKPQDEYGTFKTRAEIGTEAEERYGIFLTGEYSAGEHDQEDFRIGLSLKA
FT                   VF"
FT   sig_peptide     complement(249585..249647)
FT                   /locus_tag="Sterm_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.594 at
FT                   residue 21"
FT   gene            complement(250378..251577)
FT                   /locus_tag="Sterm_0229"
FT   CDS_pept        complement(250378..251577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0229"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: hypothetical
FT                   protein ; K00927 phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07114"
FT                   /db_xref="GOA:D1AKU8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU8"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACZ07114.1"
FT                   /translation="MAKKTVKDLDVKGKKVLMRVDFNVPMKDGKITDENRIVAALPTIK
FT                   YVLEHGGKVIAFSHLGKVKEEADKASKSLKPVAERLSELLGQPVKFIPETRGAELEKAV
FT                   SELKDGEIMMFENTRFEDIDGKKESKNDPELGKYWASLGDVFVNDAFGTAHRAHASNVG
FT                   IASHLETAAGFLMEKEIEFIGGVVNNPARPLVAILGGAKVSDKIGVIENLIEKADKILI
FT                   GGGMMFTFLKAQGKNIGSSLLEEDKVELAKQLLEKAKANGKELVLPIDTVVAKEFKNDT
FT                   EFKTVSVDAIEDGWMGLDIGADSIKLFSEKLNGAKTVVWNGPMGVFEMPNFAKGTIGVC
FT                   EAIAHLEGATTIIGGGDSAAAAIQLGYADKFTHISTGGGASLEYLEGKVLPGVEAISDK
FT                   "
FT   gene            complement(251662..252669)
FT                   /locus_tag="Sterm_0230"
FT   CDS_pept        complement(251662..252669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0230"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: nmc:NMC2137 glyceraldehyde 3-phosphate
FT                   dehydrogenase C; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07115"
FT                   /db_xref="GOA:D1AKU9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKU9"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ACZ07115.1"
FT                   /translation="MAVKVAINGFGRIGRLALRLMVENPEFEVVAINDLTDAAMLAHLF
FT                   KYDSAQGRFNGEISVKEGAFVVNGKEIKTFANPNPAELPWGDLGIDVVLECTGFFTSKE
FT                   KAEEHIKAGAKKVVISAPATGEMKTIVYNVNHSTLDGTETVLSGASCTTNCLAPMAKVL
FT                   DESFGIVEGLMTTIHAYTGDQNTLDAPHRKGDFRRARAAAANIVPNTTGAAKAIGLVLP
FT                   NLKGKLDGAAQRVPVITGSVTELVTVLGKNTTVEEVNAAMKAAANESFGYTEDEIVSSD
FT                   VIGIRFGSLFDATQTKIITVDGKQLVKTVSWYDNEMSYTAQLIRTLKYFVEISK"
FT   gene            complement(252826..253992)
FT                   /locus_tag="Sterm_0231"
FT   CDS_pept        complement(252826..253992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0231"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   hdu:HD1125 pili/fimbriae biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07116"
FT                   /db_xref="GOA:D1AKV0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV0"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACZ07116.1"
FT                   /translation="MKIKFKYMDKGFNKKSSVLEFKNEKEFYDYIKIQKYTLLHHKKIL
FT                   SLKSRVKTGEFTTFITSLYFLVKADIRIADALSILAENFSGALKDNISNAVSALKAGKT
FT                   LREGFAFITDDKIFLNTMEIAEESGNILLPLENLKNKYEFEQELKKEIINLSMYPALVL
FT                   GTSIIIISILFKFVVPKFSGIYNDLNKEIPLLTKIMIKLSNLYGKYFIIISISVIGLFF
FT                   FSITYCKKNKENFEKLLIKFPAVKKLYQEFRILYFSQSMSILLNSGVEIIRSIELSAQT
FT                   AGSLLEKELKILVKKLEQGHSISTIIENMQFFDNEYKNYILIGEETGNLGFVFSHITDI
FT                   YFMRIKEKTKRFLKILEPVSIIFIAFFIGLIVISVLLPVFRLGENLNI"
FT   gene            complement(254055..254531)
FT                   /locus_tag="Sterm_0232"
FT   CDS_pept        complement(254055..254531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0232"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: gme:Gmet_0059 2-C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4- cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07117"
FT                   /db_xref="GOA:D1AKV1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV1"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACZ07117.1"
FT                   /translation="MFRIGQGYDVHKFAGDRDLILGGVKIPFELGLDGHSDADVLTHAV
FT                   MDALIGALALGDIGKFFPDNDPKFKNADSILLLREILSVVSEKGYNIVNIDATVVAQKP
FT                   KLRDYIDEIRKNFAKELNIPLDCISVKATTEEKLGFTGNMEGMKSYCVVLLSKK"
FT   gene            complement(254534..255907)
FT                   /locus_tag="Sterm_0233"
FT   CDS_pept        complement(254534..255907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0233"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pzu:PHZ_c2267 permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07118"
FT                   /db_xref="GOA:D1AKV2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ07118.1"
FT                   /translation="MTETAVRETKKFSILEGIFFNGMYLSTQGFIMLNLALYFNANPFF
FT                   IAIISILPTATQVLQIFTKKLYALFKTRKKTLMVSIIISRTSMIFLPVAVFLDLRNPYI
FT                   YTAIILIYSLFAPFVTNTWTAAMVEIINNKERGKYFGKRNFFISISSIFFTLIYGIFLA
FT                   MPDKKTGYFILSLSIAISAVSTIFLMNRHHIPDFKPTAQKISYKEIFKNKDFITYLKFV
FT                   SVWLFSLEFLKPFFEYFRVKTLGSDPRFLANIGVLTAVISMFLFIIYGKLSDKYGNRTI
FT                   LRLGIFFATYNALLYFTLTDDNFKVSLVLSGIFDAVGFTAINLCFLNLLMEVSKDPVEG
FT                   YVSIYSAVVGITAMLAGLFAGILGTFINEGFIYLMGEKIYTIKLAFIIGFLLRLFSILR
FT                   LTSINSFQKEFKYSGTLPLRSAMNKRITAFLPSYIAISRMKKEDHTSEDDKNIKENKE"
FT   gene            complement(255924..256805)
FT                   /locus_tag="Sterm_0234"
FT   CDS_pept        complement(255924..256805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0234"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sde:Sde_2639
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07119"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV3"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ07119.1"
FT                   /translation="MKKIAAIEAGGTKFICGIGNENGEILDKTSIPTKTPEETMKMVID
FT                   YFKDKEFEAMGIGCFGPIDPVKGSESYGYITKTPKPHWSDYDIVGELKKHFDVPMEFDT
FT                   DVNSAALGESLWGAGQGLSSVVYITVGTGIGAGAVINGKMLQGLTHPEMGHIFVKRDKN
FT                   DPYTGKCPFHKDCLEGLAAGPAIEERWGDKAYNLEERNEVWEMEAYYLSQALVNYILIL
FT                   SPQKIIMGGGVMKQSHLFPLIRKMVRETLNGYVHKKEILEDIDNYIVYPGLKENAGLMG
FT                   SLALGRLALENR"
FT   gene            complement(256832..258565)
FT                   /locus_tag="Sterm_0235"
FT   CDS_pept        complement(256832..258565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0235"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   atc:AGR_C_3190 ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07120"
FT                   /db_xref="GOA:D1AKV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ07120.1"
FT                   /translation="MFRKFLDYILKYRKNMSLVLLVVMGITAIDLILPFFSRQILNVYI
FT                   PENNSEAIIKGGLIFTGLVIIYTGLNFSQAYFGHIWGLRLHQDMRERAFKKLQVLPFEY
FT                   FDKNKVGIILSRVTNDLFTISEMIHHGLEDFLTFFLVSIVGFILLLQINIPITLLIFAF
FT                   VAVQLIATAMARKHMENIFRKAREKTSSVYAKLESSISAVRLTRAFANEGRELEDFRSG
FT                   AKLQEKMAKRTNFALAMFSAVNNFFSLLLNIVILTISGTAVIKGVINYGDLLAYIVYFN
FT                   LLMAPMKLIIRSFETIQEGWVSFVRFQELIDEPEPIKNAPDAVMLKNIKGNINFENVTF
FT                   KYEAGTETILKHFNLNIPAGKMVALVGPSGVGKTTIAQIIPRFYEIESGNVYIDDTDIR
FT                   QADLHSLRENIGYVQQDVVIFWGTIRDNIEYGKLGASDIEVITAAKHAGIHEFIMSLPE
FT                   GYDTFVGERGVKLSGGQKQRISLARIFLKNPRILILDEATSALDNITEAIIQENIEKLT
FT                   KNRTVIVVAHRLSTIKQADQIIVLDKDGIVESGTHSELIRNENGHYFKLYNTQLNGFIT
FT                   G"
FT   gene            complement(258606..259598)
FT                   /locus_tag="Sterm_0236"
FT   CDS_pept        complement(258606..259598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0236"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein; PFAM: PfkB
FT                   domain protein; KEGG: nam:NAMH_1710 bifunctional protein
FT                   HldE"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07121"
FT                   /db_xref="GOA:D1AKV5"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV5"
FT                   /inference="protein motif:TFAM:TIGR02198"
FT                   /protein_id="ACZ07121.1"
FT                   /translation="MVGKKRLEEILNNFSNARIAVVGDVMLDDYIFGSVDRISPEAPVP
FT                   VVNVKKETFVLGGAANVLNNLNSLNAKVFAFGVIGNDDNGKRFLNVLEEKSIHTDGIII
FT                   DEKRPTAVKRRVIAQNQQLLRLDWENKANITADVEDKILEKIKNNIDNIDAFILSDYDK
FT                   GVLTARLSSEIIKLANENNKIVTVDPKPKNHMNYLGATSITPNRKEAMECLEVESFSDE
FT                   EDLTAQMFKLKEKLHLNNLLLTRSEEGMTLFGNDEAETISTVAKEVYDVTGAGDTVISV
FT                   FTLAKVAGATWFEAARIANTAAGIVVGKMGTATATPEQITEFYDELYNS"
FT   gene            complement(259689..260819)
FT                   /locus_tag="Sterm_0237"
FT   CDS_pept        complement(259689..260819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c2471 lysophospholipase L1"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07122"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07122.1"
FT                   /translation="MNSKIKWVGAFSVSATNLTLTNIQFKNETILIKLNITLKGRNIKI
FT                   KFSNLYGSLPLKIKEACIFKENSAYSDIFFNGGHEVIIPVKEEIYSDPLEFSVTADENY
FT                   WVGLYIENFTELSTGNFSFLSYYISEKGNILDELKNKNSDILHKNEYRNHLIPFVTNIE
FT                   VIDEGSYSSLVIFGDSGIANGWHHHLVKRFQENNIHNTAVLSQEINGNRLLHSCPDQLK
FT                   GLYGSSGLSRFEKDVLNQTGIKFLLLFPGINDLISSCKTEEISSLNGNDIINALKICST
FT                   IAKERQISIIGCTIPPVYGCKYYSAKMESIRTAVNFWIRTSEEFDSVADFDSFLCNPEE
FT                   PEKLKKDFDKKEYFYINDEGIKAMAECIDLKIFNKK"
FT   gene            complement(260842..261948)
FT                   /locus_tag="Sterm_0238"
FT   CDS_pept        complement(260842..261948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0238"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: eta:ETA_07920 general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07123"
FT                   /db_xref="GOA:D1AKV7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV7"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ACZ07123.1"
FT                   /translation="MNKKYIFLILLIFLPAYSTEISNYVNKEDHEASKRIFIVKPKEEI
FT                   KKASEKVQNTAEIKSEISSPASLQNNSEKNKTPPVTRESIRLVNIDTSELIPKLKDINT
FT                   SKITGLGKELILKGTMEEINELKYIIEKFDRPKKQIQIKATIIDTSDNLFERLGVDFSA
FT                   GKNNDNKASDFLSSFIDGNLSLSGLLKTGGNFLGINIDALKENGDIKIEAMPVLLILEG
FT                   SEGELRVTEEVIVGEKKSTIKDTEYIEPVFAEAGVVFKIKPEIRGFGDSQEIILYIDSE
FT                   ISNFKLSSNFNADQGAKQKNKINSIVSFKNGTSVFIGGLKQNVQKDSEKRVPVLSKIPI
FT                   LGSLFRYKRKNKEIRDIYIEIEGEIQTE"
FT   sig_peptide     complement(261892..261948)
FT                   /locus_tag="Sterm_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.878 at
FT                   residue 19"
FT   gene            complement(261945..262490)
FT                   /locus_tag="Sterm_0239"
FT   CDS_pept        complement(261945..262490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07124"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07124.1"
FT                   /translation="MELNRNKYTLLFLSVVLLIFLFQKYERRTELKNNYNILLNEKNEL
FT                   KEKLRHVNEENSQKKTESEEQLKTINNITLNLNSSTLKNETEFKKIIYLFSEESGLDLR
FT                   EIGKAEYIWKKESYSLKYIFFTFEGDLAGMTKFLYFINKSKVYIDMTKSYIELTRDSFK
FT                   ISLGYLEKNSNLMKEEKK"
FT   gene            complement(262481..263632)
FT                   /locus_tag="Sterm_0240"
FT   CDS_pept        complement(262481..263632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07125"
FT                   /db_xref="GOA:D1AKV9"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07125.1"
FT                   /translation="MLEIYLKSENRLFLKYHEEITAYTFDNILEVINDIKNKYGIKKEK
FT                   VSLILDFSRFYISFFEAPSSNSKEEQNLLKSFLSDEIENYSIKNFITKQFYLDHPLRKS
FT                   LVFCIRRDFIVNLAALLKKYGFIITECKADIIGIYRYYENEDVSVLTFGDELSSFLSVR
FT                   NRNIQGFKSLNLNINDSDNINSYEFVNDDETMIFLDYQPENIEIIFKGCELSNDINFLN
FT                   TRIPIFKNIKMKNIFPYFLIILICILLNLFLSTNELEKKNDEIKNEVETIQQSFLAAKN
FT                   ENIPDYSKDLNELKEIIQNMKYQNHYKFLKFLIEESNTDTGFSKIIYENNFWTIEGDSL
FT                   KFKNIEKFEIKLARYAQNIELIFIKSRSKLLTFQYKIGDIIWN"
FT   gene            complement(263632..264171)
FT                   /locus_tag="Sterm_0241"
FT   CDS_pept        complement(263632..264171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07126"
FT                   /db_xref="GOA:D1AKW0"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07126.1"
FT                   /translation="MKNKGSSLLYVLIILSVLSVFLTGFIFFTKNRYKILTLNSAYSYA
FT                   LKIKLTENEKAFSASIYKSGILIAGNKISLNNKYEYYNSGVAEDSTGKTNLKRLLYFKQ
FT                   NEKSTGGFNITDIKDQNGNSYHLPLKENMLYPDLIIIYGKNILNENISAAENIKFIRKN
FT                   NDEINIETISFYFEGE"
FT   sig_peptide     complement(264103..264171)
FT                   /locus_tag="Sterm_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.483 at
FT                   residue 23"
FT   gene            complement(264168..264650)
FT                   /locus_tag="Sterm_0242"
FT   CDS_pept        complement(264168..264650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07127"
FT                   /db_xref="GOA:D1AKW1"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07127.1"
FT                   /translation="MKNKGGLLLEFILNIFIFSIILLLLFTFMKRIVIIQNYKTKVRTA
FT                   GENTLYLFNVLKKNIKERDKEKFLYKGKKSNFFIINENGVSDTGNSLLYKADGEFYLIK
FT                   FNKPKLLISSSQTPESFKKYDTLAKLDSLVFRTKSDLLLIIFEINGNTTEQVINLK"
FT   gene            complement(264640..265071)
FT                   /locus_tag="Sterm_0243"
FT   CDS_pept        complement(264640..265071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cation channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07128"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07128.1"
FT                   /translation="MKYKNKRGSLLIENLLALLYITAVLLPFSHLYIKVFKTNILLEKK
FT                   ERESVFLENIPEYLENTGYQNLETKTGKKSFTSFKDFCNFFHLSCFETKEKENTLINID
FT                   IQKTEYYYLNKNLQKLFIFKITTDTKELYYIPYLEDYEK"
FT   gene            complement(265068..265787)
FT                   /locus_tag="Sterm_0244"
FT   CDS_pept        complement(265068..265787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0244"
FT                   /product="peptidase A24A domain protein"
FT                   /note="PFAM: peptidase A24A domain protein; peptidase A24A
FT                   prepilin type IV; KEGG: geo:Geob_3081 peptidase A24A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07129"
FT                   /db_xref="GOA:D1AKW3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW3"
FT                   /inference="protein motif:PFAM:PF06750"
FT                   /protein_id="ACZ07129.1"
FT                   /translation="MIAALILGLITGSFTGVICYRIPRNESIIFPGSKCDRCAVKIAFY
FT                   RNIPVFSFLLQHGKCHRCGIKIKRSYFILEILTPVLFLILYFSHGFSIIFFYKAFVYSI
FT                   LLAASFIDIETHIIPDRFFIILLITGFLYSVLRNNPENWFLGAASYGLPVLLLYSASDF
FT                   INKEIIGFGDVKLICAAGGFISYSGLKNLLWFYEILYISAGIFSFFLIFFRKRTLKCYV
FT                   AFAPFICFSVFISEVYL"
FT   gene            complement(265784..266158)
FT                   /locus_tag="Sterm_0245"
FT   CDS_pept        complement(265784..266158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ftn:FTN_0415 type IV pili, pilus assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07130"
FT                   /db_xref="GOA:D1AKW4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07130.1"
FT                   /translation="MKKGFTLVEVILVLAIISIIATIAIPQVNKYLDKANKSKILGAIS
FT                   DLNNSSLSWSIENNGSIPDDIQKVFQEHGDIEKLNINLKTDTSFELGNIKGKFFLDDGE
FT                   ISAKIDSDSRSFKDETLVAK"
FT   gene            266625..266861
FT                   /locus_tag="Sterm_0246"
FT   CDS_pept        266625..266861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0246"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   dol:Dole_0802 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07131"
FT                   /db_xref="GOA:D1AKW5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW5"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACZ07131.1"
FT                   /translation="MEELIQAGALLGAGTAMIGGIGSGIGQGFATGKAVEAVSRQPEAK
FT                   QDILQVLFIGCAIAESTGIYSLVIAFLLIFMKS"
FT   gene            complement(266997..267782)
FT                   /locus_tag="Sterm_0247"
FT   CDS_pept        complement(266997..267782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0247"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="KEGG: gur:Gura_3754 NAD synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: NAD synthase; ExsB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07132"
FT                   /db_xref="GOA:D1AKW6"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW6"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ACZ07132.1"
FT                   /translation="MNKLAIDHEYVSRRIIEFMRREVRNSGFEKVILGLSGGIDSSLVA
FT                   FLAKEAFGKKNVHGVIMPYRTSSPKSEEDALKVAEAAKISWEKVEITNMVDSYFSFFPD
FT                   ASPLRKGNRMARERMCILYDLSARDRSLVMGTGNKTEMYLGYSTQYGDAACALLPIADL
FT                   YKTQVWSLSEYLGVPKEVIEKKPSADLWEGQTDEGELGFSYHDADDILFELIDRKKDRN
FT                   EVITLGFKSEVVDSILEKIKNSEFKRRMPKIAYIHDKAK"
FT   gene            268103..269458
FT                   /locus_tag="Sterm_0248"
FT   CDS_pept        268103..269458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0248"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: pca:Pcar_0086 TrkH family potassium uptake
FT                   protein; TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07133"
FT                   /db_xref="GOA:D1AKW7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW7"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACZ07133.1"
FT                   /translation="MSRKKSISPYWILLDSFLIIIFIGTVLLTLPISSATGERVPVIDS
FT                   LFTTTSAVAVTGLVVNDVSTTFSLFGKTVIIILIQLGGLGIMTFSSIIVLLISKKISYR
FT                   TKKIVQEDLNYNTLFDIQKYIKNVVKTVLFIEFLGAFCLFFTFIKKYSFWKAVYYSVFH
FT                   SVSAFCNAGFSLFSDNLGGYRSNISVNIVICSLIVLGGIGFAALNNIHLYIKKKIKRDK
FT                   NKIRLNLTTKMAVLMSAILIAAGILVTFVIEANNPATLQNFSMHDKILASLFQSVTTRT
FT                   AGFQTMDLANMRIATLISYIFFMYIGASPGSTGGGIKTTTIGVIILGVYSTLTNREDIE
FT                   IKKKKIAWDVFNKATSIVFISLTYIICIVFFLSLLEKNKGFLELVFETVSAFGTVGLSL
FT                   NITPDLGSISKLLIALTMFIGRVGPLTVAMALSAHSKRRGAYKYPVEDVQVG"
FT   sig_peptide     268103..268216
FT                   /locus_tag="Sterm_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.449 at
FT                   residue 38"
FT   gene            269474..270133
FT                   /locus_tag="Sterm_0249"
FT   CDS_pept        269474..270133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0249"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pca:Pcar_0085 K+ transport systems, NAD- binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07134"
FT                   /db_xref="GOA:D1AKW8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW8"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACZ07134.1"
FT                   /translation="MANYLVVGLGRFGRSVARTLYENNQDVLAIDDDEETVQQAIDSDL
FT                   VSEAIVLDASDETAIKNVIKDNFDVAFVCIGSNMQASIMVTLLLKEAGIPKIIAKAQSR
FT                   AQGKVLEKIGADEVIYPEEFMGKRTANKILRPTIVEHFKLSNKYAVVEVLAPKSFSDKT
FT                   LIQLDVRKKYGINIIGIKDKNNEVNISPAPDTMIKEGDTLIVVADNKKLNELNRMK"
FT   gene            270147..272033
FT                   /locus_tag="Sterm_0250"
FT   CDS_pept        270147..272033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0250"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: ppd:Ppro_3621
FT                   tRNA uridine 5- carboxymethylaminomethyl modification
FT                   enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07135"
FT                   /db_xref="GOA:D1AKW9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKW9"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACZ07135.1"
FT                   /translation="MRDYDVIVVGAGHAGCEAALASARLGMKTAIFTITLDNIGMMSCN
FT                   PSLGGPAKSHLVKEIDALGGEMACNMDKSFIQMRILNTKKGPAVRSLRAQADRKVYSRE
FT                   MKKTVENQENLDIIQDIVTELKTENGKVTGISTKTGLEFTAKVVILATGTFLKGLMHIG
FT                   DRKIKGGRMGELSSEELSDSLAKEGLKIGRFKTGTPPRVDIRTINLDILEEQPGETEKL
FT                   LKFSARTKDEDIKGRKQLSCYLTRTTPNIHSIILSNLDKAPMYNGSIDSTGPRYCPSIE
FT                   DKVVKFSEKDSHHLFLEPEGFDTSEVYISGLSTSFPAEIQQKIVNNVIGLENAHIMRYG
FT                   YAVEYDYVDPSGLKYTLESRAVENLYLAGQINGTSGYEEAAAQGLVAGVNAVQKLKNKE
FT                   PLILDRADSYIGTMIDDLINKEIMEPYRMFTARSEYRLILREDNADLRLAETGYKIGLV
FT                   SEEEYKKTVHKRESVKKIIEILENTKLGTSNGRLVEILDKYGDSLKSGTTLKETLRRPK
FT                   VTYDDIKYIAGIMNDVPDLSYDEDIEYQTEVQVKYEGYIQKSYQIIERQKRLEEKMIPE
FT                   NFDYNRMLGITREAKQRLGEKRPHNIGQASRIVGVTPADVSVLLMYLEGVLS"
FT   gene            272035..272730
FT                   /locus_tag="Sterm_0251"
FT   CDS_pept        272035..272730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0251"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: hypothetical protein ;
FT                   K03501 glucose inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07136"
FT                   /db_xref="GOA:D1AKX0"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX0"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ACZ07136.1"
FT                   /translation="MKDYFEQLLKKSNIKLDNSKVEILLKYLRLLTEKNKVMNLTAIRD
FT                   EKEILEKHFIDSLLLSELFLHTDKKIIDIGTGAGFPGLVLAVAFPEKDFLLVDSVRKKI
FT                   SFIDEAAENLGLTNVKTSYERAEDLVTKSRSSFDLGLCRGVANLRIILEYMIPLLKVNG
FT                   RFLPQKLNENELSESENALKTLNSKILKIHKFRLPESNDERIIIEIQKLKEISSRYPRK
FT                   TGIPAKKPL"
FT   gene            272740..273549
FT                   /locus_tag="Sterm_0252"
FT   CDS_pept        272740..273549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0252"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: gbm:Gbem_3956 ParB-like partition protein;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07137"
FT                   /db_xref="GOA:D1AKX1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX1"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACZ07137.1"
FT                   /translation="MKLLNLDSGKIILNSKQPRKKFDDEKLEELSKSIKEYGIIQPIIV
FT                   RKIVSLNKYEIIAGERRFRASQMAGLSKIPVIEIASDNIKSFEIAVLENVQRENLNSIE
FT                   EAEAYNNLIEVYNYTQEELAEKLGKTRSAISNKLRLLHLPEKVKQMVRENKLSYGQART
FT                   LLAFKDNTQIEELSDEIVKKQYSVRELELMAKKSQKKDKTPKNKKSESVFEGSSDEIEY
FT                   LKSKLIEFFESKVEIKLLNEDQGKLEIEFYGYEDLERILNILKLDLE"
FT   gene            273706..278217
FT                   /locus_tag="Sterm_0253"
FT   CDS_pept        273706..278217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0253"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   rsq:Rsph17025_2622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07138"
FT                   /db_xref="GOA:D1AKX2"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX2"
FT                   /inference="protein motif:PFAM:PF04357"
FT                   /protein_id="ACZ07138.1"
FT                   /translation="MKYLKKTIVVFILLLMVITGVVTYINSKLFSKDIQGIIKSLNLDI
FT                   KVGDAKFVGYGKIKVTGLVLYDKEKRPAIEADEGYIYINPLSISRVRKIDVYSPNVILE
FT                   KQDGMKFNIVEMFSGESDKIDRTSRIGRINFYNAKLDYRDTSYKKLIQKNLDNVNGYVN
FT                   FSKAKGISLEAAGNNDDEKIGVVLKIFPSQKKSPEAFLQRKAIRENKIYFELNFDKFRI
FT                   FPEAVQYVPFEGLEVYDGKISGKLKMELNKKFSGNLNIENGTLKYVDYDEILKNVNANV
FT                   VLKDNNVDIATGAELNGGKLDLGIKFLEKTKTVKLAIKSDNMDYSDIRKYKLVKEQNIE
FT                   AFGRITGTFNANLDLDKKIYEFDGFLSSPNLQYSGYNFRNLKTNLVYDKNSILTLSNIS
FT                   FGFNETISDIHIAADARALFSYNTKLKAGSGTYELDNKGSDFSIKKINGNFEIDKNNVV
FT                   RSDFFSEEADGNFAFDTKNKLLEISTGGKQYFDLKYGENKFTLKPVIRNLKISLDKFLL
FT                   VSGAADIDIAKNEYFDTARVSAIVRNGNFDVNAAAAISGQNVRATGTTDNKFNHRYKVS
FT                   GSNVRIKPLLDRFGIKVAGMEQSDLVTDFNANIYGSGANLKGDFNIASQRGKYFVEYEK
FT                   LNVSGNIEDLLKGRLQAKVNAGEIWLNYQRFKNLSGDVKYENNVITLTDFKNEDLNANV
FT                   SFNIKDQYVNLNAQINNYVLYNVSKPEFNLKLLKLDVNLSGNVNSLNGSMFISPSMVTI
FT                   DNRYSGELKGNVDVRNSVLILDQLAWRKNTLKGTYDLNTQTADVYVHIDEEKLEELYGM
FT                   DNIIVSLNSDLRLQGRLDDFTITGDINIGHMQYGDIKLPAVESVIAYKNGDIKSILKKG
FT                   SLEVSKFILRGEEGEEILHTSTKIDDLSTSQLDFVLNDKELDLTSIKGFKEKGYTGIIN
FT                   YSLILRGNIDDFFVDIKAESDNFSVSGFSFNNLSIDAQINNKGLNIGQLYLEYENNPLL
FT                   VNGYVTFTPIDYNINVLAENFNLDFLKAGNGMKDAGGIANLDVTFTPENTSGIIDLQNF
FT                   VFKDQKGNVDISELNANIDINNRKLVVNNFSGNYNGGTVNISGNLDVPGLAADFADSKK
FT                   LDLGDFDLRITLDKTNIKYGKTFDGVLSADLSFTEKELLGSVIVDKGKIADISQFIGDK
FT                   KEEEETSGKKKEKSIIDGLQSEIVDIIMGQYSANIRINIMKGIDLEIPSVSLVRNIRGV
FT                   LKGEGVIMLNSGNISASGDFYVTKGKFTLSDRNFVLDQAEFYYGSGGFSGSEIGNPFVV
FT                   VLATTNINNDQVSVSISGNLSDPQIKFNSSLGLSQEQILALLIFDARTAENSEFESRDQ
FT                   NQQLGNLADPILNQLIFGSVIGTIEETFGLSAVSLRTNVQTQSTDKNANGQDFGATIAP
FT                   SVYIQDNLYKDRLYWNVELGYGEESTASAGLDYNFWITYKVSEKFGVNLGLQNLRGNDS
FT                   LVDKTDYYLGVEFSTRFYTFGDFLKSLRKPKLEVIPEQDKLK"
FT   sig_peptide     273706..273777
FT                   /locus_tag="Sterm_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.521 at
FT                   residue 24"
FT   gene            278232..280283
FT                   /locus_tag="Sterm_0254"
FT   CDS_pept        278232..280283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0254"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: bba:Bd1493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07139"
FT                   /db_xref="GOA:D1AKX3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX3"
FT                   /inference="protein motif:PFAM:PF01103"
FT                   /protein_id="ACZ07139.1"
FT                   /translation="MKGKLSSIIIVMVILILATFNIQAAENNELRVRNILISNLRELPR
FT                   ELVMSKLKIREGETYSTKKISDTYLALRELPYINDANFYTQVEGDNIDIRIEVDEMPNA
FT                   LEIAKREESREELSKKTEFIISNVSITGLQSLKEADFIKDIPLKTGEFFVPQDAIDGAS
FT                   KLFNSGYFSSVEPKVVRGADNTISIEYVVEENPRVNNITIEGNTIFTEAELLSALEVKK
FT                   GDILNIEKMDPSKNGVIKKYQDSGYTLARIDDMKLDDSGNVRIILSEGTIEAIEYRKIG
FT                   KKREGERRTPKSTDLRTQDYILERETRMKVGEIFQRDKMEQTIRNIYRTGLFTSIQPNF
FT                   KPSATDPNGRIIEMEAEERPAASINGNISYGTSVGFLGGINYTDSNFLGRAQEFKAAIE
FT                   ISDEGDQTYEISIFDPWIRGTERLQAGASIYYRQTEDDDANGTDLYKVKRYGTRWTLGQ
FT                   GLNDDIYVRGAIRYEDVKEYYRSGAKRDDYDLVAFTPTITYDTRNNRFSPQKGLYLSLS
FT                   DEIGKIVSDHRSYNQFEIDLRAYHRTFFKDKNTMAYRAVWGTTGSETPEALRFKMGGAD
FT                   SIRGYDYGDFEGYNEFYFNVENRTQVTNSIQVVAFFDIGNAWQTNDKKPDRDGADKFKD
FT                   LKSGAGIGVRILTPVGPLKFDYAWPLDIAPGDSKKDNGKFYFNFGPSW"
FT   sig_peptide     278232..278306
FT                   /locus_tag="Sterm_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            280298..281308
FT                   /locus_tag="Sterm_0255"
FT   CDS_pept        280298..281308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0255"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-
FT                   acyltransferase; PFAM: UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N- acyltransferase LpxD; transferase
FT                   hexapeptide repeat containing protein; KEGG: pca:Pcar_1253
FT                   UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07140"
FT                   /db_xref="GOA:D1AKX4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX4"
FT                   /inference="protein motif:TFAM:TIGR01853"
FT                   /protein_id="ACZ07140.1"
FT                   /translation="MYHINEISKLINGKIIGEDNLEFSKLSPFFEADPEDLTFAADESM
FT                   LKNIAGTKAKAVIVPVMEEYPDGKAYIVLEQNPRNVLPILLNFFKPKMQKPEKQIEDSA
FT                   KISENVLIGINSYIGHNVEIGENTVIHPNVTIMEGVKIGKNSIIYSNAVIREFCVLGEN
FT                   VILQPGAVIGADGFGFIKDKNGDNVKIEQIGNVILEDNVEIGANSCVDRGAIGSTVVKR
FT                   GTKIDNLVHIAHNDIIGENCFIIAQTGISGSVEVGNNTVLAGQVGVAGHLKIGNNVVVA
FT                   AKSGITNDIPDNSKMSGYPLRPHMEDLRVKMSMGKVPELIKRVKKLEKLLKNEEK"
FT   gene            281449..282087
FT                   /locus_tag="Sterm_0256"
FT   CDS_pept        281449..282087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ATP-dependent RNA helicase ; K01509
FT                   adenosinetriphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07141"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07141.1"
FT                   /translation="MKKIFFLIIICLFMVSCGKQADNTVEKFIDNIKNKKIDAAMKYVK
FT                   NEDVAKNMEIMEISYKNKTQEAIFEALFKNMNYKVLQTKKESDELTIVKVEIENVDIKG
FT                   VFMRLFEETIQDMSAGGEGSKADDHSSLEKKLIEILNDKNVPKIKAVTEFAVYNTKEGN
FT                   KIELTPDNVNIMFGQISSLGGFAKSDETTEEKKTEPEDIQPKPQPMQKK"
FT   sig_peptide     281449..281511
FT                   /locus_tag="Sterm_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.383 at
FT                   residue 21"
FT   gene            282162..283403
FT                   /locus_tag="Sterm_0257"
FT   CDS_pept        282162..283403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0257"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pca:Pcar_2295 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07142"
FT                   /db_xref="GOA:D1AKX6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACZ07142.1"
FT                   /translation="MYDNVTEAKRCIACKIPFCEKGCPVSTPIKEIIQMYLGNKILEAG
FT                   DILFKNNPLSIVCSIVCPHEKQCEGSCILNRKSKGVEFGKIENEISNCYIDNVDFAIHK
FT                   LNDRKSRVAIIGGGPAGIAIAFILAFKGYDITIYESHSQIGGVLRYGIPEFRLPKVTID
FT                   KLEKKLMEIGVKIRPNILIGPTLTLDDIFNDGYGAIFIGTGTWNPRKLKIKGEALGNVH
FT                   YAIDYLKSPEYYKLGEKIVIIGAGNVAIDAARTMIRNGAKEVLLLNREGEAGITANRKE
FT                   FNDAVAEGVQVMNFKTVLEIKDDGVVIANTELTEKDGITDYSVDYDSERFYKCDSVVVA
FT                   ISQGPRSNIVSTNKELEINEKGLIVTNIDGSTTKKGVFSGGDVVTGAKTVVEAVKMSKI
FT                   IAEKMDEYMRNEYK"
FT   gene            283423..284316
FT                   /locus_tag="Sterm_0258"
FT   CDS_pept        283423..284316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0258"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: gme:Gmet_0041 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07143"
FT                   /db_xref="GOA:D1AKX7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX7"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACZ07143.1"
FT                   /translation="MGKLIKGVSKNARFFICDTKDMVQEAMDIHSCSPTGISILGRVLT
FT                   AAGMMGSDLKSENDSMTIRINGDGPAGTIIATANMKGEVKGYLSNPQVETDDHDSAHIH
FT                   IGKAVGNGTMYVIKDMGLRDPFSGLVQLQTGEIGDDLAYYFYTSEQIPSVVALGVKINK
FT                   DYKVSCAGGFIIQLLPGAENEFIDRLEEKLKAIRPVTELFEGGFDIYRIARLLYEDMGS
FT                   DEEGKLVEDYEILAESEITYKCDCSRERYLRGLITLGRKEIDSILEEDGGKMEVECHFC
FT                   MKKYEFTKEDFEDIEF"
FT   gene            284420..284905
FT                   /locus_tag="Sterm_0259"
FT   CDS_pept        284420..284905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0259"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sde:Sde_1113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07144"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX8"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ACZ07144.1"
FT                   /translation="MEDRFLYSEADDTIFIKIEGNATMKNSKTLSDLLAKIFKGEKKNL
FT                   VFEMSACNYLDSTFLGLIAKCALEIKKTWNSTLYIMNASNMVLSGLKQTGIDKFVEKIE
FT                   DSSLQLKTSELENQDFSDRKEKTLHILEMHKTLMELNEKNKETFQNVVNMIEKDLNK"
FT   gene            285204..286121
FT                   /locus_tag="Sterm_0260"
FT   CDS_pept        285204..286121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0260"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: hypothetical protein; TIGRFAM:
FT                   D-alanine/D-alanine ligase; PFAM: D-alanine--D-alanine
FT                   ligase domain protein; protein of unknown function DUF201;
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07145"
FT                   /db_xref="GOA:D1AKX9"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKX9"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACZ07145.1"
FT                   /translation="MSKLKIGVVRGGISSEREVSLKSGEGIIRELNKDKYDVKDIVLND
FT                   KNDIFTSLDGVDFVFLGLHGKFGEDGKIQAILETMDIPYTGCGVLASSLCMDKDITKHI
FT                   MRSYGVRTAKWISVREGEECDYSEAAAYLGEDIIAKPNSGGSSVGVHFIKNEQEFYEAL
FT                   KDIFTIDKEVMIEEVLRGVEISVPIIDGKVYPTLCIEPKAGTFFDYASKYEVGGADEYV
FT                   VEFEKELQDEINELTKTAYHAVKCEGYARIDFMLKDNKPYLMEINTLPGMTMTSLVPKS
FT                   LKHLGVSYSELLDKLIEVSLKIKR"
FT   gene            286145..286627
FT                   /locus_tag="Sterm_0261"
FT   CDS_pept        286145..286627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0261"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="PFAM: LuxS protein; KEGG: dps:DP0529
FT                   S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07146"
FT                   /db_xref="GOA:D1AKY0"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY0"
FT                   /inference="protein motif:PRIAM:4.4.1.21"
FT                   /protein_id="ACZ07146.1"
FT                   /translation="MELNKIPSFTVDHIKLEPGIYISRIDEVGGDYVTTFDIRLKKPNA
FT                   EPVINIAELHTIEHLGATFLRNDEEWKDKVVYFGPMGCRTGCYLLLKGRLEPKDILDLI
FT                   KRLWKFISTFEGEIPGAAAKDCGNYLDQNLPMARYEAKKYLEKMEKFTESNLAYPE"
FT   gene            286721..287476
FT                   /locus_tag="Sterm_0262"
FT   CDS_pept        286721..287476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0262"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: nam:NAMH_1201 deoxyribonuclease,
FT                   TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07147"
FT                   /db_xref="GOA:D1AKY1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY1"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACZ07147.1"
FT                   /translation="MKLADTHAHIYDEKFRDDFDEIMDRINNELDFVVSIGYDMESSEK
FT                   SIALSEKYEKIYSVIGFHPTEIKKYSEEAEKKLEELAKNSKVTAIGEIGLDYYWMEDPK
FT                   EKQMEIFRLQMELARRVKLPVVIHTRDAIEDTVKILEEYKDLGGIMHCYPGSYETAKKL
FT                   MDRYYFGIGGVVTFKNNKVTKETVKKLPLERIVIETDCPYLTPEPFRGKRNEPVYVKYV
FT                   AEKIAEIKEISLEQVIEVTTNNAKKIYSI"
FT   gene            287557..287883
FT                   /locus_tag="Sterm_0263"
FT   CDS_pept        287557..287883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07148"
FT                   /db_xref="GOA:D1AKY2"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY2"
FT                   /inference="similar to AA sequence:KEGG:mma_0138"
FT                   /protein_id="ACZ07148.1"
FT                   /translation="MEKNTKLMYILAIFIGLISSLIFFINAKSDEEKEAAKLSLNFEIS
FT                   FTIVAFIASFVIGFILGMVGLGLVAPLVSLAIWLYHAFIDFKAMKAVEEGKTPGFPINF
FT                   NLVK"
FT   sig_peptide     287557..287640
FT                   /locus_tag="Sterm_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.622 at
FT                   residue 28"
FT   gene            288055..288450
FT                   /locus_tag="Sterm_0264"
FT   CDS_pept        288055..288450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0264"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: pub:SAR11_1055
FT                   holo-[acyl-carrier protein] synthase (holo-ACP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07149"
FT                   /db_xref="GOA:D1AKY3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY3"
FT                   /inference="protein motif:TFAM:TIGR00516"
FT                   /protein_id="ACZ07149.1"
FT                   /translation="MEIIGIGTDIIEIERIKDAINNVKTFKGRVFTKNEIEHVEKRKNP
FT                   YPSYAGRFAAKEAVSKAVGTGFRGFNLVDIEIYNDELGKPYLKFYNDLEKIMEGVKFQI
FT                   SISHSKEYAVSTVILYKEDENKQRDII"
FT   gene            288930..289676
FT                   /locus_tag="Sterm_0265"
FT   CDS_pept        288930..289676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0265"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="KEGG: bba:Bd0187 iron-regulated ABC transporter
FT                   ATPase subunit SufC; TIGRFAM: FeS assembly ATPase SufC;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07150"
FT                   /db_xref="GOA:D1AKY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY4"
FT                   /inference="protein motif:TFAM:TIGR01978"
FT                   /protein_id="ACZ07150.1"
FT                   /translation="MSLLELKELKAKVEDKEILKGLNLNINKGEVHVIMGPNGAGKSTL
FT                   ASVLVGHPKYEISGGDIIFDGEEINDLAVDERAQKGMFLSFQYPEEIPGLTVEDFLRAA
FT                   KEAVSGEKQYFMQFHQELVEKMERLHIDPTYADRHLNVGFSGGEKKKNEILQMAVLEPK
FT                   LAILDETDSGLDRDATKIVFEGVQKLKNDNNALLIITHYNKVLDYLKPDFVHILMDGRI
FT                   VKSGGIELVEYIEKNGYQKMKEELGL"
FT   gene            289693..291105
FT                   /locus_tag="Sterm_0266"
FT   CDS_pept        289693..291105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0266"
FT                   /product="FeS assembly protein SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD
FT                   protein; KEGG: afw:Anae109_0903 cysteine desulfurase
FT                   activator complex subunit SufB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07151"
FT                   /db_xref="GOA:D1AKY5"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY5"
FT                   /inference="protein motif:TFAM:TIGR01980"
FT                   /protein_id="ACZ07151.1"
FT                   /translation="MEDRKKTYIADIERGVYDIKDEMKHEFTTKKGLTEEIIRTISKEK
FT                   NEPEWMLEHRLKSLEVYNSKPMPKWGADLSDLDVDDIIHYLRPDSKIMSDSWDDVPDYI
FT                   KNTFDRLGIPEAEKLSLAGVGAQYDSEVVYHSIHEELVKQGVIYTDIETALREHEDIVK
FT                   EYFMKLITMNDHKFAALHGAVWSGGSFVYVPKGVKVDKPLQSYFRLNAAEAGQFEHTLI
FT                   IVEEGADLHFIEGCSAPKYQKNALHAGAVELFIKKGGRLRYSTIENWSRNMYNLNTKRA
FT                   TVDADGVIEWVSGSFGSRVSMLYPMSILKGERARCEFTGITFASTGQYLDTGSKVIHAA
FT                   PYTTSNVHSKSISKNGGTALYRGLLRVAPNAHGCKSTVECESLMLDNESRSDTIPIIEI
FT                   HNDNIDIGHEAKIGRISEEAIFYLMSRGISKDEAKAMIVRGFVEPISKELPLEYAVELN
FT                   KLIELELEGTIG"
FT   gene            291118..292245
FT                   /locus_tag="Sterm_0267"
FT   CDS_pept        291118..292245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0267"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: similar to ABC
FT                   transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07152"
FT                   /db_xref="GOA:D1AKY6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY6"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ACZ07152.1"
FT                   /translation="MFNEDNIKELDNYQFRIDNFRKYSALSAPKWKRIAHNVEVPEDYK
FT                   KFGGVSVRNTEQDGLTVKDINEAFQDIEKYNNDNEYGLNEFFNSQMFSFYNSGKFIHIN
FT                   ERKKLEDTVCINYNFNKENNLLIDYNVIVAEDFSEGTVIINYNSEDDTEAYHNGMIKII
FT                   AKPNSKLKIIKIQNLNLNSYNFEGSKAEIFGNADAAIYSMEMGAKVNAVSNKSYLEENG
FT                   AKIEIWPGYLADKDRKVDLEYSVIFRGRDTSGIIEGRGAVKDTARKVFRGNLYFKKGAA
FT                   HSVGREGEFAILLDKGVRSDSIPGLFCDEDDVIGEHSASIGKVDEAKLFYLMSRGLSEN
FT                   NAKKLIIESSFKPILNSIDDTDMKNKLLEELEKRI"
FT   gene            292256..293455
FT                   /locus_tag="Sterm_0268"
FT   CDS_pept        292256..293455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0268"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; KEGG: mxa:MXAN_1156 cysteine
FT                   desulfurase SufS"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07153"
FT                   /db_xref="GOA:D1AKY7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY7"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ACZ07153.1"
FT                   /translation="MEIKKEFPIFDDENLHYLDTAATSQKPQVVLDSIERYYKNYNGNP
FT                   GRGSYKLVMDSTRIFEDSRKTVQRFLNAKEKEEIIFTKSTTESINLLAYSFGLEFINEG
FT                   DEIILGITNHHANIVPWQMVAKKKKAKIKYIYLHENGQFDLDDFKYKISRRTKLVAFSA
FT                   VSNVTGVVHPIDEVVEIAHNNGAYVLVDAAQALLHFPIDVLKSNIDFLAFSGHKLFAPM
FT                   GIGILYGKRQLLEKMPPFLFGGDMIEFVTEQNSTFAPIPNKFEGGTQNVEGAYGLSEAI
FT                   NYLNGIGYDQINKIEHDLEMKALFELRNLGFVTTYHTENVERVGVIAFNVNGVHSHDVA
FT                   FILDYYGVGVRSGHHCAQPLMNYLEIPSCCRASFGVYNDAGDVEKLIEGLRKVKEVFKL
FT                   "
FT   gene            293452..293898
FT                   /locus_tag="Sterm_0269"
FT   CDS_pept        293452..293898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0269"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   lpc:LPC_2694 nitrogen fixation protein (Fe-S cluster
FT                   formation) NifU"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07154"
FT                   /db_xref="GOA:D1AKY8"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY8"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ACZ07154.1"
FT                   /translation="MNLEKLYQQTILEYSSRKDLKREIESPTYIERGHNPNCGDDLTLE
FT                   IKLNSDNIIEDAAFLGNGCAISSASTAMLIDLIKGKSIEEAKEKTDIFFKMMGQKEKLN
FT                   SDEMKKLGDAVLMEYVANMPARIKCATLSWHSLKVIIDKNEESK"
FT   gene            294031..294543
FT                   /locus_tag="Sterm_0270"
FT   CDS_pept        294031..294543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0270"
FT                   /product="Domain of unknown function DUF1877"
FT                   /note="PFAM: Domain of unknown function DUF1877; KEGG:
FT                   dal:Dalk_5077 domain of unknown function DUF1877"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07155"
FT                   /db_xref="InterPro:IPR015068"
FT                   /db_xref="InterPro:IPR035944"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKY9"
FT                   /inference="protein motif:PFAM:PF08974"
FT                   /protein_id="ACZ07155.1"
FT                   /translation="MSCLGVLFSIDGSEAEKLKKMERGNIVEYIQEEIEEVYFNEKQEQ
FT                   TAELDKAWDAIHRAFCESELLFQHGEQPFSFVILDGEILYGDMEDEDDYIVSYKNAEQV
FT                   KSVSEALKNLSESEFREKYFKIDEAKYEYPLSEEDFEYSWGWLSNTFEFWHNAAKNNLS
FT                   VIFTVDQ"
FT   gene            294771..296108
FT                   /locus_tag="Sterm_0271"
FT   CDS_pept        294771..296108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0271"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   ank:AnaeK_3118 glutamate dehydrogenase (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07156"
FT                   /db_xref="GOA:D1AKZ0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ0"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACZ07156.1"
FT                   /translation="MDYIDSILKKVESRDGHEKEFMQAMKEVLKSLEPVIAKHPEYQEN
FT                   GILERLVEPERQIIFRVPWVNDKGKVMVNRGYRVQYNSAMGPYKGGLRLHPSVNLGIIK
FT                   FLGFEQIFKNALTGLPIGGGKGGSDFDPKGKSNNEIMRFCQSFMNELYRHIGLNTDVPA
FT                   GDIGVGGREIGYLFGQYKKIKNSYDTGILTGKGLEYWGSLVRKEATGYGLVYFMEEMLQ
FT                   EHDSAFEGKTVVISGSGNVAIYAHEKATQLGAKVIAMSDSSGYIVDKNGINLDTIKKLK
FT                   EVERRRIKDYLEFHKDAEFHEGFQGIWDVKCDIALPCATQNEIALEQAKKMVENGVIAV
FT                   GEGANMPCLDEAVEYFLANKVLLGPGKAANAGGVATSALEMSQNSMRLAWTFEEVDKKL
FT                   HEIMKNIFKEAKKAARDYGVPGNYVVGANIAGFKKVANAMLVQGVI"
FT   gene            296803..297729
FT                   /locus_tag="Sterm_0272"
FT   CDS_pept        296803..297729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0272"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sei:SPC_3669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07157"
FT                   /db_xref="GOA:D1AKZ1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ1"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ07157.1"
FT                   /translation="MKFAARINSFKSKGKTTLDIIREISKIEKVTHVDLNYPEHFENTD
FT                   FEELKNLLEEKKIKVNGLALRFRDEYKNGELGNTDKKIAEQAKQLCLEAIDTAEKLGAD
FT                   LVTIWLGYDGFDYSFQIPYEKTWSQLVKAFKEIASYNKKIKISIEYKPFQPRAFSMISS
FT                   IGTTLLMVSETEEENIGVTLDYCHMLMKGENPAYGLSLAAERKKLYGVHMNDGHGLNDD
FT                   GLITGSVTFIKTLEFIYYLKKYSYDGVIYFDTFPIRENGIDEVRKNIEIYEKLESLVEK
FT                   IGIEKIGNIVSGNDAVKAQNILLECLG"
FT   gene            297792..298886
FT                   /locus_tag="Sterm_0273"
FT   CDS_pept        297792..298886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0273"
FT                   /product="RbsB protein"
FT                   /note="KEGG: msu:MS0201 RbsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07158"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ2"
FT                   /inference="similar to AA sequence:KEGG:MS0201"
FT                   /protein_id="ACZ07158.1"
FT                   /translation="MKKLVKLLTLVFVTSVLFTACSDKNKETGEGNKENKPQQTEAFNP
FT                   DSDPNGVEFSEIREKLGAMPKVEGEIKLGSVAKAFENEYWRTLKEGEELGTQKFKENGY
FT                   NITLDMKSAQGEGDEQGQLSIVEDMINKKYTALLLSPISDGNLVPGVEKAKKNNIPVIN
FT                   VNDGIIKNADIFVGPKAIMNGELAAEWISKKIGGEGEVAIVIGMPKAFAARQRTLGFEN
FT                   WMKSNAAGVKIVEKQNADWDRAKAKDLAEIWIKKYPNLKAIFCNNDVMALGVQEAVNAS
FT                   KRDILVVGVDGIKEAYESIRKGEMDATVDSFPLYKGQIAVEMALRSLGGQQLPRVIWTP
FT                   QALIDSTNVNEPSEKIINWKEPVF"
FT   sig_peptide     297792..297860
FT                   /locus_tag="Sterm_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.761 at
FT                   residue 23"
FT   gene            298918..300414
FT                   /locus_tag="Sterm_0274"
FT   CDS_pept        298918..300414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0274"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: atc:AGR_C_5112 ABC transporter protein, ATP binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07159"
FT                   /db_xref="GOA:D1AKZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ07159.1"
FT                   /translation="MNDSIIKFDNVGKQFPGVKALDNINFNVKKGEVHALLGENGAGKS
FT                   TLLNILHGVYNIYDGDVWIKGEKINFKSAHDAIKYGIAKVHQEVSLVNELTVGQNIVLG
FT                   YEPKKGIFVDHKKLHEEANKILKRLNCRFKSEDSINGLSAGEMQMIAIAKALYHKAEII
FT                   SFDEPSSSLSNNEVEILLNIIFELKKQGITILYISHRIDEIFKVSDRVTVLRDGKYVNT
FT                   FETEKIDQKTLIKNMVGRDVAAFAVRNKKRCATDEVVLEVRNLNKNGVFENISFDLHKG
FT                   EILGFFGLVGSRRTDVMRTIFGADKKSKGTILIKGREITMKTPKQAVENHIALIPEDRK
FT                   KQGFVKELSNAENIGLSCLKKFTKYGFIDHKKKIKNSEHFIEEMNLNPKDPEYKTFNLS
FT                   GGNQQKVVISKWLSTEAEIFILDEPTKGVDVGAKAEIYRILEELVSQGKSILMVSSELP
FT                   EIIGMSDRVIIMNEGKKQKELSYTEFTEERILNYAIGGNK"
FT   gene            300411..301382
FT                   /locus_tag="Sterm_0275"
FT   CDS_pept        300411..301382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0275"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: msu:MS0199
FT                   AraH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07160"
FT                   /db_xref="GOA:D1AKZ4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACZ07160.1"
FT                   /translation="MKSIKLGRESGIVVALVMMIIVFSLIDPIYLSSSNIVDIVKQSTI
FT                   NGLLGIGITLAIITGGIDLSIGSTFAIVIVSVGKLLVSGVNPFLAFAIGIILGFSLGIV
FT                   NGILVAKVKLQPFIATLGTMSIYRGVAYIITGGWPVLDIPENFRKALDGDIFGVIPSSV
FT                   VLLFVVGIIIWIILKYTRFGNYIYALGSNEEATKLSGVNVDFNKMMAYAICGVGAALAG
FT                   MVLLARLGTGEPTAGQGYELNAIAAAAVGGTSLMGGKGTMLGTILGTILLSALRVGLIV
FT                   VGVDSFWQYIATGIIIVIAACFEIIQNKISSIKVSRSKLSKA"
FT   gene            301430..302344
FT                   /locus_tag="Sterm_0276"
FT   CDS_pept        301430..302344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0276"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sei:SPC_3671
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07161"
FT                   /db_xref="GOA:D1AKZ5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ5"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACZ07161.1"
FT                   /translation="MKEKKAVIIGSLNYDIILKQKRLPKIGETFVADSITMCGGGKGAN
FT                   QAVQLSKLGGKAFMAGCVGNDKFGEELLSNLQKHNVNTDNVKLSEKNNTGMGIVNVFDD
FT                   GKLIATITRGANYDITNSDIDKIKNEIISAQIIILQMEIPIEVIEYVINLASKHDVYII
FT                   LNAAPACEIKEEVLSKVNCLVVNETEASFYLNKEINDVKSSIENCEELYGKIKDLLIIT
FT                   LGENGSLLYDGKEKLHIKARKAEVTETTGAGDSFIGAFAYKLLNDSSYKEAAEFASLVS
FT                   SITVTKIGAQDSMPTYEEVKKFL"
FT   gene            302402..303139
FT                   /locus_tag="Sterm_0277"
FT   CDS_pept        302402..303139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0277"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: kpn:KPN_01704 DeoR transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07162"
FT                   /db_xref="GOA:D1AKZ6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ6"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACZ07162.1"
FT                   /translation="MIPYLRKKRILDELEKKEIVYLEHFVDILYEVSESTIRRDLKILS
FT                   DEGKIILLHGGAIKLKKNSKEVPVVSKKLMNVKFKERIAKYASSLVQNGETIYLDSGTT
FT                   TELMIKYLKNKDITIVTTNTQILNQLEDTKFECILIGGEIIKNLGSTVGVLTDRMLSEF
FT                   HFSRAFLGANGYSEVNGVSTYDLREANKKRIVKRNSDNTYVLLDSSKIGKNAVCKVFEL
FT                   EEIELITDKMNDILRKYKNYIIV"
FT   gene            303835..304044
FT                   /locus_tag="Sterm_0278"
FT   CDS_pept        303835..304044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07163"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07163.1"
FT                   /translation="MKKTVIGALMVISILTLGAEKGKTTEPAVPDFEAQMEKADKIESY
FT                   KAKKDSAWHKNEYKKVLKYLKKKK"
FT   sig_peptide     303835..303891
FT                   /locus_tag="Sterm_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.566 at
FT                   residue 19"
FT   gene            304055..304345
FT                   /locus_tag="Sterm_0279"
FT   CDS_pept        304055..304345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07164"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07164.1"
FT                   /translation="MKKALMICAAGTMIFVSYSAENTAPEVSKAVEDRITKDYDQDGVY
FT                   SSYEKALRRAQGSIYVTLPEKRGEWYSTLDKIKEEEKELMPDEEARMRRKR"
FT   sig_peptide     304055..304114
FT                   /locus_tag="Sterm_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 20"
FT   gene            304349..304618
FT                   /locus_tag="Sterm_0280"
FT   CDS_pept        304349..304618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07165"
FT                   /db_xref="UniProtKB/TrEMBL:D1AKZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07165.1"
FT                   /translation="MKRLGIMSVLCVAAGIWASAASTYEYKRELREGARGKWINLRQHL
FT                   NSGTRLEKELIKVDRQIDKKAAEIKEIEDLLFKIEQYKAENNIR"
FT   sig_peptide     304349..304420
FT                   /locus_tag="Sterm_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.662 at
FT                   residue 24"
FT   gene            304628..304801
FT                   /pseudo
FT                   /locus_tag="Sterm_0281"
FT   gene            305086..306861
FT                   /locus_tag="Sterm_0282"
FT   CDS_pept        305086..306861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0282"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; Hemolysin activator HlyB domain protein;
FT                   KEGG: ara:Arad_4755 hemolysin activator protein hec"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07166"
FT                   /db_xref="GOA:D1AL00"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL00"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ACZ07166.1"
FT                   /translation="MKKKIIAVFLLGSIVFSAGVGDIIERNNAAIENERRQQELERRQK
FT                   ELERENFGKEPQIIDGTGEVDTSVRFFIRKIEVQDEYNLLSKAEIKAVIKKYLNRKLSS
FT                   KDINKLMTELNNKYIEKGYITTRVRLDETQNLSEGTIRLITLPGTVEGASLNENTFSDR
FT                   MKVFMSVPKNKKRILRLQDTEQATDQFNRVSSNNVEIKIAPGQEAGGSILQIENQQTRT
FT                   FNANISYNNYGDESTGRDRGKIDITKDNLFGINDSFYASYQRGRNKRPLRNDYTGSSSI
FT                   PPGTIIKDKDDLLPADTEAEPEKFNEDWSLNYSFPFRYWTFSTGYSHSYYISSSEGYNG
FT                   LYDTSGRSTQFNLNADRVVYRNKMSKISINGGLKLKTNQNYFEDVQLVDRRLTIGSLGI
FT                   NYSRGFFGGILGFDVSYDRGLPWFRSADDHEKEIYDPKGRFDKYGLNINWYKPMTIGKQ
FT                   RFTYRLVGVGQYTQDVLYGSEKISMGDEYTIRGYKGDSISGDKGYYVKNELSYNLNISK
FT                   IGSISPYIGYDFGESWNNEVHDIYRYGYMRGFAVGVKYYGEIFNFDIAYTKPDKASGYV
FT                   SKPEDEVYVTFGIKF"
FT   sig_peptide     305086..305148
FT                   /locus_tag="Sterm_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.609 at
FT                   residue 21"
FT   gene            306883..307320
FT                   /locus_tag="Sterm_0283"
FT   CDS_pept        306883..307320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07167"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07167.1"
FT                   /translation="MKKHIFLVMLILVLSFQLNAKKITNKVLVYSTAENLTKEEVAVLG
FT                   ISKDVTLIEINKSKFKVNGDRVYIAPGRHTFQVKKPLSITYDGELSATLEAGKYYVLDT
FT                   WTEPAGGRYYRVIYKVFEVSEGDFENYNRKVLNKLIKESKN"
FT   sig_peptide     306883..306945
FT                   /locus_tag="Sterm_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            307348..315303
FT                   /locus_tag="Sterm_0284"
FT   CDS_pept        307348..315303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0284"
FT                   /product="adhesin HecA family"
FT                   /note="TIGRFAM: adhesin HecA family; PFAM: filamentous
FT                   haemagglutinin domain protein; Haemagluttinin
FT                   repeat-containing protein; KEGG: nme:NMB1768
FT                   hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07168"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL02"
FT                   /inference="protein motif:TFAM:TIGR01731"
FT                   /protein_id="ACZ07168.1"
FT                   /translation="MKRGKRYNIVKRNIAVGLLLGMLNSMLFADIKVDKNVPQKTSVDR
FT                   AQNGANIVNINTPNGRGISVNDFSEFRTKDPTVFNNFGQGVGRSYLAGMMAANPNLTKE
FT                   QAARLILNRVGGNNRVEIENWLEVMSENKTDIIFSSQNGFYLNNTGFINFDKAIFTTSR
FT                   VDLDGNGDLLPFNIRGGKIEIGREGINAEGVRYLALLSRQMYIDGQIYAKDADINLIAG
FT                   DFDYNPHTRDYTKQGVNNNELLISSSAFGSIYGNQIKIVGVNGNIGVAGDVISERVLKI
FT                   NADGTIVTNKTQAKEAIEIKAKEFVQEGSIYTEGKLTIEANKTTLKGSGTQASEIEISG
FT                   NLDNNSNLYSTGNVTVGKDVKNKGQIISENDLDIKGSLDSDNLVYGKNEIRVGKSLVNR
FT                   SDIQSEGNITVSEDTINTGRILSDKELNIKGNTVNQGTLYGKDNVKIEKNLNNTGSVQT
FT                   TGELRAKDTANTGKLTVEGNISTDNLDNNGEIITNKKLVTKNLENKSTGKITTGEGIDT
FT                   AGNAANHGQINTNGSFIIFSNLENYNVINVGGLVSTKDLTNTGTLKVSDKIVSKGFSFT
FT                   NTGEIVTVNLDVDSTNIMNTNKITVVETSKLKGSSNVNNQGIIASKNIEITTPVLINSG
FT                   QILAEEVITANNTSLTNTGKLASNGSINLNNTSIVNRSSIESTIVNLQNVFSYDNNTGI
FT                   IRGNNITLTSSGNLLLEGKIQGINNLLISGVDITNNGNTISSGLLRLSGRDITNNLTIS
FT                   ASNVELLATGNILNNSMIEGERGKLSGNNITNKDLIVFLDKLDIEGTKFVNKDASVYSD
FT                   NELNISTGDVDNTGGEIVGQSTLNITGFNLLDNTKGIIDSRGNILLSGNKLLNSGEVSG
FT                   QYRLYWETWDGRIIYDDVWRNLDDTYTLTGNSSLITRLNEWIFSEGRSNMQGWGINPKD
FT                   ELDDINNDLDYKLYYGNLTSSQLNPTKNYMTQVLTGYIDTSRLVTEGGRILSGGNLTLD
FT                   VIELENVNSKISSGGTLRITDKVQTIKNETTASTIKVYDGEEQVKTWELHWTAGNGDTR
FT                   TGAALGVRRDLKTAGRDVNIADSVSVIEGNNVIIEGSPVISNGYVIQSGAVVDPSTITS
FT                   KDVDVDLYYDPVTVHVDRTAVIDIITTGTIPFNPGVFNSSVSKLFSENKDPSSKYLMET
FT                   RSQYIDLSRFYGSDYFLSRIGYNESNDWNNARRLGDAYYETKYMNNLLLETLGTRFING
FT                   KADTELMKEMLDNAVATSGDLQLTIGIALTGDQIAALKSDIIWYVEQEVNGEKVLVPQV
FT                   YLSQATLENIKSPTTTISAQETLAINSSSLVNQGRLEGNTVYVNTDNLINKSVGALTAE
FT                   ITGTNIQIDAKNDILNIGAVIAAKENVVLTAGGTISNITTGVQVIEHDRLRGEERSYTA
FT                   DNIQNVGVISSGDTTYISGENYVSRGAVTQSEGTTYIEAEKDISINTINLRESEREGIK
FT                   NGYQYTEVNQKLGSEVTGLDNVIMNAGNDISIKGSTVVSDGTVQLTAENNINISNDKNT
FT                   MYHEEKEEKKGTFSSYYRYETDYSESAVGSTLIGNNVILDAGKDVNIKASNVIAVKNDN
FT                   IQNSGGNIIVTAGNDINITTDDMNNEYSLTEKRSGFSSSFSTGGGGISAGVSYSRSSLE
FT                   NERNSTTVAVSSLMSEGSTVLDAGNRVRTEAMQADIGENLVIRGVNGVELLDAKEVYEE
FT                   KVKQKSTSIGLSVSVGSTVTSFIDQANNMYNDKDKYGATNTSELINSAGDGFTLFRSGV
FT                   SAFNDAQSIYDKLVTGIHPANALAGITANASLSFSQSSYESNTNSTTSVAGNINVGKNF
FT                   VIESDGDVRLINQKVNVGENFIVDAKNFEARAGENTYSNNTKSSSSGGNIGYDFAQRTM
FT                   TGGVNVSGGKSNTDSKYYDNTIINVGGIFQLTTKEDALFAGANVTADKINFDIGRDLSI
FT                   ISLQDEYKSEGKNYGIGGGYSQNNTTTNKPEPGAFTGNISYSQNNAESKWVSNQTSIIA
FT                   ENGGNIKVGETLTNIGSIIGSLNADEKLSIEANKVVVSNLEDYNRGENAGVNVGGIGFN
FT                   NKAPIGQTGVQYGSHDKEQESNATFVNTEVTEAGKKLNLEELGINTDINKAQIVTKDEV
FT                   VEQIDTNLHTDLLNTTTRQQFMEDTRKAGHGILDIIDSAGRDNLRYEEARTDRYAQYYI
FT                   EKNPQMAEFIKDPDSKSAADIEKLTKDYIKYMTGKDVEVIIVATGEGSGYIRGDQKGKG
FT                   KDNVFLLDLNDLASGMSVSNLYGHEPNHIDDHRRGREAGEEIASNAAGDRLSEILGDKG
FT                   KSNVFDIDKWLDNKDNLQAIQDGKNTLDSEYDGYEGENSSYLDQRTREAGSIASTKSVA
FT                   SKKLENKKADLAKLTNEYQQKCSGRQLSGCSSILNQISSLEKEIKYLQGVATTGQGSVH
FT                   DSETKSQKTPNNTQNAGNKPSNKPNNNTSSKAEANSAKKIKTKEELVSEMYSKGYTPDQ
FT                   YEIREEKGGVLRVVLDSYKTPDNLNYDDTNVIVWNKGLDIPLKVADAYLKADNASMILT
FT                   QGHLTDTFGPVLSGGLINKFGPNSGWGSVKDKTELSGNSNYKKLTNEEIKKVGSLSEQK
FT                   DIRELPGNSEDALKFFQAQVSDYKEVKPGVFVGKDENGITFTYRAQSKSGPPTIDVNGI
FT                   KGIRKIKFKE"
FT   sig_peptide     307348..307437
FT                   /locus_tag="Sterm_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            315326..315856
FT                   /locus_tag="Sterm_0285"
FT   CDS_pept        315326..315856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07169"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07169.1"
FT                   /translation="MEMKRLKDLYKKIFSNNDPFNNVFNNYIEKKILIFPTEGYYLSKD
FT                   QYDNLIKVLDFFLEKEIFISEIENGEESFENTVEYCFNHNRIELKTSYEEYLKIPVFLE
FT                   NILYSTTAKWGMMISHENHALLGGSSKFIQKFLENYNYLEDKEKFLRYWHYNKQNYNSD
FT                   LNWQKEFFKYYDV"
FT   gene            316287..318629
FT                   /locus_tag="Sterm_0286"
FT   CDS_pept        316287..318629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07170"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07170.1"
FT                   /translation="MQANVGEDMIIRGVNGVELLDAQEVYNEKVKQESKSVGISASLGS
FT                   TITNFISSADEKSQNNGKYEFGNRSELINTYGDGLDLYREGVKAGADLSQLVVDGMKGS
FT                   YGSLAGYGVTANVSASINKSKYESNTSGTSSVAGNINVGGNLVISSEGDVKLVNQKVNV
FT                   GENIIVEAKSFEALAGKNTYNNTTDSSSQGMSAGYDFTGGTVTGGVNGSKGNSNSSSVY
FT                   YDNTVINAGGTFQLTTKEDATFKGANVTADKIDFEIGGNLNVISLQDEYKLNGENKSGG
FT                   INYGHTEQSDGKSYNSPSGNLSYGESKGDSKWVNNHTSIIAENGGSIKVGETLTNVGAI
FT                   IGSMNDSVRIEAKEVVVENLKDHDNGKGYNVGLSGVDRKNVVPQTELQYGSHDKEQDTN
FT                   ATFVNTVVIENGKEINLEERGINTDIEKAQVITKDDVVEQIDTVLHTDLLNKEKRKELV
FT                   NDLNTIIGNLGDIKNEVANIYDTAISKIANNDKNLTAEEVEIYLAIESLNGISYDIEEN
FT                   ATKYLNDLKAYAKKNNMDYSTLSAGGLVDEIINIKDKYDSENMVDYSREDKIRLVVLFD
FT                   SLNQKDSSYQKMTEKVIGKVFNSLVTTNEYKELAQNWSEAYNNSDKEKMNQIYGKYGEL
FT                   IDKKIKDEFGISLKSDYMILHSGETQLVFGNDTFTPANNLYGAYIPGVNTNVINLNYND
FT                   EKFNLGLLDDINTISKHEIGVHNFYNTLFNSNSSTTNRIIKNNKLERYEKISKMKIQLP
FT                   KNFDPLNTILYLIEPEEAIARHAEKFN"
FT   gene            318610..319161
FT                   /locus_tag="Sterm_0287"
FT   CDS_pept        318610..319161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07171"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07171.1"
FT                   /translation="MRKSLIKICVIYVLVLSLTIANSKYIIMDIGNDPYATSGSLITSN
FT                   EIETLKNVKKIGFIEVNDEEKIEKVYFFDDKKYQVIEEFKEGDTINIDKFKEFNQKSIE
FT                   EYNKFRCFGIPCSKPEIYNEDESELWNFIKYLYRASTRIVVLTDREYLKYLKLKNNEEK
FT                   VRLLKEKIKDEVMYDTSKKI"
FT   gene            complement(319282..320580)
FT                   /locus_tag="Sterm_0288"
FT   CDS_pept        complement(319282..320580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0288"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: gur:Gura_1571 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07172"
FT                   /db_xref="GOA:D1AL06"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL06"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ07172.1"
FT                   /translation="MTLILVFEIFVLFLAFIFHEKITILLSFLAIFLIFNFLLYSLYIS
FT                   KEREIEFLKENIINIIDDNFTLNIDYYINNKSLDFFQKIFNIKKETKNYKKNLEKESQK
FT                   LKEILRAIDDIIFVINNNEIILKNKNVDILTYNSKSKKFFDTIKYNSLIKKIKDILISK
FT                   ENIKEDFFLTELNKYYLIESYRLETEPSIIISLRDITITKNFEKIQKDFISNVSHELKT
FT                   PLTNIKGYTIALEESIENKDDNVKNFFKIINSNINKIDNLIYDFLNYSKYEGFKILNLS
FT                   YIKAEELINETLFGLTLLINNKNAKIQTNFMLFDENHYIYIDVEKIKLVMKNLIENALI
FT                   YSSKKPEINIEILEDENSYIFKISDNGLGIPEEERDKIFEKFYRVDKSRPMNFSGSGLG
FT                   LSIVKEIVHNYNGEIKLTSESGLGSTFYVIIPK"
FT   gene            complement(320577..321275)
FT                   /locus_tag="Sterm_0289"
FT   CDS_pept        complement(320577..321275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0289"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: dol:Dole_1930 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07173"
FT                   /db_xref="GOA:D1AL07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL07"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ07173.1"
FT                   /translation="MKKNTILVVEDDLEIKTLIQFFLEKENFNVITAQNSGKALEMLQN
FT                   NKPELVILDIMLPGLNGLEIAKLIKKESHKYGTPFIFMLTAKTETEDVIDGFQAGCDDY
FT                   LRKPFDPRELILRIKKLLSLKKEGFAPEKESGLLRYDQIEINLDKHTVTESGNEVILSN
FT                   KEFRLIAFLIQNKGLALSRETILSRVWNENYHLGDRTIDVYVGKIREKLPSISENIKTI
FT                   KGVGYRLKEI"
FT   gene            complement(321300..322004)
FT                   /locus_tag="Sterm_0290"
FT   CDS_pept        complement(321300..322004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0290"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein; KEGG: dat:HRM2_02440
FT                   PhoU2"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07174"
FT                   /db_xref="GOA:D1AL08"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL08"
FT                   /inference="protein motif:PFAM:PF01895"
FT                   /protein_id="ACZ07174.1"
FT                   /translation="MRNLDERMEDIRTLISEALKNCKRSLAIIRTILNSGTFDRALYGE
FT                   AKSIEETMNHTELKIDEEVITTIARFQPMAINLRFLIGVIKIGNATERINDLALNILKV
FT                   LKHSENIKSLEKQSILEMHTKVEQMFDLFLKCYYEEELNYAYLILSLDDEVNAYKTNVI
FT                   EATKKIMNDRNGSEKGENKDIYLGALFISQHLERIGDTIKNLAEIVIYIYNGIDIRHID
FT                   YEEEKITLKRKK"
FT   gene            complement(322024..322827)
FT                   /locus_tag="Sterm_0291"
FT   CDS_pept        complement(322024..322827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0291"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: dvm:DvMF_0881 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07175"
FT                   /db_xref="GOA:D1AL09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL09"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACZ07175.1"
FT                   /translation="MSEAKLDKPVINNDNGLTNIISVRNFNFFYGDFQALYDLNLEIPK
FT                   NNVTALIGPSGCGKTTFLRSINRMNDLIDTSKYEGDIIINGKNIFEPGYDVVELRKKVG
FT                   MVFQKPNPFPKSIYENIVYAPRLHGLRDKNKLMEIAEKSLKAVALWDEVKDKLHKSAMG
FT                   LSGGQQQRLCIARAISIKPDILLMDEPTSALDPLSTSKVEELMRELEKNYTIVIVTHNM
FT                   QQAARISDFTAFFYKGVIEEYDKTSTIFTNPSNKKTEEYINGKFS"
FT   gene            322992..323843
FT                   /locus_tag="Sterm_0292"
FT   CDS_pept        322992..323843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0292"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: erg:ERGA_CDS_05480 SfhB
FT                   protein homolog (peudouridylate synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07176"
FT                   /db_xref="GOA:D1AL10"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL10"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ACZ07176.1"
FT                   /translation="MKKFKIEKEHHGYKISEYLREIQNYSGRGLRNIEVFLDGKKVRTT
FT                   QKIRKQGLLKVVEKEKGTNIKPIKIPLDIVFEDEDILVVNKQPYLVTHPTKKKVDVTLA
FT                   NGIVYYFQEKYGKEMVPRFYNRLDMDTSGLIIIAKNSFTQAFLQNFGDVKKYYMALVHG
FT                   IIKEEMINIEKPIARVGDDLRRKILDEGQYAKTVVKTIKRNEEKNITLTECELFTGRTH
FT                   QIRVHLSNEGYPILGDKLYGDMDDNVKRQMLHSYKVSFIHPRTKERKELEIEMYDDMKE
FT                   FM"
FT   gene            323929..324555
FT                   /locus_tag="Sterm_0293"
FT   CDS_pept        323929..324555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0293"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   gbm:Gbem_0301 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07177"
FT                   /db_xref="GOA:D1AL11"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL11"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACZ07177.1"
FT                   /translation="MRVIAINGSPHKNGNTYESLAVVTKELEKQGIETEIVHIGNKVIR
FT                   GCTGCNYCQKNEQNNCVFNEDTVNETALKMAEADGIILGSPVYYSGIAGTMKSFLDRVF
FT                   YSKSQYFRYKVCTAVAAVRRSGGVDTFHQLNNYFNLGEMIIVPSHYWSVIHGRRPGEVL
FT                   QDEEGVQTLREAGKSMAWLMKSLDHAKDTVEKPEKEERKWTHFIR"
FT   gene            324722..325489
FT                   /locus_tag="Sterm_0294"
FT   CDS_pept        324722..325489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0294"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ccv:CCV52592_2023 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07178"
FT                   /db_xref="GOA:D1AL12"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL12"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ07178.1"
FT                   /translation="MKYTVITGASTGIGYEAALAFAGKNKNLIIVARNKEKLEHLKEEI
FT                   KKINPDLDVIIKVSDLSVGENVYKLYEDLKKYTLETWVNNAGFGNTGLVKDQNLEKIEA
FT                   MLHLNIEALTILSTLFIKDYSDTEGSQLINVSSVGGYSVVDNNVTYSATKFYVSAFTEG
FT                   AAQELKKRGGKMQVKVLAPAATETEFANTAMGIDGFDYEKSTPRFHTAKEMAEFLMKLY
FT                   ESDKSVGIVDIQTYEFKLTDPVFNFRQSQTEKH"
FT   gene            325726..326199
FT                   /locus_tag="Sterm_0295"
FT   CDS_pept        325726..326199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0295"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   azc:AZC_3294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07179"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:D1AL13"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ACZ07179.1"
FT                   /translation="MKRFIYILGLLILSLTSFSNALVQKNISLDIAQNLASEVLKEAKK
FT                   EKVNISLVILDKGGNVVLSMKEDNAAVHTMKTAQKKAFTALSFGITTTEFASRVEKVPN
FT                   LTQIENTTTLGGGIPIKAGNETIGSIGIGGAPSGAIDEKIGSAALSRISNLLK"
FT   sig_peptide     325726..325791
FT                   /locus_tag="Sterm_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.773 at
FT                   residue 22"
FT   gene            326347..326472
FT                   /locus_tag="Sterm_0296"
FT   CDS_pept        326347..326472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07180"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07180.1"
FT                   /translation="MMCYNMLQILKLKNMKQRGVLFMLNKVLTDSVLRKEGTEKR"
FT   gene            326526..327602
FT                   /locus_tag="Sterm_0297"
FT   CDS_pept        326526..327602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0297"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: cak:Caul_1373 ribosome small
FT                   subunit- dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07181"
FT                   /db_xref="GOA:D1ALR3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR3"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ACZ07181.1"
FT                   /translation="MYLNLKKYGLSDRFEQEASLYNNLFPARIIEQHRDLYKVVCEHGE
FT                   LIAGISGKLAYHAEDQMSFPAVGDWVMIDRTDNNSGNAVIKNILGRKSVFVRQTAGTSN
FT                   EQQIVAANIDIIFICMSLNSDFNIRRIERYLAVTWDSMATPVIVLTKSDLCDDLQEKLD
FT                   ELSSVSIGIDVIVCSSEDENGYQAVSSYIEKGKTIAFIGSSGVGKSTLINRLAGDENQA
FT                   VQEIRKGDDKGKHTTTYRQLKLLPNGGIVIDTPGMRELQLYTGDISKTFEDIEELAAQC
FT                   KYKNCSHVSEPGCMVRNAIENGILSEERFGSYLKLQREMEYSNLNSRQTEQEKINRMFG
FT                   SKKEMKNVMKHLKGRKNR"
FT   gene            complement(327721..328101)
FT                   /locus_tag="Sterm_0298"
FT   CDS_pept        complement(327721..328101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07182"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07182.1"
FT                   /translation="MKKFLLLGILMISVVSFSEILTGSFVSKIHQISGEVSLETTGKEI
FT                   TISNFTYDGNGKNVYLILTKDGDFKDMKIISKELKKGYVNETLTLKVNNLQKLIDEGYN
FT                   TVSVYTKTNKSTFGDASLSEVQ"
FT   sig_peptide     complement(328045..328101)
FT                   /locus_tag="Sterm_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.986 at
FT                   residue 19"
FT   gene            complement(328194..329426)
FT                   /locus_tag="Sterm_0299"
FT   CDS_pept        complement(328194..329426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0299"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: gsu:GSU1605
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07183"
FT                   /db_xref="GOA:D1ALR5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR5"
FT                   /inference="protein motif:TFAM:TIGR03150"
FT                   /protein_id="ACZ07183.1"
FT                   /translation="MKRVVITGYGIISALGNNVDIFWKNIAEGKSGIKLIEDPEFSDIP
FT                   TRIAAYIESFDAEKYMNKKDINKTDLFTQYAYAAAAQALESGGVSDNTFDKNRVGIYIG
FT                   SGVGGLDTILKNHRIFLEKGSRRVSPFMVPMMITNMAAGFISINTGFKGPSFSPVSACA
FT                   TSNHAIGEAFLSIKHGYTDAVLAGGAEAPINPLTFAGFSNMKAMSRNNDHPLESSRPFD
FT                   KDRDGFVIAEGAGILLLEEYEHAVKRGAEILGEVVGYGATSDAFHMTTPDFHGAERAMS
FT                   LALSMAEIQPSRVNYINAHATSTKEGDISETNAIKSVFGENAKNIKISATKSITGHLFG
FT                   AAGGAEAVITLKAIENGLVPPTINLKNPDEKCDLDYTPNTAVKHDIEYAVSNGFGFGGH
FT                   NASLLFKRFDK"
FT   gene            complement(329427..329981)
FT                   /locus_tag="Sterm_0300"
FT   CDS_pept        complement(329427..329981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0300"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eum:ECUMN_3348
FT                   conserved hypothetical protein, putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07184"
FT                   /db_xref="GOA:D1ALR6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ07184.1"
FT                   /translation="MISTKDKIIEYSIKLIKTKGYSSFSYDDIAQKLKISKAAVHHHFE
FT                   KKEDLGIAVCQYLQSKIEDGSGKILKQGLHPWIFAETRINTIKSGEICPISSLQSDFDQ
FT                   FSPKLKKELKKTTEMEIEHFKKLVEKYAPGLTDYSQAVNSYLALKGALQYRRILGEEFY
FT                   KESVMSIKKEFYDFLDKKESN"
FT   gene            330175..330969
FT                   /locus_tag="Sterm_0301"
FT   CDS_pept        330175..330969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0301"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: gur:Gura_3505 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07185"
FT                   /db_xref="GOA:D1ALR7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:6N1N"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR7"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ACZ07185.1"
FT                   /translation="MEILFSFLLSFVFSVNTMVSNSNVNLQKIFDENKITGSVTIYDYK
FT                   NKIWIYSNEEDSKIRRLPASTFKIPNSLIFLEEEVVKDENEAMEWDGIKRYIENWNKDL
FT                   NLREAYEYSALWFYMKGAGKIKSEKYKEYLKEFNYGNQIVSEKKNSFWIDRSLKISPEE
FT                   QIDFLINLYEEKFMLSEKTYKIVKDIMINEKTPEYTLRGKTGWGREGAENIIWYVGYIE
FT                   AKENVYFFAVRIINASEERNSYLLDFRKQLTMMAFRELGIIN"
FT   sig_peptide     330175..330234
FT                   /locus_tag="Sterm_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.381 at
FT                   residue 20"
FT   gene            331244..331594
FT                   /locus_tag="Sterm_0302"
FT   CDS_pept        331244..331594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0302"
FT                   /product="ribosomal protein L19"
FT                   /note="TIGRFAM: ribosomal protein L19; PFAM: ribosomal
FT                   protein L19; KEGG: sfu:Sfum_3044 50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07186"
FT                   /db_xref="GOA:D1ALR8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR8"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ACZ07186.1"
FT                   /translation="MKEKLIELVEKDQLKTDIPEFKAGDTVAVHYKVKEGNKERIQVFE
FT                   GVVIRVSGGGISKNFTVRKVSSGVGVERIMPINSPLIEKIEVKRIGKVRRSRLYYLREL
FT                   SGKAARIKEIRK"
FT   gene            331653..333137
FT                   /locus_tag="Sterm_0303"
FT   CDS_pept        331653..333137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0303"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: rbo:A1I_01370 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07187"
FT                   /db_xref="GOA:D1ALR9"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALR9"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ACZ07187.1"
FT                   /translation="MNLVLWGVFYVILTGILLYFFIKEKVIVEWLKEKEKNIADRLASK
FT                   GDLGKMKKTADIITVVHIIILALLFWKIMDSGQDLDFSFKRNIIMVVFALNAGVLILRK
FT                   KQEWAFVVNALLLVLGRLMMDMQGIYLYSYLALGCVLFLVEIYLYQSQIFEAVHLIETS
FT                   ITAVVIVLLIQNFYLGNFMIPTGSMRPTIIENDRFFANMISYKFQDPKRGDIIAFKEPK
FT                   DNKLLYTKRLVGLPGETLSIDDNGELVINDNVIEMKAHLIGQGKKALTVTNEGLVVILQ
FT                   NGYDNRTGTVYDEVINFKTNLEGKEGTPIQVDKKGILFSDGEMLDTRVFYRKEGFLGFA
FT                   GKIYIPKKDDVVKLGKIYKMIIEQEISTQSYVINYVEVPLEEIMEQVKAGEKFTDIFYN
FT                   TDNFRTTGETYIYTLNVKGKDDTVMNILDFKYNKDTMNSLLAGQEITLTHDYYFAMGDN
FT                   SSDSDDSRYWGYVQDSRIKGKLLFRFLPITKFGIVK"
FT   gene            333138..333569
FT                   /locus_tag="Sterm_0304"
FT   CDS_pept        333138..333569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0304"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   abb:ABBFA_002742 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07188"
FT                   /db_xref="GOA:D1ALS0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ07188.1"
FT                   /translation="MEVLISEKIKDYDNIIKIHNLYFDNKWQPNDIENMNRTENYGFIV
FT                   IKKDNEIAAYLISYDTLDSIDLFEIAVDSSYHGQGMGTILLKTLSEKNRNRDIFLEVSE
FT                   DNEKALLLYKKNNFKQISLRKNYYKDNKSAIIMVRKYDN"
FT   gene            333559..334032
FT                   /locus_tag="Sterm_0305"
FT   CDS_pept        333559..334032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07189"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07189.1"
FT                   /translation="MIIEFLESKRIIKSREIAGYLEKNEVYLTHSMLKKFTELAYELEN
FT                   STDENFYEKLSEIKLDMKKSKKDRGTELIEKIERMKMPVYSDTLREFEKRIRKIKNSQI
FT                   SVKYPRELEGGEILLEIKLKDHRDVKKSLDSLDKNREIIEEMMRIFENGIWEE"
FT   gene            334035..335621
FT                   /locus_tag="Sterm_0306"
FT   CDS_pept        334035..335621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0306"
FT                   /product="Domain of unknown function DUF1957"
FT                   /note="PFAM: Domain of unknown function DUF1957; glycoside
FT                   hydrolase family 57; KEGG: ank:AnaeK_1135 domain of unknown
FT                   function DUF1957"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07190"
FT                   /db_xref="GOA:D1ALS2"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS2"
FT                   /inference="protein motif:PFAM:PF09210"
FT                   /protein_id="ACZ07190.1"
FT                   /translation="MRGYFSMILHAHLPYVRHPEYEEFLEEDWLYEAISETYIPLLNMF
FT                   ENLTRDKIPWSITMTMSGTLANMLNDELLRSRYEVSLNKSLELCRLEVERLKDQEELLN
FT                   VAKFNLSFFKRAKETFLRYNGDLIKAFKKFQDNGNLEIIPVAATHGFLPFMKDFPEAVN
FT                   AQILMAKEDYKNNYGRDPKGIWLSECAYYPGQDKYLEKNNLKYFIVDAHGIMFSSPKPL
FT                   YGVYAPVYTANGVAAFARDLESSEQVWSSEIGYPGDGAYREFHKDAGYELDYDYVKPFL
FT                   HSDGVRRNIGIKYYAITDKNSGEKRVYNPGAAHDRAKEHARDFVNNRSKQIGYLKSLMR
FT                   TREPIVVSPYDAELYGHWWFEGPVFLEWVFRYMKDSDFKSITPSRYLDKYKVNQIVDVN
FT                   LSSWGANGYYDVWLDERNDYVYRHLHKAAQKMIELANGRDPETELEERALNQAARELLM
FT                   AQTSCWEFIMYTETMVGYAKKKISDHINRLYKIYEDFKGKTLEEEWLCEIESRDNIFPT
FT                   MNYSIYKSERL"
FT   gene            335784..336143
FT                   /locus_tag="Sterm_0307"
FT   CDS_pept        335784..336143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0307"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: aci:ACIAD1223 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07191"
FT                   /db_xref="GOA:D1ALS3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ07191.1"
FT                   /translation="MKSYDNFFLPADDMEVAEEYYSEILGLSIKFKFENIGMTAFNVGK
FT                   EEPAIILKDRKIYADMKPTIWFTVDNVMEEYEKLLKKGVEFLSEPFKIKTGMAAEFCDP
FT                   FGNRLGITDYSGVQK"
FT   gene            complement(336468..337286)
FT                   /locus_tag="Sterm_0308"
FT   CDS_pept        complement(336468..337286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0308"
FT                   /product="alpha/beta fold family hydrolase, putative"
FT                   /note="KEGG: alpha/beta fold family hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07192"
FT                   /db_xref="GOA:D1ALS4"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS4"
FT                   /inference="similar to AA sequence:KEGG:NFIA_103280"
FT                   /protein_id="ACZ07192.1"
FT                   /translation="MEYKIKDLNIHYEICGEGKPVICIHGYTVDHHLMKSCLEPVFQEE
FT                   KIQYKRIYIDLPGMGQTKAVPWIKNADIMLEVLLEFINYITDGESFLLAAESYGCYLSM
FT                   GILKKLQHQTDGVFFLCPCIISDYNERNLPSFTVVFSEKITDSGDFENEIKEFNEMAVI
FT                   STDETWADYRTNILPSIKIADQDFLARYRENGYGFSFENDFESLTYNKPSAIITGRQDD
FT                   SVGYKDMFKLLDNFPRAGFSILDGAGHNLQIEQPELFREYFRNWLKRTRY"
FT   gene            complement(337426..338208)
FT                   /locus_tag="Sterm_0309"
FT   CDS_pept        complement(337426..338208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0309"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: gur:Gura_1529 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07193"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS5"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACZ07193.1"
FT                   /translation="MGKNLIFYFSGTGNNLKVAKTISENISNAEIIPMGSSHIYEFEGS
FT                   YESIGFVYPVYFAGLPAKVADYISKLILPEDKDIYYYTVNTCGSIIGNGFVQLKELLEQ
FT                   KGVHLDYSAKLKMFSNYVVMYNMKENVKEITEKSAKDLIPIIENIKNKYKNKTGNKNPL
FT                   LEWWYHKEMKAVPAKDKFFNVSDDCISCGICVKVCPVENIKLEGKKPEFLHHCEQCTAC
FT                   IQYCPKKAVNFKNKTQKRRRYTYPDISWKVLSESNKSF"
FT   gene            complement(338319..338726)
FT                   /locus_tag="Sterm_0310"
FT   CDS_pept        complement(338319..338726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0310"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: pca:Pcar_3004 repressor of mar
FT                   (multiple antibiotic resistance) operon"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07194"
FT                   /db_xref="GOA:D1ALS6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACZ07194.1"
FT                   /translation="MKLADIIEILSKRFLNYKIHELEKYNAENINVNFFQYIDVIGDME
FT                   SPTYGELAQKLNLSKPAITAIVNKLIKQNLVYKEQSMTDKRTFYIKLTKNGLKIFNSCR
FT                   LAHNDLEKYIAEKLTEEEYKQLVHLLCLVIE"
FT   gene            complement(338946..339653)
FT                   /locus_tag="Sterm_0311"
FT   CDS_pept        complement(338946..339653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0311"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: apj:APJL_0235
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07195"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS7"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACZ07195.1"
FT                   /translation="MEKSECQNEPIFLYIVRHGKTVSNLEAKVHGWTDSPLSELGISQA
FT                   KKVGEGIKDIVFNTAYSSDIKRAADTAGFILSANKNEKPVLQEVFGLREWNYGGYEGID
FT                   EVNMWVPLFEEKNMEFRLDRSNWEEFTALTTDREIADSIARNDPAKTAENYDDILKRAK
FT                   EGVDFLIKDTAEKGGGNALVVSHGNIIPTILHLYIPDEYNGETVPNCSLTILKIENGKF
FT                   SLEKVGDTSFIDN"
FT   gene            340037..340240
FT                   /locus_tag="Sterm_0312"
FT   CDS_pept        340037..340240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07196"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07196.1"
FT                   /translation="MSGVKGKSGRKPGFKNPNAGRPEKSKENKKVTLSIRISPENLKWL
FT                   NENIKNKSEYIDNLLINERNKK"
FT   gene            340491..341168
FT                   /locus_tag="Sterm_0313"
FT   CDS_pept        340491..341168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0313"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   mfa:Mfla_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07197"
FT                   /db_xref="GOA:D1ALS9"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALS9"
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /protein_id="ACZ07197.1"
FT                   /translation="MFEKKFKKYKQTSDTFRIGILLSMAGGFTDAYTFVIRGNVFANAQ
FT                   TGNIVLLGLKLVEAKWGEAVFYLFPVSAFVLGILAAEFIRAKLKDKKRIHWRQIVILIE
FT                   ILVLFFSVFVPQGNYNVVVNIAISFICSLQVQSFRKVNGNLSATTMCTGNLRSGTEQLY
FT                   KYIVQKDSEAKEKYMIYYGLILFFIIGAVIGALFTEILREKALFVCCGILITVFAVMFR
FT                   DEM"
FT   sig_peptide     340491..340586
FT                   /locus_tag="Sterm_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.401 at
FT                   residue 32"
FT   gene            341578..341784
FT                   /locus_tag="Sterm_0314"
FT   CDS_pept        341578..341784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07198"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07198.1"
FT                   /translation="MKKIIILMSIIGCFSLAAKKNEKTPEIPDMNAQMEKADKIESYRA
FT                   KKDVAWHKTEYNKVLKYLNKSRK"
FT   sig_peptide     341578..341640
FT                   /locus_tag="Sterm_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.654 at
FT                   residue 21"
FT   gene            341793..342071
FT                   /locus_tag="Sterm_0315"
FT   CDS_pept        341793..342071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07199"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07199.1"
FT                   /translation="MKRMILIFSLLTLSLMAFGEEVNVDRSVEESITKDYDQDGVYSSY
FT                   EKALRRAQESVYVKLPEKRGYWYTILDRVKAEEEELMPEEINRMRRR"
FT   sig_peptide     341793..341852
FT                   /locus_tag="Sterm_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            342088..342354
FT                   /locus_tag="Sterm_0316"
FT   CDS_pept        342088..342354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07200"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07200.1"
FT                   /translation="MKKTIILIFLTVMGTMLYSAPTYEYKRELREGARGKWTNLRKHLN
FT                   SGQRLEKELIKVDKQIDKKVNEIQEIEDLLFRIEQYKAANNIR"
FT   sig_peptide     342088..342147
FT                   /locus_tag="Sterm_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.968 at
FT                   residue 20"
FT   gene            342367..350637
FT                   /locus_tag="Sterm_0317"
FT   CDS_pept        342367..350637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0317"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: azc:AZC_3233 putative outer membrane autotransporter
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07201"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT3"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07201.1"
FT                   /translation="MKRNKKLLVSFLALNAILTSYTQAETVQSARYERMYNSIVKNMEK
FT                   GSSNEKTYQTIEKILNQKNKELKDLYLQGNYIVKPEYLEWQVFFTGFYDEYSEGRDNSQ
FT                   ENARYHSKVTGYYDTNGNYIVTSGSINGLAGKPHQSLQQPKEIDLGIGIQVREPNRQPI
FT                   SLGVGKPSMPLVTPITPGSPSIAAINPVLPPLASFSIPTILTPTPPTPVTIAAPTISTV
FT                   VVSSFSPVTPTIIVPSTFTPPTLTFIPSGFGQSPSPAFHPNSTPMIENVSAKTLDPGGV
FT                   TIVTGGAAGTWNGRIQYGNTAYPTAPWNTWQTSAASYASNGSPNAVFNYVDNYDYTIEG
FT                   DWTFTNTGSTRTTTMFLSYNPYEVVAPAGKTVEFKGNLTMNHTNPTLNYMTLGFEHQLL
FT                   YGDGGGNTASMLTGYSTLLNSGTITLNSGQNMIAIMIDSEGTQSPLMSYTINKGTIDIK
FT                   STQSIGVDFGQYLNNASIGSANPRVTVRPGYILVDGSENYGIRVANVFTADPTYYRYAS
FT                   IDGTNQGKGGIVVQGTKNVGLSLSKQMGSNLIGNISNLNISVNGSEGIGVLRRSDYAQT
FT                   GNMVFTGTHIQTLDFGANATKSVLLRSDNGNITLDRNITINKGLGNNVVLQANGAGTSI
FT                   INNTLRTMTLDTGAKTSIGLLASGGGSLENKGTVVVTEEKSQGIAVLGGASGVNSGTIT
FT                   LNGKETLGVNNSGTFTMSSGTITSKGENSIGVYASGTTSNTTVSGGSITAENGGIGLYS
FT                   GDNATINVSGSNIITAKAGGLAFYNHVNGGTVTGKYNITAPSTLKVEAGGMLLYAKVTS
FT                   LSGITSLATAIKSAFIGAGNMTANMDPGSNIMYIDSPGGTASINSFAGLPSLTTGFFSF
FT                   VGTGYNDYVMNGFNLTLDNTAESNLDTGAYGKIQFINSDITVASSINVVGTQAGQVAVA
FT                   QKNKSGSITPTDRKIINNGNILLSGANSTGLAGDYITMTNSGTGTIKLGTNSVGMYIAN
FT                   GSESLNQGLIELGAGSVGMYGKNDFGSTAAAYGNRKINIENQKDIKTVSGGVTGDAFGI
FT                   YANNALTLADSSVNLTSASNIDLKGTGTIIGAYLKKTDLTSAGIIKVESLGGTSVGIYG
FT                   DESTATSITESIDISGGAGTGIYLKNSSMSSGASINVDNVTSGIGIYVEASAGNTASGA
FT                   NTGTISLGDNVTGMYALGVSAANTGTVTNTGTIQSLATSADKAIGMYIGNHGIGNNSGN
FT                   IYLTALGTNEDQVGVYNSGTFNMTGGNIEVYSKNGAGLYATSTASLSGGTIKTGNGAIG
FT                   LYADGTTINLSGTYKSIVENGGIFALNNSGSGTINVTGNIAVDIEAGGMAFSSTGALNT
FT                   YLSGLVAGSGTLEINLKDPTSKLAILDSPGTILLSSLGTAYAPGSTITPNVKISASSNP
FT                   NYTPFSITKGHLVVDQIVNLDSTTDSYNKSDFINSSVDVNSAISGTGTGQLGVGQVNYG
FT                   TGAAAADRARITVNNNNTIDLSGNNSTGMLADFGDITNTNIIKVTGEESVGIYGANSAV
FT                   STNTGTINIGNKSVGIYGVNYLSGAELYGDGKIIINNNGNIISTGTTHGGYGIFANDTG
FT                   ALGSTVTLGSASNIDVSSGEAGIGVYAVNSTLSIDGNITVGKDGVGIYASGSTGTINGG
FT                   TISLNGDNAIGYYLTNGSVFTNLGGSIAVNGQNITLMITDASSSINLTTPFTVTSTPGS
FT                   TYVVGNMVGGDFYNNTSATLGSNGSLINGIGTVALFGTASNINSTGTNVSGMVLSGQHA
FT                   SIPVPGHVVSGSAITVYEEGTNLGVIALGDSSAGMYLTGGARGRNEGIITITNNSVGMY
FT                   AEGTGSYLVNNNGIITVGQESTGLFLKDGVSISNTGTAEINSTGLKAVGIYSENNLAGS
FT                   ATVTNSNKIDLSGDQSIGIYTTGENNVANTGIINIGNSSSQTQPGVGIYADHAGSSITN
FT                   SATGSVNVGDNSIGLYNLNGNVTNSGAITAGNGGTGIYSEGGTITLNAGSSIITGQNDA
FT                   VGVYAVNQTGIVTNNSTVSVGDGSYGFVFTGATAPTFINNQSAVIGNNSIFVFSDSALS
FT                   ADNSGILTMTGSDNIGYYLKNGGSFTNNMDIIGNSGVSNIGVYAKGANIINNADIILGD
FT                   SNLVEHTDAGGVKYKTGYSVGIYGEDSNITNNAGNTIQVGKEGIGIYVKGSGYTAENYG
FT                   IINGFGNDAKGIFAADYAIVNNYGTINMTGDNVMGIVGQNGAQIYNHSGSVINVSGNDV
FT                   TGIYLAGDDTKLVNNGIINITGTGLGISYTPTVELSNVTDTTGTTQGYTSKQYDLPDMP
FT                   TVVNSGIININVGGNFNYDGIRVIVTIDPSTNTPTTNSSSQVGFGGTIPNKLEVAPDFA
FT                   VGTAADRYVFENIFKGATGKGEYISQSLTWDATAQGSNLIMTRKPYMDFTDGLWFEDFG
FT                   KILNEKYAVTTGEGRKIFDKINYITNEADFRHIMASMAGNVYANINQREYDIAKAFEES
FT                   LHILQDSSNNTKENIKVSLIGGKGKNKEETDGVTGYDYTTTGVLALREVERTYRHTFGY
FT                   SLGYLHTGFEFKDGNESEEWVDTIQLGVHNKYRSNGWKVVNDLTGRASIHNVDRNIDWP
FT                   SPNSRSEMDGTYETYSITSDNILGKEFGLGKKASIMPYGAFKAMYVTRPAFNESGLEAL
FT                   EVEGNDAWSAKPRAGVELKGALPLGANWQLKGALDLAYEYELADLNEREKARLIAIEDG
FT                   YHKLSKPEDEKGTFRTRAAIGVEVEDRYGIFLTGEYSTGNDKEDDYRAGVTLKAVF"
FT   sig_peptide     342367..342441
FT                   /locus_tag="Sterm_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            351048..352037
FT                   /locus_tag="Sterm_0318"
FT   CDS_pept        351048..352037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0318"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B2196 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07202"
FT                   /db_xref="GOA:D1ALT4"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT4"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACZ07202.1"
FT                   /translation="MANGNNVKKRPDYLSDDHLNTGTKEYLKVLNSGDTPVESLPPAEA
FT                   RKVLEGAQSSVNVDLSGIDEEEKTIETDGFKIVINITRPKGAKEKLPVFIFLHGGGWVL
FT                   GDYPTHRRLVRDIVVESGFVSVFVNYTRSPEAKFPQALDEIYAVTKWVAENGDQINVDG
FT                   KKLAIIGNSVGGNMTIATSMRAKQNNGPEIKCQVLMWPYSNASTDADSYIEYGEQRFLT
FT                   TPLMEWMRDNYIRTPEDHKDFFVSPVLAEKDQLKGLPPTLIEVAENDILRDDGETLGRH
FT                   LDEAGVYVSTVRFNGVIHDWGLLNGFAELAPVQSLVLLSAAMLKKYLK"
FT   gene            352710..359129
FT                   /locus_tag="Sterm_0319"
FT   CDS_pept        352710..359129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0319"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: bcm:Bcenmc03_5354 outer membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07203"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT5"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07203.1"
FT                   /translation="MKTNKKLLVSFMALNAVLSTGIEASGASAPSKYDRMYNNMIKNLD
FT                   QNKSNSKNYQIIEQVLNKKNKELKDLYIQSDYIIKPEYLEWQVFFSGGYEEYGKGVDNS
FT                   SDNAKYSSKVTGYYDTSGNYVVTSGNKGGTLGKPYQPLQTPKEINLGVNIPISGISRDP
FT                   LNLTINPKTVTVVAPSQKTVPAPNPNVVLLNLSGIEVPTAPVPPTGLGSSGIIINPNQI
FT                   YSTNSQFTTGVGTITGGTYAIDSAPYSSLYTFTTNNETLNFTGNIDINGNTGVIVSNSG
FT                   PTTITGASITNDSTMTVKSSGSGLGGFHSNNSTAGYLDFINNNILDIEYVSGSGATQSL
FT                   FFYGNINLKNNGTINYVNNDGGTKALYSMWNSSPADPNPMRVENNGTINIIGNSSLSYS
FT                   STVMAHHFGHLTSTALGQHTVINNGTIDLTNALGYLQDYSTGVYDASGGGIMNVRENSV
FT                   GIELTLTGNSENIFNSSTLKVGTINVYGSTNTGGQYSKAINMSLNAFPNVIVNISDGEI
FT                   NLESNSMGIITNIPGTQTINNSAEINISGENSYGIITYNNSASAGSIENTGDITLDVNN
FT                   TSKLSAGIFHQIAPSFVNKGNIYVKSTGSNAEGTIGILLSQGAKFTNDGGGTKVISVDG
FT                   RKATGVFANQNTTNTIKNTAVKVANSGIGFFSYNGSDIKLENITAEASAGGILFYSSST
FT                   PSNSTITFVNSSSATVKDGGTAFYVDGPLSMIPTSYVNLNNLNLKMEDGSTVFLLDSPG
FT                   TYSIGALPTASMAGLNIDPSSGNYKDVTINRGTINIDNVGGNQVFDLDNPNDALNKNSF
FT                   YSSNLNLITGSTIQGSGSGQLAMGQTSYTGAASNALVTLTNGGTIQLSGASSVGMYSNY
FT                   GTLNNNTAINVTGTDSVGMYGENGTAVINSGSITIGNKGVGIYGISNQNILSPASYGDQ
FT                   KVNITNNTSIVSNAGTAGTVGIYANNNAGTTGNNLIFGTGSVINLGASDSAIGVYANQI
FT                   DNVQARGVITVGSNGIGMYANNSNITLNNFTINLNGDNALGYYIEGNSSSFTGNGTINI
FT                   DGQNVTLFNINSNSPAVDFSGITVGTVTAGSNYTLGSLTNGKMTYASDARLATNGTMLN
FT                   GRNTNIYLNGTSDIKAEAGATGVVAVALDGQYTGGAPITPGVDGKNDGQIILGNSSVGL
FT                   YGKNDARFENTHIITVGDDSAGIYTDGALASIKNTGTITIGNNSQGLYLKNGDTIDNGG
FT                   SILSLGISTVGIFADNVTNPVINTGIIDLSGDKSVGIYKTGAVNSISNNNIIKIGDSSD
FT                   LNDPGIGIYSNTAGDIITNSGTIDTGKNSIGIYAEGAAVNQNNILSVGATGTGIYTKGG
FT                   TVTLGAGSNITVGSNESVGVYGTNGTHITNNSTNAVNINNGGYGFILETGSLLDNHGIL
FT                   SLNGKGTGVYSDGLNTVNNYTGADINMSGDNNIGIYMVSGGIVNNDADINGAAGKSNIG
FT                   IYNKNGTINNIGTINVGNSVLVYKSDGTVDYDKSGYAVGIYGDGSYINNTGNITVGENG
FT                   IGLYTRNNPAAVVNKGNITGTGKGAVGLFVDNGVVENNLGTTITMTGDDSIGMVANKNG
FT                   TIINNGDIIMSGNNVSGMFANINSHSVNNGTIDMTGATGDKSTAFLLGAGSTFENNGTL
FT                   LLGSNAVISGVAGETYKIPSIVNGGIIYSDGALAADGISLAIKVNPETVVYQSLSSGPQ
FT                   FTANGTSIIADTLTTSKPIVVLPGFADGTNANVYKIENAVVASGGNYEFVSGSLLWEAT
FT                   PEATGTGANVYMERKSFTEFTDGLWFEDFGNALEKNFLGSRGDAMKIYNKTGYIETEED
FT                   FRQIMGSLAGNVYANMNQRENDIARTLENSMLTLHESPNNTKENVKINIIGGKGKNKEE
FT                   TDGVTPYDYTTAGVLALREVERTYRHTFGYSLGYLHTGFEFKDGNESEEKADTIQVGAH
FT                   NKYRAGGWELRNDLTGRVSFHNVDRNIDWGSSLGKSEMNGTYETYSITSDNILGKKFEI
FT                   GKKTSIMPYGAFRAMYVTRPTFSESGLESLEVEGNDAWSVKPRAGLELSGSLPLGSKAV
FT                   WQLKGTLDFAYEYELADLNEREKARLTAIESGYHKLAKPQDEKGIFRTKGMLGIAVEDR
FT                   YGLFLTGEYSTGNDKEDDYRTGLILKAVF"
FT   sig_peptide     352710..352784
FT                   /locus_tag="Sterm_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.623 at
FT                   residue 25"
FT   gene            359531..361000
FT                   /locus_tag="Sterm_0320"
FT   CDS_pept        359531..361000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0320"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: sat:SYN_02264 UDP-sugar
FT                   diphosphatase / 5'- nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07204"
FT                   /db_xref="GOA:D1ALT6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT6"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACZ07204.1"
FT                   /translation="MKKILLIFFVFMNFIGGIIYGKEVKLTIFHTNDTHGRGLDDKSIG
FT                   YGKVTAYVNQYRASNKNVLFLDAGDAFNGLPVIDLSLGRANLDVMNLMGYDAFTAGNAD
FT                   FVQGGKQILELEKAANFPFLSSNIYYNGKHAFKPYIIKEIEGVKIGIIGVSPMNSMVAT
FT                   TDSKLKGFKVTDAIKEVEKQVKIVKKKADIIIILAHLGKTDPVVNVQKLVETVPGIDII
FT                   VDGHDHVLIKEGMKINETFVVNAGQYNEYLGMLELRIEDKKLVSASGKLLGADEFKNIS
FT                   ADKNVEELIQKITKENDRILNEKVMVLPFTLEGRREFVRSEQTNLGSILADAEREYTGA
FT                   DVSITVGAFLRESIEEGPVTYGKVLSALPFTLPTVTRNMTGRQIVDFIEHNYTEEKIVS
FT                   PAYTHVSGMTFTVDFSRPAGARMTDIMINGKPIDMNKIYVLACNEQISDFGIRDTKIEN
FT                   SFDITMAQLLINYINKHPDIKNPENRVTIKK"
FT   gene            361290..362048
FT                   /locus_tag="Sterm_0321"
FT   CDS_pept        361290..362048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0321"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: lhk:LHK_03101 GlpR1"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07205"
FT                   /db_xref="GOA:D1ALT7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT7"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACZ07205.1"
FT                   /translation="MKEKRIDIIMKEIEKHGIVSVNDLMKKLGVTRMTIGRDLKLLEDS
FT                   NMLKRIHGGAVRNEDSKLTELTHLQKKNINISKKEEIGRQAAGYIENGDIIFIGASTTN
FT                   ECLMKYIKNKRIRIITNSFYIFEQYKGNDDFELILTGGIWREKSGAFIGDVTDRILSEI
FT                   KVDKSFIGANGIKNNNVTNSNKEEAGLQKIIMDNSQKNYILIDSNKFDLKDLYTFYQTD
FT                   KINGIITDSRLDKELREKYGKYTQIINIIK"
FT   gene            362161..362640
FT                   /locus_tag="Sterm_0322"
FT   CDS_pept        362161..362640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0322"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: dat:HRM2_43150 putative 5-nitroimidazole
FT                   antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07206"
FT                   /db_xref="GOA:D1ALT8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT8"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACZ07206.1"
FT                   /translation="MFREIRRIKKKLPESEAVRMLEQLSCCTLALSGDDGYTYSVPVSF
FT                   VYDNGKIFFHSATEGKKCDSILQNNKISFSAVEKDDIKPAEFTTHYKSVIGFGEITLLE
FT                   KREEIQHAMELILKKYSPDYMKEGKDYIERAWGHFYTYVIDIHHMTAKGTEKQKE"
FT   gene            complement(362816..363283)
FT                   /locus_tag="Sterm_0323"
FT   CDS_pept        complement(362816..363283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0323"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   plu:plu4617 IS200 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07207"
FT                   /db_xref="GOA:D1ALT9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT9"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACZ07207.1"
FT                   /translation="MAKKSNSLSHTKWMCKYHIVFTPKYRRKIIYNQYKKSVGEILRSL
FT                   CKYKGVELLEGHLKTDHVHMLVSIPPKISVSSFMGYLKGKSALMLFDRHANLKYKFGNR
FT                   HFWSEGYYVSTVGLNETTIRKYIQEQEKQDIARDKLSVKEYEDPFRGGKSE"
FT   gene            complement(363482..364309)
FT                   /locus_tag="Sterm_0324"
FT   CDS_pept        complement(363482..364309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0324"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: ppr:PBPRB1791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07208"
FT                   /db_xref="GOA:D1ALU0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU0"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ07208.1"
FT                   /translation="MGYKLIVSDMDETLLNDNREISENNLKMIKLAKEKYGIKFVPATG
FT                   RGYASIQNELARLGLHDLPGEYVISYNGAIITENKGNTLLRSNGLDYNIMKEIFDFGLT
FT                   KNVCQHVYTKDTVYVFNVNQYEKEKMDGYNGGRVYMEENSVDFLKNEKIYKILFQNPDV
FT                   PYLMSLEKPMKNLTENCTVSYSSNRYMEFNSIGIDKGNGLRSLAEILGIDVKDTIAVGD
FT                   NYNDISMLKTAGLSIAVSNAVDDAKKAAHYVTEADNNKGAVAELIEKFIINRI"
FT   gene            complement(364460..364978)
FT                   /locus_tag="Sterm_0325"
FT   CDS_pept        complement(364460..364978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0325"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG:
FT                   pub:SAR11_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07209"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU1"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACZ07209.1"
FT                   /translation="MYKVNDTVLYNTHGVCKIVGISEKDFGGNHTSCYALKPVYRDKSM
FT                   VFIPVNSNNALSKMHRILSADQIYSLIKALPAEYPVWIQDKDQRKEYYEKVLLGEDREE
FT                   LIILIKTLHVYHQSLLDQGKKMHAADRYFMKEAEKKLHEEFAYVLNIKPDEVIPFITEQ
FT                   IKVDEKDDI"
FT   gene            366234..372605
FT                   /locus_tag="Sterm_0326"
FT   CDS_pept        366234..372605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0326"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: cha:CHAB381_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07210"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU2"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07210.1"
FT                   /translation="MKVNKKMLTMLALNILAVMPAIAGESKTDRLYNNIVKNIQTGKSN
FT                   NSNYKLIENILKQKNKDLKDLYLQGNYVEKPEYLEWQIFFSGFYEEYNNGKDNTGENAE
FT                   YNSKTSGYYDANGNYVLTEHSVNGIPVKPYAEAQDGKYINLGINIQVKEVVKDVLTLNP
FT                   SPVVPVNLALSIGNVSVPVIGSIAPVNVPQFSITQPNINITTPAGINIVIPSLSAYTNW
FT                   TSITGAQWANNTQYGNVNLTSPSYKTSDGINAIAQYTISGDYYADSDTIMYVDVSQTRA
FT                   VTVDLTEDLGKPSSNVYTTFTNYGKIYLTALSTAGLEIQSDNRGEHPTLKNSGLIEGQN
FT                   KTQVGMIFTPEGSTDINATYIMENTSSGQIIMGGNDSSGMAVNKMGARPLFLINALNTG
FT                   LIETRGLNNYGIALDLNNLNSASSILNKGIINVKGDKSGGIVLKGSIGNTDDNVVNKGN
FT                   INVTSSTSFGIYSNVSDTKYVNEGNIDLTSAANSIGLRNEGGLLKNGSNGIINLTNGTN
FT                   NIGLYSTDGTTENNGKIIISNGTDNIGIYAKGSGTSVVNSGEINAVSSGKIKGIAVTDN
FT                   ADITNTKDIKLNGQSGSVGIYASNYGTFTSSGTGDVDIKVSGTDSVGIYSENNGLVAVN
FT                   GNIEAADNAINLYASNGKILLTDAALTTKANSLLFYMTNNGKFSLTNTQADIENSGAAF
FT                   YYDASSLGAITSGIMSGYISNMFLSGSNSVLNMSQDSILVSVNNAAVNLSNLPDLRTTL
FT                   GSVGINVSGTGYKSYLLYKSNLTVDQNANLDTDILGTIGLSATGVVNNSEITGTLADKK
FT                   AIAVENEDLSAKSAVTITNNNSIILSGNNSMGIYTNYGIINNSSGKIIKLTGDNSVGLY
FT                   ATNGTSVQNSGDIYINGAGIYATSYKADGVSQTFGDGKTSIVNSGTVTSGSKANSVGIY
FT                   SRNNSGGTVSSNDFTLDLSSGEINMTGSSGGTAVYAEKTKVTDSGSTISVGEKGIALYA
FT                   KDSDVTLNGSVINLLGDNAIGFYLEGGTAFNGTGTINIDGKNIILMIPGASTTVSNNFT
FT                   VGTVTSGSTYTLNAMVDSIYTYTGTAALESNGTLINGVRTAAYIGNPGGVYANPGAENI
FT                   GAIVLNGQYTAGGTLPAGMSAGVDGENAGTVILGNASAGLYGTNGTRLGNTGTIQVNDN
FT                   SGAIITSGSGSLGQNSGFISIGANSQAIYVKNGDTVNNMAFGSIESAGQKAVGLFADTV
FT                   NTVVNDGYINMTGANSMGIYTAGANSTSITNNGAVTIGASSDPDNPSIGIYSSSSSVIN
FT                   NNGSIASGENSVGIYSNNGTVNQNGALNVGTNGIGLYLSGGAANITSNASFSLGTNAAG
FT                   VYAENAGISNASNMSVNNNSYGFVLTNSAFSNTANNVSLGTNSVFVYAGGGTNINNGNI
FT                   IMNGSDNIAFYTFDGARVENYGTITGTAGTANVGIYNKGGSVLNDVSGVISVGDSILAN
FT                   EEYAVGIYGVNSAISNSGTIYAGSGAVGIAAEGGRAENTGNITAVGTQSIGMYTEGGII
FT                   VNETGGLITVSGKDAIGMAGKGSGSQIINNGIINVTGNNSKGIYGVEGATVINNGKIYA
FT                   AGSNAAGIVLDSKSTLVVSGTGEIITNSIAAGNSYREMTAYDTPEIINSGVIQVLEKFE
FT                   TDGLKVTIKVDPSSMTTPETSVVSSGGYDNVDMDAEYLISNAVKIKAPSFSISNAMEIT
FT                   ADYALGTNLNKYKLEDVLVSGSNVAANSSDIAVKSRSLTWEATPVTNSKGNIDIWMTRI
FT                   SYSKFTDGLWYEDFGRTLDEKYTSAGNDDALKIYDKIDLIENEVDFRHVMGSMAGNIYA
FT                   NINQREEDITGAFENTLQLLQNSENNTKENVKLGVIAGKGKNKEETDGVAGYDYTTTGI
FT                   LALREVERTYKHTFGYSLGYTHTGFEFQDGNESEEWVDTIQLGVHNKYKTNGWALRNDF
FT                   TGRASIHNTDRNIDWPSPNNRSEMNGTYETYSVTSDNILGKEIELSKNVSLMPYGAFRL
FT                   MYVTRPSFSESGLEALEIEGNDVWSVKPGAGLELNGKVSLGRNWQLKGTLDFLYEYELA
FT                   DMNVREKAKLNAIEDGYHKLSKPQDENGIFSTKAAVGLEAADRYGIFLTGEYKTGNNSK
FT                   NDYRTGVVLKAVF"
FT   sig_peptide     366234..366305
FT                   /locus_tag="Sterm_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            372681..373241
FT                   /locus_tag="Sterm_0327"
FT   CDS_pept        372681..373241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0327"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nam:NAMH_0571
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07211"
FT                   /db_xref="GOA:D1ALU3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ07211.1"
FT                   /translation="MNREDAIKMTLEVIKEKKLENSSIGEIVKKMDISPGNLYYHFKSK
FT                   NELYREVLEYSINEIADSLDKVKLDINKKNNLFQLTEKLIRFLEKREDILFFLITMKGS
FT                   SYLEKKSNSRDLLLNFKNMLVNQDLNTEHEKRIALKLNMFLGSVYEVLYENKLLKKRNL
FT                   TSAEINEIYLSFWGNEGKEDNGI"
FT   gene            374033..374242
FT                   /locus_tag="Sterm_0328"
FT   CDS_pept        374033..374242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07212"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07212.1"
FT                   /translation="MRKLIFAIAIMMSCFILGAKKNNQNLKLPDIEEQMKKADKISDYE
FT                   AKKDVAWHKTEYNKVLKYLKKNQK"
FT   sig_peptide     374033..374092
FT                   /locus_tag="Sterm_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.579 at
FT                   residue 20"
FT   gene            374251..374529
FT                   /locus_tag="Sterm_0329"
FT   CDS_pept        374251..374529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07213"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07213.1"
FT                   /translation="MRKNILIFSLIAFSLTIHCSEIRVQRSLEESITKDYDQDGVYSSY
FT                   EKALRRTQESVYVTLPEKRGYWYTMLDRIKAEEKELIPDEKVRMRKR"
FT   gene            374546..374812
FT                   /locus_tag="Sterm_0330"
FT   CDS_pept        374546..374812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07214"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07214.1"
FT                   /translation="MKKTVILMLFIIAGTILHSASVYEYRRELREGARGKWTNLRQHLN
FT                   SGTRLERELIKVDKQIDKKVSEIQEIEDLLFRIEEYKAENNIK"
FT   sig_peptide     374546..374605
FT                   /locus_tag="Sterm_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.737 at
FT                   residue 20"
FT   gene            374825..382795
FT                   /locus_tag="Sterm_0331"
FT   CDS_pept        374825..382795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_6355 outer membrane
FT                   autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07215"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07215.1"
FT                   /translation="MTRNKKLLVSFLALNAILAPHVSGAAASSSQKYDRLYNSITKNLD
FT                   KGSSNEKAYQTIEKILKQKNKELKDLHLQGDYIVKPEYLEWQMFFTGFYNEDARTGSLS
FT                   SNHAREGDDSESNWSGKNKPMIQADSYKEVKVGPSIPYKYLNLQDINPNISLPVIESVA
FT                   SINLNKIPLVIDIPQLPALPNIQLNTVTTTNINDINITKNVQVSPINISIAAKTFNPVT
FT                   LVNPQLARNGNGFNSSSGAANLHTNLDAPGTTTLVTSTTNPTGLIQIIGPHGVNWNGAM
FT                   QSGGTGSMTYNITGSLKTEKVGSRVVLVESHRASSGVTTGNTNDILYVNSSGTLTSDVS
FT                   YSGTVTGVYSDTTLIVEIEGGYGAYNHSMFENTGMMQSIGTGKTIGMEFKSGSDLTSTI
FT                   KVKNSGTIDIKGDESVGIDSLISQNGNQFNIGVENATGGTILMRGNNSFGILLTQGRLD
FT                   GSNVKSSGNIGTLTNTYIQNGTITMKGYGSYGVVIEGGTELPTGTSLNSGTINIENGGA
FT                   SSAADTSSGIYLNKNLALSNDGIINVSGNYSNGIRINSGSVTNKYVSGKAVNILGTAAD
FT                   STGIAVINSSSTGINNGKIALTATGGKNIGMYGTGGGTGNRIENTGTNAEITMNITAGS
FT                   ENIGASIIGTGSTFSNSGKINLTDTTTAGKNVGIYSDNATVNNTGEVNLTTKGNDIGIY
FT                   LKGNSIGTIGGNINLTSTGSNYDYGVYFDNGYTGNAAINSTISLKGKSAGVFSAVKPIV
FT                   FNGTVNMDTSSSLLSADSIGLLYQITGALPAGNIVTNNGTLNAAAGTGIYIHNNSTALG
FT                   KTVINNAVKSINISGGGVGIAAESAAYTSGDKLHIINSGLINNVSSSTANSIGIYAKNQ
FT                   DIRITGAGKISVSSPGSENLGILINGGKTEFESSLELGAGGIGVYLNGNASNTNDSVLD
FT                   IGNTANAITALTNGIGVVAKGEKATVNILSNGITLTGHSALNEGSLGVFLENGNINNNG
FT                   TIKTGDYGTAAYLKSTANARTVNLGNLETQDNGVGLYLENQNIIDTLTSITTGENSIAV
FT                   YAKNGDIDIDVLDSANFTLGKGSTGYFLEDGTIKSLLGINTDITLGNDITGVALTGNSA
FT                   IDSSINSITIGNNTGSAASIKPIVLGIKDISSPLTVSTKLTGGNGTVGLYYEEGGTGNA
FT                   VTYNGSGSLTVPDIKVGTAGGNLSSVGVYLDAATNVNGLNINNAYIQVNGNSGIVLGAD
FT                   TGDINVTGGKVELTEGGVLFLVKNGGNVNISPSTVIITPDSGIELFRVIYSNYTNTAGT
FT                   KLEIPKESVAIHGETGIITNDGELVSKLISGVPAESSIGIYIENTLESSPGVLLHSNMS
FT                   SQGINNNKIDLGNKGIGIFGENSYIKNETTGTITIADNGAALYASIGSILENAGAINIG
FT                   ENSVGMYALDRTGSPSYTGLTKENYLINSGQIISSGNNTVGISSTGAEPLVKSEITNNG
FT                   VISVTGTNTTGIYGSHTNILNTGNITAGNGFDSGLTIEYAAGIIGNNSSINIQSGAIQS
FT                   GNYSIGAAATGDSVLNITGGTISVGDNSIFNYIKRGTGTNVTLTDSSGGTYDLNRSKQI
FT                   GIYSEEGDVASNKTLEVRSGTGSIGLYAQNNGNVNMTLQGLTINVENGQKGVFAKGISG
FT                   SGVKTTLANSVNLNDNSALGIIHQDGDIENNGFTNVSGIGSVGILSSNSDNLNTNTMLN
FT                   NGGINVNSDSGIGIYGTTLNNAQLNVTNTGNLNLAASSSSNDVILGIYGENGAEINNTG
FT                   NIVIGASSIGIYGKGIDINQNGGVLSADKNALGIYLNGGTGNVNNTAINIADDNGAGIY
FT                   ATNSAGVTLGNTNNLNVGDTSGALSGSAAGSFGIVGKDGSIVTNNANMNIGLASIGIYT
FT                   ENSTITNNGNMTAAGGGTDTKDGRVLIYGGRADIGNIGSAITNTGILNAGDMGVGIYSN
FT                   TGSIVNSGDITVGNTYQNPSNPSDRQYAVGIYGVGTTSINNTHKITFGDNGLGLYAYTP
FT                   NGTISNSGLITSSADNGVGVYIEKGDTITGVTQEFINTGQIILTGNNSIGIAGVDNVKI
FT                   INNNLVETTGANSIGIYADTYSIVENNGTVRSTGTNGIGILLKNNSVLINNGIIDINIS
FT                   ANGRAIVTDGTGSTSDLTAVHTGTVDASASSPVDHVGSGPSYSKPSIINAGIIKVNERF
FT                   EVPEDAIIQIKVDPSSVKEASLATSDYHPEDVNGKYLISNAVQFIADEFVLRNIQVTSD
FT                   FSQGTNHKTYKLEDVFVPLTAGGGINYGKAAIKSKGILWEAIPITNSNGNLDIWMTKRD
FT                   LTEFGEGLSWEEMASILDKNYEDATGDRLSLYDKIDKIETESDLRRIMTSLSGAYYANR
FT                   AQRGYDIKRGFDNALDLMENSENNTKENVKVSVLAGAGKTYENKEGVMDYKYETAGVYA
FT                   LREVERTYAHKFGYSLGYARNSFELQDGNNSEEWVDTLQLGVHNIYRKNSWKLRSDLTG
FT                   RLNLHNVDRNIDWTDSIEKLDDKYMSYGVSLDNTLLKEFELNKVLKISPLLSLDFGYQY
FT                   LDKVKEESSVSALEIDSNNAYSIKPGAGIRVDSNIPLGSRSAWELKSALEVKYEYELGE
FT                   AQPEETARLQSFGETYKLAKPAEDKGELKLKGMLGVEVTDRYGIFITGEYGKAFNEVTK
FT                   DGESYKVGVTLKAVF"
FT   sig_peptide     374825..374902
FT                   /locus_tag="Sterm_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.701 at
FT                   residue 26"
FT   gene            382889..383452
FT                   /locus_tag="Sterm_0332"
FT   CDS_pept        382889..383452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0332"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vvy:VV3093
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07216"
FT                   /db_xref="GOA:D1ALU8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ07216.1"
FT                   /translation="MDRKEVIKITLELMKEKKLEKTTIGEIVKRLDLSPGSLYYHFKNK
FT                   SEIYKEMADYSLEEITRNLNEVRTAESNKNKLFILTRALIKFLEEREEILFFLISMKGS
FT                   CYLEEEIKSQDFLINFKNILLTEQQDVNHKKRMLLKLNMFLGSIYEVLYDSKLVNGRNL
FT                   AEYEIRDIHASFWGNEILDTKYNN"
FT   gene            complement(383991..385580)
FT                   /locus_tag="Sterm_0333"
FT   CDS_pept        complement(383991..385580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07217"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALU9"
FT                   /inference="similar to AA sequence:KEGG:Rmet_5016"
FT                   /protein_id="ACZ07217.1"
FT                   /translation="MTTKKFFKKLCLLGTMSFALTSSLYAESLPKPNPYLSAPVYGLTH
FT                   FDPAQTDSVPYAVKSGTYNIDLNKLKNVNGGPVNIITLASTSQNYMWGVSSQGVSYIDI
FT                   SNGNFKEAARLDAPGIKVITPEVHKQVLGKKYKTAKEVEDAVANIYGLGTTRIFNGIYS
FT                   VVDNNNVVYADYVDGSDPVIYAFALKDSSNPSKGIEIIGTLNLKNVLKQGETLAGVSLT
FT                   YDGKLIIVGNRSISVTDRSLKGELQTVRFGDDEYISNSVAVDEKNGIYVASDKYMRKVV
FT                   WTGTKLSTDEKDGAWASLYDTGIEPPTVKVGKGTGSTPTLMGFGNDEDKLVVITDGANR
FT                   MNLVAFWRDNIPANFKQKPGTKSNRIADQIKVTAGLPESTEFVQTEQSVVVKDYGAFVV
FT                   NNIGQPGPKDKLAGVIALGPVTTPPVGAERFEWDTKTDSWKSVWTRNDVSSTSMVPAVS
FT                   TKSNIVFVNGYSAKAGWEVTGMDWNTGKTVHRTVFGYNNYGNGAYAIIQFFPNGDMLFN
FT                   SIAGPFRIKYTK"
FT   sig_peptide     complement(385500..385580)
FT                   /locus_tag="Sterm_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            complement(386500..386973)
FT                   /locus_tag="Sterm_0334"
FT   CDS_pept        complement(386500..386973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07218"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07218.1"
FT                   /translation="MRKADDILDYCIKNLKGTVLIETWGEKAVFYNPGNILKKGVYVLT
FT                   IKEKDGENDKASGLDRKDIFRVNLGLRKEAFIKLFGEIPARPAAGAVVDMNYDFKKTDE
FT                   ILPHPVYAWMGWISILNPAKNTDNTLIPFINEAYSFAKEKFEKRHSKIQKKLK"
FT   gene            387253..387555
FT                   /locus_tag="Sterm_0335"
FT   CDS_pept        387253..387555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07219"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07219.1"
FT                   /translation="MENKSLDDIFSELAEKYSESTNIKKEAADIKNNFMNVNKANISSH
FT                   SVGNLQSPVNITGEKLPELFTGKNIILKINKESLDIKDIDFEIDKKLFNHDYLKM"
FT   gene            387706..388917
FT                   /locus_tag="Sterm_0336"
FT   CDS_pept        387706..388917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07220"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07220.1"
FT                   /translation="MGERAAVIIETPSATFQMNKILKFRSFQSMEITYRQIAETIMAEY
FT                   PDITAYIGNEFDRNIEKIYMQYNENDWDFLVRICKDMGIPMASHLNEIVMGNEINLEVY
FT                   NAQLNNAVYGRGRERENIIFRVRESTDPYNTGERVKITLANQGSRGEEGSDTRIVSKAL
FT                   LKIKDNYVVNDYELIEMSHEFETVNNSGGYIIEGKVMETGGVDGVATMKIDFSHGLEKS
FT                   AGSKFQAYEDEYAGAYNFPYCTEYSSSNSGMFCTPEKGDVVTVYIPNNNENFSYITGAV
FT                   NNPGSERFSNPNVRNYTLAGDESAGGVPMFDFQLNSRVFGISVTDNVNMNAKNSMDLGV
FT                   GSGNFNVNAKGKNEIIEGETVVISQNINQTVSGETVINSVGNTTINSGGFSVVKAGTNV
FT                   IING"
FT   gene            388948..389745
FT                   /locus_tag="Sterm_0337"
FT   CDS_pept        388948..389745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0337"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Sel1 domain protein repeat-
FT                   containing protein; SMART: Tetratricopeptide domain
FT                   protein; Sel1 domain protein repeat-containing protein;
FT                   KEGG: geo:Geob_0947 Sel1 domain protein repeat- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07221"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV3"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACZ07221.1"
FT                   /translation="MKKLCISVVSLLVIFSCGKQNLPDKVEEHIKKNLGDNPNKQQIEE
FT                   LLISGQVIYGSRPEEAKKYFEAAAKYDPRGAYALSDYYLEKEDYENFEKWVKQAAEGGD
FT                   SRAQFNLGYYYDERNRLEEAKRWYIKAGEQGDSEAQFNLGIIYFNENNWNEAEKWYLKA
FT                   IQNNHSKAYNALGRIYSEEKRFKEAEYMYLQALESGNNSWQIYSNLGYLYYELGDYSKS
FT                   LKFLEIALSKDKENKVINCNIMKTKEKLKKYDGITINRKNCKK"
FT   sig_peptide     388948..389007
FT                   /locus_tag="Sterm_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.594 at
FT                   residue 20"
FT   gene            389899..390735
FT                   /locus_tag="Sterm_0338"
FT   CDS_pept        389899..390735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0338"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein;
FT                   Tetratricopeptide domain protein; KEGG: hip:CGSHiEE_05405
FT                   Sel1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07222"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV4"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACZ07222.1"
FT                   /translation="MKKIFILTMSLFLILGCGRGNSSDRVEEHIKKNLGNNPTKQQIEE
FT                   LLISGQVIYGSRPEEAKKYFEAAAKYDPRGAYALSDYYLEKEDYENFERWAKQAAEGGD
FT                   SRAQFNLGYYYDERNRLEEAKKWYIKAGEQGNVGAMLNLGLIYDIENNINEKKKWYLKA
FT                   AESGNIQAQYNLGVMFMEKNQNIEAEKYFLNASLEGDSDAQNNLGIVYKRIGNFKEAEK
FT                   WLLKSSKQGNIKAQYNLGELYEEKLNNKEKAIYWYEKSFSLGDNDSEKKLIELRGK"
FT   sig_peptide     389899..389967
FT                   /locus_tag="Sterm_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.939 at
FT                   residue 23"
FT   gene            390742..390987
FT                   /locus_tag="Sterm_0339"
FT   CDS_pept        390742..390987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07223"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07223.1"
FT                   /translation="MDNIDKKYKIFYIPKKTYGEKIQRTQYQKIPKGSEKIYICDGGIL
FT                   TCPNIGKILLNSKYLIKEKNEKNIYTYNEFVFNIRV"
FT   gene            390935..391831
FT                   /locus_tag="Sterm_0340"
FT   CDS_pept        390935..391831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0340"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Sel1 domain protein repeat-
FT                   containing protein; SMART: Sel1 domain protein
FT                   repeat-containing protein; Tetratricopeptide domain
FT                   protein; KEGG: lpf:lpl2147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07224"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV6"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACZ07224.1"
FT                   /translation="MKKIFILIMSLFLILGCDSGNSSDRVEEHIKKNLGNNPTKQQIEE
FT                   LLISGQVIYGSRPEEAKKYFEAAAKYDPRGAYALSDYYLEKEEYENFEKWAKQAAEGGD
FT                   SRAQFNLGYYYDENSRLEEAKRWYIKAGEQGDVGAMLNLALLYENEKDEKKAEKWYLKA
FT                   AEAGNAQAQYNLGIIYMENADFNKAEEWYLKAANQSHLSSYRALGYIYSEEEKYKEAEK
FT                   WYLKALEMGDQSKEIYNNIGNLYFNINEFEKSLYFFEKALEKDSNNVTINCNILKVKKK
FT                   LKDGSNTEKNEEKCNIK"
FT   sig_peptide     390935..390997
FT                   /locus_tag="Sterm_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.309 at
FT                   residue 21"
FT   gene            391851..391943
FT                   /locus_tag="Sterm_0341"
FT   CDS_pept        391851..391943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07225"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07225.1"
FT                   /translation="MEFKGIKTVYFYGDSNSMGRTGILLIVNIR"
FT   gene            391966..392862
FT                   /locus_tag="Sterm_0342"
FT   CDS_pept        391966..392862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0342"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; Sel1 domain
FT                   protein repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Sel1 domain protein
FT                   repeat-containing protein; Tetratricopeptide domain
FT                   protein; KEGG: gur:Gura_0781 Sel1 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07226"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV8"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACZ07226.1"
FT                   /translation="MKKIFILVMSLFLILGCDSGNSSDRVEEHIKKNLGDNPTKQQIEE
FT                   LLISGQVIYGSRPEEAKKYFEAAAKYDPRGAYALSDYYLEKEDYENFEKWAKQAAEGGD
FT                   KRAQFNLGYYYDENNRLEEAKKWYIKAGEQGNVGAMLNLALLYENQKNEKEEESWYLKA
FT                   AEAGNAQAQYNLGVINRNKKELKKSEEWYLKAANQNHLSAYRALGSLYSEFKKYKESEK
FT                   WYLKALENGDQTKEVYNNIGNLYFEIGEFRKSLYFFQKAFEKDPDNKMINCNILRVKEK
FT                   LEDSDNIKIYKEKCGVK"
FT   sig_peptide     391966..392028
FT                   /locus_tag="Sterm_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.312 at
FT                   residue 21"
FT   gene            392889..392981
FT                   /locus_tag="Sterm_0343"
FT   CDS_pept        392889..392981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07227"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07227.1"
FT                   /translation="MEFKAIKAVYFFGDNDSMGRTGILLIVNIR"
FT   gene            393004..393900
FT                   /locus_tag="Sterm_0344"
FT   CDS_pept        393004..393900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0344"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; Sel1 domain
FT                   protein repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Sel1 domain protein
FT                   repeat-containing protein; Tetratricopeptide domain
FT                   protein; KEGG: hiq:CGSHiGG_00130 Sel1 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07228"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACZ07228.1"
FT                   /translation="MKKIFILVMSLFLILGCGSGNTSDKVEEHIKKNLGDNPTKQQIED
FT                   LLISGQIIYGSRPEEAKKYFEAAAKYDPRGAYALSDYYLEKEDYENFEKWAKQAAEGGD
FT                   SRAQFNLGYYYDENSRLEEAKKWYIKAGEQGNVGAMLNLALIHGNENNKKEEEAWYLKA
FT                   AEAGSAQAQFNLGVIDKNKKEYRKAEEWYLKAANQNYVPAYKAIGALYSKKKDYKEAEK
FT                   WYLKALEMGDQSKEIYNNIGILYSKMNEFEKSLYFLEKALKKEPDNKMINCNILEVKKK
FT                   LQNSNDVDIYIEKCNMD"
FT   sig_peptide     393004..393072
FT                   /locus_tag="Sterm_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.949 at
FT                   residue 23"
FT   gene            393927..395144
FT                   /locus_tag="Sterm_0345"
FT   CDS_pept        393927..395144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07229"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07229.1"
FT                   /translation="MEFKVIKTIYFSNSENNTGRDEEFEIQQEKTTTQYQKIPKGSEKT
FT                   YICDGAILTCPNIEKDTILTASGEYDASQKISFLVTEPKALLMGIDPLGSDKDIKPENF
FT                   SVSKTTKCEKSPSGFCEIKEKAVRWENTSELVINKFKALRLNSYLVCKVDPSVKVKFES
FT                   NGQDLMLVTADLQRDFKDIWSPETAAVLDLSIGVLETGIGVAGLAGAGISVTNPMTIPI
FT                   ALQLAPESGLLILDGGRRTINATLKLNDQHKLDNMSIEEMKDYKEPDILAMTVGSILGD
FT                   EEAGDNFALGYDTAGLVGSGISAFRNAKQVKKAGETAEWAKKNNILQTEKMANHAEGSK
FT                   KWNKALNRNNSNNRLLEDYYNMKLNNQKSNIKDVAMNVKDSLTPKAAYNLKISYANEPF
FT                   FMYMGD"
FT   gene            395146..395949
FT                   /locus_tag="Sterm_0346"
FT   CDS_pept        395146..395949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07230"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07230.1"
FT                   /translation="MRDLNKKYRYELENITDIDGITENIKWTSELHIKTLEELESSNPY
FT                   QKGKFYLLGIKEKKLQFENETNNSYLSELEEIFSCLFIIVNEKMKIQDVPNYDMLIEKF
FT                   LITMEYVDEMNLKAGSIVLLSEILAEKDRLIYFLSSNRIFRHLFFPLYRFDEINFYGRL
FT                   PETIEYEFFDLIPGIMIPMRLKKIMNNGKIIISGEKDDLLLSDYSLERIIREKYNHNMR
FT                   RYNLDYKAAIASDKENGFVKDYVFYSQLEIDYDINIFQKVKIIEI"
FT   gene            395963..396781
FT                   /locus_tag="Sterm_0347"
FT   CDS_pept        395963..396781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07231"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07231.1"
FT                   /translation="MSEHFLKFSSGFEKNYELIQEGYRDDEIEYQSKSRMEIKIEKNKY
FT                   NDFECKMKIIYGESNFCVNSFKTAFVTELYKKYNYYNLILNSENKIIKVKNKREIIKNL
FT                   ESDSFSYIKKYPEKGQLLVYLIQKFKSMMENEEIFKQNMMNTHILSYFFIDIYNKAYNN
FT                   AESVNVRKNFDDIIYGLSIPFIFDIKLSGNNEDTVSLLYEAEMENKQEIPTLLKKYFGN
FT                   SENESFGFDTKIIGNYKFDKIHGFMKEMNTTRILSAEGKNYKTVYRIMEK"
FT   gene            396963..398204
FT                   /locus_tag="Sterm_0348"
FT   CDS_pept        396963..398204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07232"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07232.1"
FT                   /translation="MEYINKIIKEALKNIKNDEERNFLRELSTSLIPQLINDFSQKLDE
FT                   IQNEVDNLFQSNNRYINTVPVNKEELENYKETLFPVLNDDIRVIKKDKKKKTDIYLKKI
FT                   FLDMNYKEIENFKNHKLSAKLKNGNNYGLEVYAVQCQDYVEKEKELAEVFESNNIDWEV
FT                   LYTPYSRRFFEIYAKKNSYEINYDNADIEIDYGKYTENIYENYFLAWNIEEKEVLADQI
FT                   SVENIKGRVYEHRIFSSNAKNDLVKIINGKIFRIDREKEKLFVYSDVASSRNWKVWNIK
FT                   DTGKNTYTNLKFKVLGNSKINDFITRFKGNSPLRTRSESEIFEIINSFSDIKNLRLKSI
FT                   TVDEYTEKTADSFDMNKVFNEKKTFKRNNRGKLNLYFECIEKDRYFTDELSYILSCIEY
FT                   KYPEYEVKGITEWK"
FT   gene            398684..400459
FT                   /locus_tag="Sterm_0349"
FT   CDS_pept        398684..400459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0349"
FT                   /product="NAD pyrophosphatase/5'-nucleotidase NadN"
FT                   /note="TIGRFAM: NAD pyrophosphatase/5'-nucleotidase NadN;
FT                   PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: hiq:CGSHiGG_03645 NAD
FT                   nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07233"
FT                   /db_xref="GOA:D1ALW5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006420"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW5"
FT                   /inference="protein motif:TFAM:TIGR01530"
FT                   /protein_id="ACZ07233.1"
FT                   /translation="MKKLFIFLCMAAGITAFSATTAKKVPAGKDNFEINIIHINDHHSH
FT                   LEAEKMDLVLGGKKTKVTIGGIGRVASKVKELRAKEKNPLVLHAGDAMTGTLYYTLFNG
FT                   VADAEEMNSIGFDAFTLGNHEFDGGNEGLLKFLNALKVPVVSSNVVPEEGSILAGKWTP
FT                   YIIKNVNGEKIGIIGLDIVGKTRDSSNPGKDIKFEDEVTTVQKYADELAAKGINKIILL
FT                   SHFGYENNVDLAKKVSGIDVIVSGDTHYLLDRNFEKFGLKVEGDYPTGVTSKTGEPVYV
FT                   VEAWNYSYVVGHLKVVFDKNGVIKSVAGTPQLLLGDDFFERRNESGEKYQIEGAEKQEV
FT                   LREIAVNPELSLVKPDAKAETILKKYSDQKQELGKIVIGTVKDEIPGGSENRIPDAKNP
FT                   NGSYATQLVAESMLYTLQHMGTGEADLVIQNSGGVRISIMPGEFTYDSGYTLLPFSNTL
FT                   YTLKMTGAEIKAVLEDALDFALKPGGSTGSFPYGAGIRYEAKKAGTLGNRVTKVEVKDR
FT                   QTGKWTNIDPKKMYVVGTNAYIASGKDGYVTFGKVNEERGGTDTYLDDAKAFIDYVKEV
FT                   KEIKKPDSTGVKFTF"
FT   sig_peptide     398684..398740
FT                   /locus_tag="Sterm_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.309 at
FT                   residue 19"
FT   gene            400501..402144
FT                   /locus_tag="Sterm_0350"
FT   CDS_pept        400501..402144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0350"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: apj:APJL_1779
FT                   2',3'-cyclic-nucleotide 2'- phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07234"
FT                   /db_xref="GOA:D1ALW6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW6"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACZ07234.1"
FT                   /translation="MKKIIVLTMLVLSALGFAKEVNIKILGTSDVHGHIVPWNYQTDEF
FT                   DDSGSYSQIAKMVDGYRKGNKNVILVDAGDIIQDNLIERFINEPRHPAMLVLNQMGYDV
FT                   MVPGNHEFNFGMPALDNVLKQFKGKALAANIYYDNGANYLPASTIITKEGVKIGIIGVT
FT                   TPLTEKFEENTGNVKGMKFTMPIPELRNQVNSLRGRVDAIVVVAHMGLPNENNIPGTGV
FT                   IDIANEVPGIDVIIAGHFHKDVSKETVNGVLITEPYKYGMSLSVVDLKFNVEKGSVSLI
FT                   NKDSRTLSVKGEDSEQGIEVIYNPFHQKLREEVNQVIGETANNMVPEGKIKGIPYAFAS
FT                   DTGLSSLITAAELYYSKADVVSFSYDTENVKLEKGPIRRKDIYANYRYAGGEVTVYEMT
FT                   GRDLKDYMEWSAGYFDTIRSGDTEYKYNAERRNFKYVTYDIFGGVRYKIDLKAAPGSRI
FT                   RDLTLVSSYKRITDNMKVRVGMNSYRYEMLVQKGGPLEGRNIKKVWDSKEAMGQEKGTI
FT                   QNMVINYIVDVRKGKVTGLSNNYWSITGLR"
FT   sig_peptide     400501..400557
FT                   /locus_tag="Sterm_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            402175..403914
FT                   /locus_tag="Sterm_0351"
FT   CDS_pept        402175..403914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0351"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: hpy:HP0104
FT                   2',3'-cyclic-nucleotide 2'- phosphodiesterase (CpdB)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07235"
FT                   /db_xref="GOA:D1ALW7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW7"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACZ07235.1"
FT                   /translation="MKRLVLLLLTLLSLLSFAKKVNIVILETSDLHGRLFAYDYAIDQP
FT                   DKSAGIVKVATIIKEERAKNKNLILADNGDTVQDNSAELFNSEQVHPMVQALNDLKYDF
FT                   WTLGNHEFNFEKEFLERNIKGFKGTVLSSNIIKDDGKTFVTPYVIKNIDGVRVAFVGMT
FT                   PPHIPMWEASTPDHFAGLKFIEPADAVNNTLKEIDGKYDVLVGLFHIGRTDEKDGDGVH
FT                   KLAEKFPQFDIIFGGHEHAVYVEKINGVTLIEPGSYGSNVAKGEITFDTVTKEKTVTAK
FT                   NIPTKDVAEDEAMKKKFAYVDEKSKAYSNEVVGEVTETFIKNPDFITGEKEITTMPTAQ
FT                   LMETPVMELINEVQQHFAKSDVSSAALFNFGSNLEKGPFKRKDVAFIYKYTNTLMGVNI
FT                   TGENLLKYMEWSADYYNQLMPGDLTISFDENVRGYNYDMFYGIDYKIDITKPKGKRIID
FT                   AKINGKPVDKKKVYKLAINNYRFGTLLTLGLIKESDMYYDSYAELQDGGRVRDLIIKYI
FT                   TEEKNGKVTPVLKNNWKIVNYNFNNPLLEKLKEKVISGEIKIPASSDGRTLNVKSIKES
FT                   EVK"
FT   sig_peptide     402175..402231
FT                   /locus_tag="Sterm_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 19"
FT   gene            404533..405417
FT                   /locus_tag="Sterm_0352"
FT   CDS_pept        404533..405417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0352"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hypothetical LOC583677"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07236"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ07236.1"
FT                   /translation="MKTIIITGANSGLGFECAKNILLENPGYFIVMACRSIEKAEKSKS
FT                   ELIKMTKNENIAVMELNLSSLNSVRKFAENFKQAGYPPLFGIVCNAGISNSNVGVTEDG
FT                   FDIVFGTNHLGHFLLTVLLLPLVEENGRITVVSSDMHNPPNGLTYRGAEELAHPASKIN
FT                   DIYSQSKLCNLYFTYELAGRLSEMGRKITVNAFNPGLLTDTNFHVNSTRSFSEDFMKKV
FT                   ADRIGYLSESGKALADMVTKPYYGENTGKYNDRGEEIPSSELSYNAENAKKLWESSVNY
FT                   TKLQKNETLDGLL"
FT   gene            complement(405598..407334)
FT                   /locus_tag="Sterm_0353"
FT   CDS_pept        complement(405598..407334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0353"
FT                   /product="Carboxylesterase type B"
FT                   /note="PFAM: Carboxylesterase type B; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07237"
FT                   /db_xref="GOA:D1ALW9"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALW9"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /protein_id="ACZ07237.1"
FT                   /translation="MKKKFLKLLAILLLVSVTATSAETVSQSAKSTINVQTSIFRENTV
FT                   RNTEFGVIKGKIDTEHNVLIWTGVPYAKAPTDELRWKKPVNPDKWSGILNTEKPGNIAL
FT                   QASGDGITGSEDCLNLDIYRPNTDSKNLPVILYIHGGNNQGGKSGEITGNALVNDLDAI
FT                   FISVNYRLGPLGFNPLPALNTGDNEEDSGNYALLDMAKALDWTKNNIANFGGNPENITI
FT                   SGFSAGGRDVMAMLISPTFQGKFQKAVSFSGGMTIADKAASEKVFAKAIAPLAVQDNIK
FT                   KNEQEAYKWLLTKDPAVKTYLYGIKAERLAPLMGNAGIRMSVFPHLYNDGNVIPENGFE
FT                   TKNYNPVPLLMLTGSSEFSMFAKFDPYFGQYFKDDQISGKGLKEFNFASKYGGKLYGLF
FT                   NVEDSTEKMFPNYKADIYGMEIKFGDNKEAVGEKMALYGAFHGVFVPLLDTDSQNYTWL
FT                   AGDAYNSAGAQELSLIFKKYLYNFIRTGNPNGENLVYWDKWSKENEKLGKSLLYLDADT
FT                   KQAYSYMGKKEFTYKDVLNEMDRDNTITKEAKKKIISEVLNGRWFSGGLDKKYRNKQLW
FT                   PE"
FT   sig_peptide     complement(407266..407334)
FT                   /locus_tag="Sterm_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.530 at
FT                   residue 23"
FT   gene            407650..408771
FT                   /locus_tag="Sterm_0354"
FT   CDS_pept        407650..408771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_01205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07238"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07238.1"
FT                   /translation="MNFENGTILEIKPSNRNKNIFAVFCDSQVLYLADVSNGKTVKTGV
FT                   FENIKMFSKPVNMDFYYPYICISEKYGLNASVINIETGKIQKFSREDYHADVSVYSTGF
FT                   IERDGKILLIHQTQWNRLDITDLESGEILTKRDIKIELTPDKHNKKTGEIIKGKRKSEN
FT                   YLDYFHSSLHISPDGKNFLSNGWVWSPVDNIRCFNVREFFSKYELCSFGIEYANGYNWD
FT                   RPCTFIDNDTFVIIADDHTKELDEEELKEYEYRQLQFYRLNDITDDKWLKSFKTIKTDI
FT                   FECDPVYGEVNGELYFDKKLNKLVALNDREAYLVTLEGEITEKIPDIKYDSASDKKEDI
FT                   FRNAKRWKYSSEHHFFYRFSATENTMKIKEIII"
FT   gene            complement(408906..410114)
FT                   /locus_tag="Sterm_0355"
FT   CDS_pept        complement(408906..410114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0355"
FT                   /product="Phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="PFAM: Phosphopentomutase domain protein;
FT                   metalloenzyme domain protein; KEGG: cko:CKO_04800 putative
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07239"
FT                   /db_xref="GOA:D1ALX1"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX1"
FT                   /inference="protein motif:PRIAM:5.4.2.7"
FT                   /protein_id="ACZ07239.1"
FT                   /translation="MKRRFIVIVLDSFGVGYMDDVPEVRPEDIGANTCRHILEKFPKLQ
FT                   LDNLEKLGIMNALGEEVGAMKKSSFCTYGKAKLMHYGGDTFFGHQEIMGTLPRKPLMKP
FT                   FSFYLEKVYNALLEKGYKVEKVGNNLKYLLVNGCIAVGDNLETDLGQVYNVTSTLSELT
FT                   FDEILKVGRIVRQNVEVARVIVFAGENSSIESIKAAAEEKEGTYMGINAPKSRVYEKGY
FT                   MVRHLGYGIDPETQVPTIMGKDGQNAILIGKVADIVENDHGKSYMGLVDTKTIFDITLD
FT                   EIDKINEGFICVNIQETDLAGHAENTARYAEILELSDKYIEKIMEKITDDDILIVTADH
FT                   GNDPTIGHSRHTRENVPLLIYKKDMQNTFIGVRDSLSDIGATAAEYFNIKMPQNGKSFL
FT                   NKL"
FT   gene            complement(410118..411281)
FT                   /locus_tag="Sterm_0356"
FT   CDS_pept        complement(410118..411281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0356"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   cko:CKO_04801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07240"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX2"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACZ07240.1"
FT                   /translation="MFIDILIEKNPKLIQTALSLHTNGTIMPDSYIIDVDIFKENAELI
FT                   KAESDKHNINLYYMTKQIGRNPYLAKILEDLGYSGAVAVDFKETEVLMKNNLKLGNTGH
FT                   LVQIPSKMIGKVLKYGTEIMTVYSFEKACEISEEAEKLGIIQDIMFRILDEKSSIYPGQ
FT                   EAGVDLCDLEDITKKILTLKNVRINGLTSFPCFLYNETNNTIEKTENIGVILKAYNILK
FT                   EKFNIKVKELNLPSSTCIENIKMIKENEGTHGEPGHALTGTTPFHVNRKAVEKPAYVYV
FT                   SEISHNFRGKSYFFAGGHYRRSHMKNVLTGSSYENLTKVNTEDFDPNNIDYYLGLSKEQ
FT                   KIGDTVLGCFRTQFFVTRSDIILVEGIQSGKPQIIGRYTALGERIEV"
FT   gene            complement(411297..412391)
FT                   /locus_tag="Sterm_0357"
FT   CDS_pept        complement(411297..412391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07241"
FT                   /db_xref="GOA:D1ALX3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX3"
FT                   /inference="similar to AA sequence:KEGG:plu2000"
FT                   /protein_id="ACZ07241.1"
FT                   /translation="MQTFPLKSINLEEAKKKQFKLVDIITRHMTGSESLTLGDLGVTQG
FT                   INKPMRTKTVEDILAEFFSAEACILLRGAGTNALRWGFLTILHPGDTLLVHDAPVYPTT
FT                   ETTIESMGLNVLRTDFNNYKETENMIKSNSIDMVLIQHTRQKPEDSYNLAELIKTIRTA
FT                   DSNITVIIDDNYAILKTEKNGIDSGADLSAFSMFKLLGPEGIGCLIGKKELIDKIRSKN
FT                   YSGGGQVQGHEAMEVLRGLVYAPVALAIQAEENEKLVSELNNNLKYPYIKQAFLANAQS
FT                   KVLLIEFYDEIAEKLLTEAEKLGALPNPVGAESKYEIAPLFYRVSGTFLKSDPALAKRM
FT                   IRINPNRAGFETIIRILENAYKKL"
FT   gene            complement(412429..413469)
FT                   /locus_tag="Sterm_0358"
FT   CDS_pept        complement(412429..413469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hCG2031650 ; K01175"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07242"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07242.1"
FT                   /translation="MKKEYLKKLFYSFLKGKEYTGKSVVIQNLSIIDKITETLCENNEE
FT                   IKLLGVKNTSDIDRKIIQKLTKSKKFYWHTIDKTADNGRAVDTNLTNPLTGRAMTGSSS
FT                   GTAINVFLGINDLGIGTDGGGSVIYPALSLNLYSFAGSGTGLKSKKIKNSTDGLTFSAG
FT                   IGFLARDLETIHTAVLILLDADIISSYSDYKIAVTEDLKNYAIFENIKNKEFITDHFKN
FT                   TDDRTELMSIFQKVFEKYDILIIREELIDITFYGDSIMGNLGKKSKEYQFLSNKRAGKV
FT                   INMMNLSAITVPSDELSSGFIIIAKTGKEYIKPLFEAAAILKGSENQLFKRYFSDFLEN
FT                   DSIIFE"
FT   gene            complement(413551..414852)
FT                   /locus_tag="Sterm_0359"
FT   CDS_pept        complement(413551..414852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0359"
FT                   /product="conserved hypothetical protein; putative inner
FT                   membrane protein"
FT                   /note="KEGG: ecq:ECED1_4035 conserved hypothetical protein;
FT                   putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07243"
FT                   /db_xref="GOA:D1ALX5"
FT                   /db_xref="InterPro:IPR019733"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX5"
FT                   /inference="similar to AA sequence:KEGG:ECED1_4035"
FT                   /protein_id="ACZ07243.1"
FT                   /translation="MTINIYKIIFVALLTGFTSFAAHTAKAVFHDGIRPILPELTEGRM
FT                   KRSEASSIAFGLSVGFIASIGISFTLTTGLLNPWLLFLPTDIIGVASPKKSISFGLGAL
FT                   WGILVVTSLDIVNKGLTALPVDFLGALGEIGTPVIAAFALFPILAIFYQFKWKKGLIAA
FT                   VVVLLTRVLVVKYTKLYPESIEMFIGIVMLLAFAIIEDSKNKVQVEKDEDEESIFEQRT
FT                   KRVFKNLPVLAVIGALIAIIANLGYFAGSEISIYPLAEAAKATDPAVAKDLIHQAALGD
FT                   FLRGLGFVPLIATTALATGVYGVVGLTFIFPVGYLAPHWIIAGIGGAVVITLEVLLLRG
FT                   IGKFLEHFPSIRHASDNIRTSMENLMDLSLLIGSVFAVIKMGGYTGFFIFVVVYFLNEV
FT                   LGRKIIKMAIGPVGAIITGIVLNLLFYAHLFTPA"
FT   sig_peptide     complement(414778..414852)
FT                   /locus_tag="Sterm_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.925 at
FT                   residue 25"
FT   gene            complement(414881..415246)
FT                   /locus_tag="Sterm_0360"
FT   CDS_pept        complement(414881..415246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ssn:SSON_3509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07244"
FT                   /db_xref="InterPro:IPR021238"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX6"
FT                   /inference="similar to AA sequence:KEGG:SSON_3509"
FT                   /protein_id="ACZ07244.1"
FT                   /translation="MIRIGVAGLKKDLTEKTIIENGNGNFEVLVTTDMDAAKKIKKGEL
FT                   DYYFGACNSGGGAAISILIGMIGYGKCSTVAKAGGSAPDKDQIKKLLAEGKVAFGMSVE
FT                   NIEKTVPVLLESILESK"
FT   gene            complement(415274..416146)
FT                   /locus_tag="Sterm_0361"
FT   CDS_pept        complement(415274..416146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0361"
FT                   /product="aryldialkylphosphatase"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: yen:YE1042
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07245"
FT                   /db_xref="GOA:D1ALX7"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX7"
FT                   /inference="protein motif:PFAM:PF02126"
FT                   /protein_id="ACZ07245.1"
FT                   /translation="MLEKGITYIHEHIYIDLSKIKNSDDTLLDDKETMISELREIKEKG
FT                   VRNIVEVTNIGMGRNMEYMEDVRKQTGLNFIYSTGFYIEPFFPETVFQKTDKELAQIMI
FT                   NEIKNGIDGTGIKPEVIGEIGSSQNIITETEKKLFQAAGIAQNETGKVLSTHTSIGSMG
FT                   LEQIKILKEYSVNFEKVIIGHTDLSNDLDYMLRLLDYGVYTAFDTIGKNSYLLDEKRAE
FT                   AIKELIKRGYGDKIVLSMDITRKSHFKKNGGLGYSHLLDTFVPMMEKAGISKADINKML
FT                   ITNPENIFS"
FT   gene            complement(416169..416519)
FT                   /locus_tag="Sterm_0362"
FT   CDS_pept        complement(416169..416519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0362"
FT                   /product="PRD domain protein"
FT                   /note="PFAM: PRD domain protein; KEGG: ect:ECIAI39_3860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07246"
FT                   /db_xref="GOA:D1ALX8"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX8"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACZ07246.1"
FT                   /translation="METERLDILVEAELIDQETYEKVKRIMNEVSEEFTLDLSTESGQM
FT                   FITHVSMAIMRIKNNEATTDVENAIFEEIKESENFENALRFAEIIENIIEHEIPKNEKE
FT                   YLVINGCLLMEQ"
FT   gene            complement(416936..417847)
FT                   /locus_tag="Sterm_0363"
FT   CDS_pept        complement(416936..417847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07247"
FT                   /db_xref="InterPro:IPR032791"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041444"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALX9"
FT                   /inference="similar to AA sequence:KEGG:PBPRA2775"
FT                   /protein_id="ACZ07247.1"
FT                   /translation="MKEIVLLKKNGQAIINIAKAFLEINIGDRMDSIPEYSKKFELSVG
FT                   TIQKAIKFLEDEKMVTLERKGHMGTTVKNIKYEKLLNYAGISTVVCVMPLPYSKRYEGL
FT                   ATGLKKCFSDKKIPFYFAHMGGADIRINFLEKGLYDFAIVSKLAANQAIKSGKKIEIAY
FT                   EFGENTYVDKHVLFKNENTVIKKVGIDPDSKDQYLLTKDYFKGNDDIELVKINYNKIPE
FT                   LLKRGIIDATVWNLDEIKEQNMNIQYEELKNKTQVNLANEAVLVVKQNDSALKNIADKV
FT                   IEREFILQMQKDILEDKLYPSY"
FT   gene            418170..418931
FT                   /locus_tag="Sterm_0364"
FT   CDS_pept        418170..418931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0364"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; KEGG: haloacid
FT                   dehalogenase-like family hydrolase ; K07024"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07248"
FT                   /db_xref="GOA:D1ALY0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY0"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACZ07248.1"
FT                   /translation="MELFVTDLDGTLLYKENEVKESTAELVKEMQKNGIKVATATGRIL
FT                   RGVRFLKEELGLNLDYYVLGNGSVITDSNFNIIYKRTIDYKIIRAVYEYLENIQLKGFR
FT                   NALTNENVYCLTGKPENDRPFFHESSIDEIADKEVVSFVTNYEGRDMKAIEEIAADMKQ
FT                   KFTEVEVFQNKHFIDVAPKGASKAAGIKTVMEKLGDIKKLYTIGDSYNDIPMLKMTENS
FT                   FTFQSSPEAVKNRAGTVVSDFDECIKKYVLK"
FT   gene            complement(419008..419592)
FT                   /locus_tag="Sterm_0365"
FT   CDS_pept        complement(419008..419592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0365"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   pen:PSEEN0989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07249"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY1"
FT                   /inference="protein motif:PFAM:PF07007"
FT                   /protein_id="ACZ07249.1"
FT                   /translation="MRRNNTALIVIIAGIFLFLLLAVGSLAYAVFVNGSKTTAVETAKS
FT                   EKTDDEEDKETGDTARTEKKTEKPKESKVTLAELKEKKAKNNEYSDNLAIRMKPIHRSY
FT                   TGGDLDYENTDQINEWGGAWDDELNAVYQALMKKLTPSQQEELRTEQRKWIKQRDAKLN
FT                   ESGDHLVNADLFYNLTMDRTYELAELYDKVK"
FT   sig_peptide     complement(419509..419592)
FT                   /locus_tag="Sterm_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.509 at
FT                   residue 28"
FT   gene            419973..421067
FT                   /locus_tag="Sterm_0366"
FT   CDS_pept        419973..421067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0366"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: ecr:ECIAI1_1938
FT                   sugar-binding transport (ABC transporter) ATP-binding
FT                   protein (CymD protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07250"
FT                   /db_xref="GOA:D1ALY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ07250.1"
FT                   /translation="MANVTLKGVEKQYPNGFKAVHGINLDIKDGEFMVFVGPSGCAKST
FT                   TLRMVAGLEEITGGEIYIGDKLVNDVAPKDRGIAMVFQNYALYPHMSVYDNMAFGLKLK
FT                   KTPKAEIDKRVRDAAEKLEITDLLDRKPKDMSGGQRQRVALGRAIVREPEVFLFDEPLS
FT                   NLDAKLRVSMRVRISQLHKELGSTMIYVTHDQVEAMTMGDRICVLREGKIMQVDTPLNL
FT                   YNHPANKFVAGFIGSPTMNFLNGVIEEKDGKLLMKVKGTELEFPESMREKIKGHTGKEV
FT                   SFGIRPEHISLGKEGEQNALRGNILVKEQMGNEEIVYFESEGNQITARLTLNQEESLSL
FT                   KESGIFKIDMEKCHLFDIDTELAF"
FT   gene            complement(421197..421853)
FT                   /locus_tag="Sterm_0367"
FT   CDS_pept        complement(421197..421853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0367"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: HD domain containing protein ; K06950"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07251"
FT                   /db_xref="GOA:D1ALY3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY3"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACZ07251.1"
FT                   /translation="MTNIEIIDKTKEYVKNKLEDEGSGHDWWHILRVYNNALDIAEKEG
FT                   NCDIFIIELAALLHDIADWKFNDGNLDKGSEIAGIFLADLNVDEKIIEHVSDIIKNISF
FT                   KGANVKNTITTKEGMIVQDADRLDAIGAMGIGRAFAYGGFMKREMYNPDVSHEIHNTFE
FT                   EYKNKSGSTINHFYEKLLLLKDKMNTKTGKEKAEKRHEFMRSFLDEFYSEWNGEL"
FT   gene            complement(421856..422704)
FT                   /locus_tag="Sterm_0368"
FT   CDS_pept        complement(421856..422704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0368"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ppd:Ppro_3243
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07252"
FT                   /db_xref="GOA:D1ALY4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY4"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACZ07252.1"
FT                   /translation="MGNQIKTFFLMFILILIFMFIGDFIGGQSGAVIGLVLASGINIFS
FT                   YWNSDKMVLANYNAQPITENSNPRVYNIVRSLVRNADLPMPKIYLIPEMQPNAFATGRN
FT                   PEHAAVAVTAGLLETMDDAELSGVIGHELGHVKHRDILISTIAAIFAGAISIMSRFAMY
FT                   SGSGRRSDNDRGANPFAFLLVLLAPVAAMIVQMSISRKREFLADQFGAEVSGNPLYLRN
FT                   ALQKLEAYGRRVPMQHNNPSYSHMFIVNPLANAGAAFANLFRTHPPTSERIKRLEQMAE
FT                   R"
FT   gene            422913..423689
FT                   /locus_tag="Sterm_0369"
FT   CDS_pept        422913..423689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0369"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ret:RHE_CH02947 putative aminoglycoside 3'-
FT                   phosphotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07253"
FT                   /db_xref="GOA:D1ALY5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY5"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ07253.1"
FT                   /translation="MLNKEKLPYDLREKISDMFFTRIDTGESGAKVFKVSSDTASYYLK
FT                   IETAAGELEEEYQKTRWLQGKLEVPDILYFGEENKNKYMLLTEINGRILCDKEHIRNPE
FT                   AAIKLLAEGLVKLGGVDTDSCPFDNRLEKKLEKAAENVRLNRVNMTDWEETTKFSNPES
FT                   LLNYLYKNRPPENEVIFTHGDYCLPNIIAELDEITGFIDLGRAGIADIWQDIALCMRSM
FT                   HRNFGTRKYEELLLEYLGRKQDKEKLEYYILLDEMF"
FT   gene            423815..424630
FT                   /locus_tag="Sterm_0370"
FT   CDS_pept        423815..424630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0370"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sat:SYN_02199
FT                   Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07254"
FT                   /db_xref="GOA:D1ALY6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY6"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACZ07254.1"
FT                   /translation="MKKFKLLLLTLISVFVLISCSSAPITGRQQLKFVDDEKLASESSA
FT                   AYSEFIAQVKQQNLLANSTNDGKRVTAVGNKLAVAVEKYLRENGQAQKVDYLNWEFNLI
FT                   KSDDVNAFAMPGGKIAFYTGIMPIAKNDAGIAAIMGHEIGHVIAGHHAEGKSNETAAGI
FT                   VMIGKQVADIVTGGATSVISNDLVGQGLSLGLLKFNRTQEYEADKYGMIFMAMAGYNPE
FT                   EALAVWERMAAGGSSGGPEILSTHPNTENRIKKMKEFLPEAMKYYNQSK"
FT   sig_peptide     423815..423898
FT                   /locus_tag="Sterm_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.399 at
FT                   residue 28"
FT   gene            424949..425149
FT                   /locus_tag="Sterm_0371"
FT   CDS_pept        424949..425149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07255"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07255.1"
FT                   /translation="MKKLDDGIREIYEVLETLNEGKKEKFNIFSKDEDIVVEELEKLKF
FT                   SYFKKGFLACLLHEEENSVSK"
FT   gene            complement(425190..425819)
FT                   /locus_tag="Sterm_0372"
FT   CDS_pept        complement(425190..425819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0372"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: msl:Msil_1953
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07256"
FT                   /db_xref="GOA:D1ALY8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACZ07256.1"
FT                   /translation="MFKVTYNDALKLGDILKELRHKKELTFKELEKATGVDSATLSRLE
FT                   QGTILRINPMILKSLADFYSINLLTLYNLINYITEDDILNYYTTLSTKKELEKEEIEII
FT                   PFSKFNSINSTYSKDFLKFPYVSKVCKAVEINKEYVVIFNPEIKILNIKDVGIFKNQDD
FT                   IFISNYYKKDKTIVLINYFDKKITVFNNLNDVKILGKVVAIINYNL"
FT   gene            complement(426498..427088)
FT                   /locus_tag="Sterm_0373"
FT   CDS_pept        complement(426498..427088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpp:lpp1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07257"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07257.1"
FT                   /translation="MRKILFRILIVIFLFNISFSLSDYYKKVYTLKINKTELFTAVNAS
FT                   DKQQNELNKIFAKYQKKAEEVANQPFSYTKKVSSLNSIRTSRKEDVYKVLSHDQIKKYN
FT                   AFMNEKRLEFEERNNKIADIITSLNLTHDQKAGILRYENEFQRNIDDLIEQNPANDDFT
FT                   DQYNNLKRARNDKIAGLLSEDQLTVIQDRKFFQ"
FT   gene            427658..429244
FT                   /locus_tag="Sterm_0374"
FT   CDS_pept        427658..429244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0374"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="KEGG: ASNS; asparagine synthetase; K01953 asparagine
FT                   synthase (glutamine-hydrolysing); TIGRFAM: asparagine
FT                   synthase (glutamine- hydrolyzing); PFAM: asparagine
FT                   synthase; glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07258"
FT                   /db_xref="GOA:D1ALZ0"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ0"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ACZ07258.1"
FT                   /translation="MCGFVFTSYEGTKQKEFDKGFQKIYHRGPDNESVTVQRGGIWGFH
FT                   RLAIMDLSNRGNQPFMHNGSELMCNGEIFNYQELEKLVKDIYEFHSESDCEVLLPLYEK
FT                   FGIEIMVKMLDAEFAMVLYDGKTGEVMAARDPIGIRPLFYGFEKETGKISFSSEAKGLI
FT                   DFCKGVKPFPPGHYYKDGEFHSYNDIADPKVIVDEEIETITKKIKDKLEAAVIKRLHSD
FT                   APIGFLLSGGLDSSLVCAIAQKHLKKPIKTFAIGMETDPIDLKYAGEVAEYLGTEHTEV
FT                   RIAKDDVLGALRDVIYHLESWDITTVRASIGMYLICKYIHENTGLKVLLTGEVSDEIFG
FT                   YKYTDFAPTPAEFQKEAQKRIRELYLYDVLRADRCIAAHSLEARVPFGDIDFVNYVMSV
FT                   NPEKKMNKYNKGKYLLRKAFEGEGYLPDSILYREKAAFSDAVGHSMVDYLKEYAEAKYS
FT                   EEDLKNAADKYPYKTPFTKESLLYREIFEEFYPGNADWIKDFWMPNREWEGCRVDDPSA
FT                   RVLSNYGDSGK"
FT   gene            429340..429711
FT                   /locus_tag="Sterm_0375"
FT   CDS_pept        429340..429711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmu:PM1699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07259"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ1"
FT                   /inference="similar to AA sequence:KEGG:PM1699"
FT                   /protein_id="ACZ07259.1"
FT                   /translation="MNKKEQIIRRYFDSWITGEVSVLSETFSENAVYIESYGPLYRGLD
FT                   NIIKWFENWNEHGSVLEWKIFQFIHNDKTVICEWFFKCVYDNKEEEFNGISVISFDSEN
FT                   KITLLKEYQSKLPNYEPYR"
FT   gene            complement(430321..431427)
FT                   /locus_tag="Sterm_0376"
FT   CDS_pept        complement(430321..431427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0376"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sfu:Sfum_2157 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07260"
FT                   /db_xref="GOA:D1ALZ2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034485"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACZ07260.1"
FT                   /translation="MEPINLLIKPASSLCNLRCKYCFYFDVAACRETKSYGIMKTELLE
FT                   IIVKKTLSEADGYCSFAFQGGEPTLAGLDFYKKLIEFQKKYNYKNLNIYNSIQTNGYLL
FT                   NEEWAAFFAKNNFLVGISLDGNKNTHDFHRINTENKGSFTEIMKNIEIFNNYNVEYNIL
FT                   TVVTDELAAAAEDVYNFFKENNFRYLQFIPSINSFDSDKAPFLSPSSYSFFLKKLFDLW
FT                   YEDFMSGTYISIRDFNNYINMLKGYPPENCAMKGRCEFYYLLEADGSVYPCDFYVLDEW
FT                   KIGSIAENSYSDIKKNSKIKEFEQMSHTLDKKCTGCEFLYICRGGCRRYREQKNSFGKS
FT                   FIGLNYFCDSYKEFFSYSLERMKAIAGM"
FT   gene            431612..432379
FT                   /locus_tag="Sterm_0377"
FT   CDS_pept        431612..432379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0377"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: dal:Dalk_3807 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07261"
FT                   /db_xref="GOA:D1ALZ3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ3"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACZ07261.1"
FT                   /translation="MRIYSWNVNGIRALYNKGEFFKLFEEEPEIVCIQETKAQAEQLSE
FT                   ELLNINGYSSFFESADKKGYSGVAVYSKKKPLMVKKFDIERFDSEGRYIELEYEDFILI
FT                   NCYFPNSQEKGKRLDYKIDFCDEILNYLEERKKSGKAVIITGDYNIAHKPIDLARPKDN
FT                   EENPGYLPEEREWMTKFIEAGYVDSFRKFYPEEVKYTWWSYRTRAREKNIGWRIDYFCI
FT                   NKESEGILIDSGIRNDVFGSDHCPIYIDISVNN"
FT   gene            complement(432481..433053)
FT                   /locus_tag="Sterm_0378"
FT   CDS_pept        complement(432481..433053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0378"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: dds:Ddes_2240
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07262"
FT                   /db_xref="GOA:D1ALZ4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACZ07262.1"
FT                   /translation="MKTRALTFKELNSILDLLKYGFHYKEDQKVRTFRAKKKIYYLLLF
FT                   QVNTGLRVGDILQLRRKDILNSRINITEQKTKKNLSRSYPKNTYNAIKEYCKENCIGYD
FT                   DLLFDNLNVRTVQKNLKVVIKYLELRDISTHSFRKTFATLKYKESKNNIELVRRLLNHS
FT                   NTSVTQRYLGISDIDLEKISSKAILNI"
FT   gene            433302..433829
FT                   /locus_tag="Sterm_0379"
FT   CDS_pept        433302..433829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07263"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07263.1"
FT                   /translation="MKQIFLAITVIFFISCTILEADTVLNETQLLKDSKEIYSLMGNLN
FT                   RAVVDKNSKRIRDIADLDSKEANVKETADFALKILANTDYQLLFQMVNTDSLNTSLLKE
FT                   KTTKIYEISMVDKSDFTSNFLIVNRYSNDNYTLIVVKSKKNNNFNEVSRISFEIKRKGK
FT                   KFKIAKIGLFSS"
FT   sig_peptide     433302..433367
FT                   /locus_tag="Sterm_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.876 at
FT                   residue 22"
FT   gene            complement(433886..436501)
FT                   /locus_tag="Sterm_0380"
FT   CDS_pept        complement(433886..436501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07264"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07264.1"
FT                   /translation="MKKFIILTLLLLNFSILTESAKKTSQTNIKNSVDTKKIDEELELA
FT                   DDYYYGNKILKAKEIYEKYSPVSDEAKLKLAKYYIDDIQDEKSTVILEELARKKNKEAL
FT                   HMLGSLYLADNSEDKLIKLFNKKSRSDMDLLAAIYAENGYEEKASAVYRDLAISGDEDA
FT                   YFYMISQYSYNTRVDLLKLESAKGKTRADKELGDLYSAYNDYKNAVNSYKKYLKNSKGS
FT                   MEIFTIFGEYYSKEDLKKELAPYIKRGDKGAKEVLEEYLSKAEEGNVLDAEDEYSENNF
FT                   QTVQDDNTVLSETDDDEAEDDLDFDLPILKTSFEENEKIYLDRITENPDDYDAVNELLS
FT                   LYYLNDKKEKLNTFIDDLISDGYYLGENWKMVKDRAVPIYEAYITQGINRAKPVLAQIY
FT                   TEKKDTEMALSIYESMLPSKNNNINLNIVDLYNRTQKYNKTLALIQDSGIDLNEEPKAS
FT                   NDYHDYDSYGYNISMIRLGAYAYYKLGDLDKAKTLYSFLSNSYDYGVSSHNQDSFYYPD
FT                   KIYLLDIYKKTNDKEEYEELEKQLTQSAGFFSFEDHGMKQALADYYASNGDFDQAKKLL
FT                   LDDKRENETLKALNFIPLVLGLFPNADFFGNSEQTANITLKYQDYSDIKNFIDEVLVLT
FT                   NNSHDNSKNYLNSVKIAALYIVKQYSEELNLSDSFKNKFLGYSDNTLKKEFKKSYKNLY
FT                   KNKKGISFYPGNPDSNFMLSMLLKEWNVETKTLDSSENPVVTYSRRQIFENGILFFSDK
FT                   YVKEFSHINDILEQEDLYEDTDETVLKNKSSKIGDAVNQFFSKTDFNKDYKDFFNLLPS
FT                   MILVNIRENLEKNSRDDIIKKLDSDYAKYLTEDKIRTIEKIKESNNELKDKTNTVFSIH
FT                   "
FT   sig_peptide     complement(436436..436501)
FT                   /locus_tag="Sterm_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.392 at
FT                   residue 22"
FT   gene            complement(436646..437635)
FT                   /locus_tag="Sterm_0381"
FT   CDS_pept        complement(436646..437635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0381"
FT                   /product="cyclic-AMP phosphodiesterase"
FT                   /EC_number="3.1.4.17"
FT                   /note="PFAM: cyclic-AMP phosphodiesterase class-II; KEGG:
FT                   yps:YPTB2912 putative 3',5'-cyclic-nucleotide
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07265"
FT                   /db_xref="GOA:D1ALZ7"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ7"
FT                   /inference="protein motif:PRIAM:3.1.4.17"
FT                   /protein_id="ACZ07265.1"
FT                   /translation="MKRTFFTVLFGIIISVSAFAKTSFEIVALGVNGGVIDGNITSYLI
FT                   RSTDENSYLALDAGTLLPGIEKAAAKGAFKNIAVPADSPLTLEGYVFKNAVKGYFISHG
FT                   HLDHVSGLVISSTDDSKKNIYALQSVVDVLTNNYFNWKTWPNFSTSGEGFKLGQYTYKV
FT                   LDPGKETAIEGTSLFGAALPLSHSNYESSMILVRKNKDYFAFFGDTGPDTVEKSTHLDT
FT                   VWKTLGPKVKSKNLKGIIIEVSYQNGIADKDLFGHLTPEWLLKELQNLEKYSGGKGSLK
FT                   GLNVIISHVKPTLNKNTDIRSSILGQLKNGNTLGVNFIMLDQGDSMEF"
FT   sig_peptide     complement(437573..437635)
FT                   /locus_tag="Sterm_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(437796..438701)
FT                   /locus_tag="Sterm_0382"
FT   CDS_pept        complement(437796..438701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0382"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   efe:EFER_3688 conserved hypothetical protein; putative
FT                   exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07266"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ8"
FT                   /inference="protein motif:PFAM:PF01887"
FT                   /protein_id="ACZ07266.1"
FT                   /translation="MKKFLKKFLLTVGSIIIFSTSVFSASEILVFQSDFGLKDGAVSAM
FT                   KGVAIGIDKDLKIYDVTHDIPAYSIWDAAYRLYQTAEYWPAGTVFVSIVDPGVGTERLS
FT                   VVLKTKNGQYFVTPDNGTLALVAEKFGIDEVRQIDEAVNRRQDSEKSYTFHGRDVYAYT
FT                   GARLASGAITFEQVGKKLPSKVEMISYQKAKYEKNTLVGNIPILDVQYGNIWTNIDRNT
FT                   ASKMNIKKGDIFTVEIYNKDKLIFKDKMPFANSFGDVPEGKNLMYYNSLDSLSFAVNMG
FT                   DFASTYKIEYGGDWSVKIYK"
FT   sig_peptide     complement(438627..438701)
FT                   /locus_tag="Sterm_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            438901..439317
FT                   /locus_tag="Sterm_0383"
FT   CDS_pept        438901..439317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07267"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07267.1"
FT                   /translation="MKKVVLFIFLALGIISFSADYSKGAAAELKLVPISGSEYGFDITY
FT                   YPEKDGTGKDEPLKARESKTEIGIAVKKGNTYYYEGESYGELCKIEITENAKKMTVKTN
FT                   KNCSGYDNFDGTYQYKGETSAKNTKDIKDNAGGF"
FT   sig_peptide     438901..438957
FT                   /locus_tag="Sterm_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.594 at
FT                   residue 19"
FT   gene            439450..440895
FT                   /locus_tag="Sterm_0384"
FT   CDS_pept        439450..440895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0384"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   sat:SYN_01740 UDP-N-acetylmuramoylalanyl-D-
FT                   glutamate--2,6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07268"
FT                   /db_xref="GOA:D1AM00"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM00"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACZ07268.1"
FT                   /translation="MFEIFENVEYEVINKGKDFVIGDIHYDSRKIKENDVFCALIGAVT
FT                   DGHNYIEKAVNSGAKMVIAEKKDITVADKDVTYIFVDNLRKHLGVIASNFFGWPQKKLK
FT                   IIGITGTNGKTTSSYILDSMLENTSRIGTIGYKILDEEIEAPNTTPESLDLVKMLDKSL
FT                   KKGVEYFIMEVSSHALEIGRVDMLEFDSVMFTNLTQDHLDYHENMENYFNAKFKLFSML
FT                   RNKDAAAVNIDDSYGERIYNSNKSYKSYSIIKDSDLKGKIEEYHNGGMKASVIFQGAEY
FT                   FFDTKLVGDYNLYNLLGCIGVLLNLGFDIRDIIERVKRVGYVPGRFELVNEGQDFRVIV
FT                   DYAHTDNGLENILETVRKITEKRVITIFGAGGDRDNTKRPKMARAAAKYSDFVIITSDN
FT                   PRTEDPAEITRQVEKGLTDIDFPKDKYTVIVDREQAIRYGIEMSDANDSLLIAGKGHED
FT                   YQILGREKIHFDDREQARKYLKK"
FT   gene            441202..442047
FT                   /locus_tag="Sterm_0385"
FT   CDS_pept        441202..442047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0385"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="KEGG: pca:Pcar_1944 2-dehydro-3-
FT                   deoxyphosphooctonate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphooctonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07269"
FT                   /db_xref="GOA:D1AM01"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM01"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ACZ07269.1"
FT                   /translation="MENLQKVKEVKISDKITIGNSRITLLAGPCVIESEDLVMEVAAKL
FT                   KEITDKLGINFVFKSSFDKANRTSIHGFRGPGIEKGLEILNKVKEKYGVPLVTDIHEPW
FT                   QCEAAAKVIDIIQIPAFLSRQTDLLVAAAQTGKAVNVKKGQFLAPWDMKNVVSKFEEAG
FT                   NTNIMLCERGASFGYNNLVVDMRSLLEMRKFGYPVVFDATHSVQIPGGKGSATDGNREY
FT                   VYPLMKAAVSIGVDAVFAEVHPDPDKGMSDGPNMLRLDDMEEILTNILKIDDLVKNQEI
FT                   "
FT   gene            442058..443140
FT                   /locus_tag="Sterm_0386"
FT   CDS_pept        442058..443140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0386"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: dds:Ddes_0804
FT                   aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07270"
FT                   /db_xref="GOA:D1AM02"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM02"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACZ07270.1"
FT                   /translation="MKKKVLLTPGPTNIPENLLGVLGTDIVHHRKVDFHNVMKELNENL
FT                   KKIFKTRENVYVLTSSGTGAMEAAVVNYFSKGEKVLVINTGYFGDRFRKIAGIYGLEPI
FT                   NLEYEFGESYKLEDVKKALAENPDIKGIFMTHSETSTGVLNNVAAVGELTKDTDILLVV
FT                   DTISGLVANEFDFDGWNIDVAVAGSQKAFLIPPGLAFLAMSKKAGRAAEKSDIPKYYFD
FT                   IKQAEKAFESKSETPYTPAIGLIIAANVSCRIIVEKGVENIVREKYELRKYIEQKLSEL
FT                   DFKILVKDEENRSNTLISVVKDGIKIKNVIRSLEERGYTVTGGKGDFEDSLMRVGILGE
FT                   FSREDIDEFLAVLIEELEKQ"
FT   gene            443214..444944
FT                   /locus_tag="Sterm_0387"
FT   CDS_pept        443214..444944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07271"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07271.1"
FT                   /translation="MLNEFSLSRGRAMINFTLKYCDTSEKLLDSYGFRKVVEVFVRRLK
FT                   KREGLIYNFYLDAFHTDDALSDAMIEVFKLLTVFDIEEVLKVDNKYSVFFEDKSLFIEL
FT                   IELLYGYWRRLERFTIVRNKRLGEGLQSVRFSQANNNFNELVLATYRRIEETVMGYKHR
FT                   VYRQLNAGANAGLTLNDISWNCPIEYRGLSRIPFIGSVILHPPFISYSKRNTREGLFQK
FT                   HNKNPLENIVLNEDDWFVYPAKVGDLLTFVFFHKDFMAHGLTLANLFELAKESEYIGKK
FT                   PDMIYLFGYPDGENEKRTFYHKDTKNDILIGYANYTDEIDYFGYMKKMLLTLHNIKKID
FT                   EGDLPIHGAMVNIVLRNGKESNIVIMGDSGAGKSESLEAFRTLNEKYIKHMRIIFDDMG
FT                   FLKLENDGKIKGYGTEIGAFVRVDDLESGYAFEQLDRGIFTNPDKINARVTIPVSTYEI
FT                   ISKGYEVDIMLYANNYEDSEKKIKFFEDVDQAIDVFEAGARKAKGTTSEKGLVKSYFAN
FT                   PFGAIQERETNEKLVREYFHKMAEQGVQIGEINTSLAIEGKEKDGPRNAAEELFQLINQ
FT                   "
FT   gene            445128..446012
FT                   /locus_tag="Sterm_0388"
FT   CDS_pept        445128..446012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0388"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="TIGRFAM: prolipoprotein diacylglyceryl transferase;
FT                   PFAM: prolipoprotein diacylglyceryl transferase; KEGG:
FT                   pmr:PMI2319 prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07272"
FT                   /db_xref="GOA:D1AM04"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM04"
FT                   /inference="protein motif:TFAM:TIGR00544"
FT                   /protein_id="ACZ07272.1"
FT                   /translation="MKAYIDLGFIKIHYYSIMYIIAFFLGIFIAGRDIVAKERGVKDKK
FT                   TIEDFAFWVMISGLIGARVYYVLFKLSMYKDNPLSVFAVWEGGLAIHGGIIGAFIGACI
FT                   FAKRKKMNLWVLTDMGVGPLLIGQAIGRIGNYANGEIEGVPTFTPWKVILNGNFEQWWA
FT                   QYQSMSMEMQSKFKELVPWGIVFPSGTSAGDSFPNFPLHPAMFYESILNVIGFLLLWFY
FT                   FRKKRYNPGVLSMIYLIMYALIRSFVSFFRVEDLSFFGIIRAPHLISIIMLILAVIGIK
FT                   YFNKDNTKKDSSK"
FT   gene            446024..446407
FT                   /locus_tag="Sterm_0389"
FT   CDS_pept        446024..446407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07273"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM05"
FT                   /inference="similar to AA sequence:KEGG:NEMVE_v1g225055"
FT                   /protein_id="ACZ07273.1"
FT                   /translation="MKKQLDKVSEFHRTFRLGIEKQPVSTLENGKARLRYELMKEENNE
FT                   YIEAAENGDIVEVADALGDMLYILCGTIIEHGMTELIEEVFDEIHRSNMSKLGEDGNPV
FT                   YREDGKVIKGPNFFKPDIAKIIK"
FT   gene            complement(446457..446894)
FT                   /locus_tag="Sterm_0390"
FT   CDS_pept        complement(446457..446894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0390"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cps:CPS_3728 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07274"
FT                   /db_xref="GOA:D1AM06"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM06"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACZ07274.1"
FT                   /translation="MNRINIITLGVENVSKSLEFYRDGLGFKTPVNEENPAIVFFNNGG
FT                   TKLALYPLSGLAEDVNVPDLKHRGSAFPGITLAYNTKTKEEVDEILDKIENLGGKVVKK
FT                   AHDTFWGGYGGYFTDLDGYYWEVAYADSWIFDKNDMLVITE"
FT   gene            447270..448583
FT                   /locus_tag="Sterm_0391"
FT   CDS_pept        447270..448583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0391"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: cha:CHAB381_0246 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07275"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM07"
FT                   /inference="protein motif:PFAM:PF03349"
FT                   /protein_id="ACZ07275.1"
FT                   /translation="MKRIFLFVLVICTSMIVNSASIDYLMNNSAAYLGNPSQAGIISVD
FT                   GAFYNPAGLTQLEDGTYININGLFSGVEESMNLSDKKFDAKDYPMAPSFNLVYKKDKSA
FT                   FYLNTSVIAGGPHLNFKSGVAGLELAAQAFNKLDPLAGTVRALDAELKNGDFEGENRYY
FT                   QGIIGGTYQLNRVLSVSLGGKYVYSVRKLEGDAEYSFYKGNPIGASINGNELHIKSKRE
FT                   ADGFGGVLGLNIRVNENLNIGMKYDTPVKLTFDTNATEDKKMYIGALGKNLGISDFYPT
FT                   YKDGYSGRRDLPGVLSLGISGKVNRFTLMAGYNRYFNKAANIDNVDYDDGNEVNFGLMY
FT                   DINEKFTWTAGVNFADTGAKKSSYNDVEFSLNSQFYGTGVIYKHDEKNEFTFSVSYIHY
FT                   DSENGEDENFLAGTKLEKSKVTYKKGIIGMGIGYTYKF"
FT   sig_peptide     447270..447329
FT                   /locus_tag="Sterm_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 20"
FT   gene            448624..448700
FT                   /locus_tag="Sterm_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            448624..448700
FT                   /locus_tag="Sterm_R0007"
FT                   /product="tRNA-Arg"
FT   gene            448984..449250
FT                   /locus_tag="Sterm_0392"
FT   CDS_pept        448984..449250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0392"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07276"
FT                   /db_xref="GOA:D1AM08"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM08"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACZ07276.1"
FT                   /translation="MRKQKNYDNVFKQTILKLHENGKSLKELSREYLVSTQSIGAWKKA
FT                   SKKIGTEKGKGIAYEELLELRKKAKDLERDKVLDLYHCFLYNI"
FT   gene            449645..450454
FT                   /locus_tag="Sterm_0393"
FT   CDS_pept        449645..450454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0393"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: yen:YE2513 putative
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07277"
FT                   /db_xref="GOA:D1AM09"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM09"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ07277.1"
FT                   /translation="MNYDIKMVAVDIDGTFVHSDYTYDILRFQRILSRMNDAGCHFVVA
FT                   SGNQYYQLRDLFPGYYNELSFVAENGAFVKDGQELIFTANIPKDTVDAVIDVCRDYPEI
FT                   SNVLCGVESAYCQRGTVSQEFFDLTAIYYHRLKWVDDFKEVKDQILKFAPTVPEEKTYF
FT                   YYDIFCERLKGKVEPTTSGHGSIDLIVPGCHKASGLKRLTKRWGISPEQCAAFGDGGND
FT                   IEMLNYCGYSYAMENASDSVKAAAKFVCPSNEEDGVLATLEELFGLI"
FT   gene            450514..451290
FT                   /locus_tag="Sterm_0394"
FT   CDS_pept        450514..451290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0394"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: msu:MS2235 Cof protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07278"
FT                   /db_xref="GOA:D1AM10"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM10"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ07278.1"
FT                   /translation="MKKIKIAFFDIDGTLIDMNTKRISEKMLETLVRLKENGIILCLAT
FT                   GRSPMALPHFKKVEFDAFLTFNGSYCFNSEKTIFSNPIPTEDIKQLIKNATEIGRPISV
FT                   ATKERLGANGADQDLVDYFAHANLEVEVADDFDTLLQEKVYQVMMGCYESDYTYMMKDI
FT                   RNAKITAWWNRAVDIIPADGGKGKGIEKVLEYYHFDKSEAIAFGDGNNDIEMLQSVGTG
FT                   VAMANGSDQLKVVADDVCGYVAEDGIYHYCLGHGLI"
FT   gene            451693..452520
FT                   /locus_tag="Sterm_0395"
FT   CDS_pept        451693..452520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0395"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bmj:BMULJ_05430 putative short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07279"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM11"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ07279.1"
FT                   /translation="MTKKVWLITGASKGIGLAVAKFLLKQGDSVIATSRNEKRLIEKIS
FT                   SEIDNFLPLKLDITNKNDVFEAIKTGVKKFKKIDVLVNNAGYLQAGSLEDTSNEEIRSV
FT                   FEVNVLGTINMIKAVIPEMRKQGNGHIINTSSIASIRSMAYETIYSLTKFAVNGLSSGL
FT                   HEEVKRFNIKVTNVLPGFIRTEFLEDTSYKIANIENSVYDYKEGLKFLKQMNGRQNGNP
FT                   LKIGEIYRTLVEMENPPIELMIGTDAVDIAIKYSNERIKNTKRYKELSELADY"
FT   gene            452523..452723
FT                   /pseudo
FT                   /locus_tag="Sterm_0396"
FT   gene            complement(453176..453913)
FT                   /pseudo
FT                   /locus_tag="Sterm_0397"
FT   gene            complement(453922..454200)
FT                   /locus_tag="Sterm_0398"
FT   CDS_pept        complement(453922..454200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0398"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   par:Psyc_1452 IS1329/IS3/IS911 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07280"
FT                   /db_xref="GOA:D1AM12"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM12"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACZ07280.1"
FT                   /translation="MIMIKRKRRNYTSTFKKQIVQLYQNGESESDIAKEYDILVSVIGR
FT                   WLSQYDNSGSFKEKENRNELENIQLKKRNKELEMENDIIKQAALILA"
FT   gene            complement(454390..454890)
FT                   /locus_tag="Sterm_0399"
FT   CDS_pept        complement(454390..454890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0399"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sml:Smlt3786 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07281"
FT                   /db_xref="GOA:D1AM13"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM13"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ07281.1"
FT                   /translation="MELKEWSLDYVHDLVHHANNQIISRNLGNIFPYPYTEEDAVHFIE
FT                   FCQTQDLQKIRNLAIVIDGQAVGGIGITVGSDIYEKSAELGYWLGEDYWGKGIMTKAVK
FT                   QMVQLSFQNRNIIRLYATVFSHNLGSCRLLEKNGFELEGVLKKAVYKNGHLYDSKLYAL
FT                   LRE"
FT   gene            complement(454901..455821)
FT                   /locus_tag="Sterm_0400"
FT   CDS_pept        complement(454901..455821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07282"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07282.1"
FT                   /translation="MDKICKRILQKIEIQDFFDRICSLNTADFNSILLKLFSLRTAKST
FT                   PQKVLHTFRENRFVAPSSFDPIKLHQLELELLSMTSKAGITNKLLSPVAPIGSCSVFGC
FT                   VNQNNVLSAVRNVEVLSDPSNILAIMLSNDILNNQIDHTRCTHYATTTRVVRGQKWEGE
FT                   NQYAHFGIFCIVSTAQDKGSYLCEKELLKHHLQFYDNLIQTRYHRKMTIVLRRRTGYTA
FT                   YEDFFEKMYSATKEMFPDTPISVVLDSENNNYYKGINFKIYMQKDNEQIEIGDGGFVDW
FT                   ISKMTGSKKNRCLISGLGLERLLLL"
FT   gene            complement(455921..456541)
FT                   /locus_tag="Sterm_0401"
FT   CDS_pept        complement(455921..456541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0401"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; KEGG: sat:SYN_00574 cAMP-dependent
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07283"
FT                   /db_xref="GOA:D1AM15"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM15"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACZ07283.1"
FT                   /translation="MFFYDIIPNRVKEKLETKMYNPNETILFAEQENNYIYFLIEGTAE
FT                   AYIQSPYGTFATLYFYEKGSFFGEIEPFYDGRKPVEITAVTSCIAKRLYKTDFLSWLQS
FT                   DFEATKFLIKELANKLIINTELVEHLLSLTVKERLLRSILLHYRRGTLQNLTKANLSKE
FT                   INTPIRSLNRAISTCESEGIISYSNNTFLIKDMAKLQKSVPYL"
FT   gene            457270..457593
FT                   /locus_tag="Sterm_0402"
FT   CDS_pept        457270..457593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0402"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="KEGG: gur:Gura_3378 transcriptional modulator of
FT                   MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07284"
FT                   /db_xref="GOA:D1AM16"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM16"
FT                   /inference="similar to AA sequence:KEGG:Gura_3378"
FT                   /protein_id="ACZ07284.1"
FT                   /translation="MSYKKYEILLINYDPFVGTEITKTRPNIVISSDIYNKLSNQLIAA
FT                   PITSVHRQWGTRIDIDTKKTKGQIALDQMRSISSVRIVKKLDTLKDEETKKKITETLEI
FT                   IFE"
FT   gene            458243..459430
FT                   /locus_tag="Sterm_0403"
FT   CDS_pept        458243..459430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07285"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07285.1"
FT                   /translation="MKDEFVQEVIRYTLGEVNEELNRKFFDLRNKIFNSVEYSYDEYNI
FT                   YGTVISKDELKIFENNFYPVIPEDLNVVDLLEEINFSKGKIFVENLFLKESLGEIKGLE
FT                   NRPVSGVIKTDTGEYKATFRLVSDKRYFNKMETLFRITEKNKINYKVINIPYISKFMSV
FT                   YLTDYDKDILKSSKIKEIIYNLDVPVLRGHILCWNIKEKEFDSEEYIKPAEEILTYEYK
FT                   VKIPLDRKYLLNIEKGELMLSYLEDHETLVFVTGEKTGHRLKIWEILDKADSETEKYLS
FT                   YKVYSNEMHLQDSGNILYYKESVAEFVDNLGVKDDIVLSDIKFELGENEREMELLNFMS
FT                   FLKEEFEMKNKRSKVYLKFDFVDDYLKTEIISYIITALNYQNKDFEFSVLEEVDE"
FT   gene            459427..460689
FT                   /locus_tag="Sterm_0404"
FT   CDS_pept        459427..460689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07286"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07286.1"
FT                   /translation="MKYIKSKIIKETLKKLDLEEERKFLRDLTSNGIQYIENNFELQLL
FT                   EMEKNIENRYLEKEQDYTIYSMPVNIEIYNKYSEIFFPLDKKDTEKKEEILKRSGNRVF
FT                   LRKIYLDEDLGRIDEFKKQSFRGNLKLNGTSYNYEISVEYEEKYLNQEKEILSVFGKNG
FT                   IKWRVLYTPYSRRFFNLYISMLPDNIGFDKLGEVKINYGEFTESVHENYFLVSNIQEKS
FT                   ILLDKARGKTIDGNMSRYKIYSNESKTDLVKITDGKIYAIERFENFLHIYTDTEPEDEW
FT                   KLWNIRKIDKMEKYSDLKFIPKGNRKKIDVLGALKENSKSRTRSESEVFEIIKSYSEIK
FT                   GVRLAKVKLNEYVGNPVPGYDSNIAFNKTVSIPRKKEDTLFLYFKYEKQDKYFYDEISF
FT                   LLASVEYKFPEYNVKGVLEWR"
FT   gene            460680..461396
FT                   /locus_tag="Sterm_0405"
FT   CDS_pept        460680..461396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07287"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07287.1"
FT                   /translation="MEMKKEQYQYIWYSLHKLISEDKDTEKIYFKVSPKISPYMELNME
FT                   EINYAALDKEYILETNPFYRFTHVFNEFMNPDLPIGEKLKGEMVNILLHMLGNLDLQEG
FT                   LNKRIILNRIIIRELEEGRYGEEIQKCFSVLNRREKIAIADGIQDKYRYDREWEIFKKV
FT                   MSKIYKDSIIYDSIDEQEKIIIYINEKKSSENKKKELLIEKLFMPLGLKSRCFWGAHFP
FT                   VLGVDEVMRIGEMVIF"
FT   gene            461425..464373
FT                   /locus_tag="Sterm_0406"
FT   CDS_pept        461425..464373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07288"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07288.1"
FT                   /translation="MKKLYHEEELREKSYYDLYEIVIEERILDSYAATPTREQLISLLL
FT                   KYRGYRLENKIREYNENGFFYVQQFLDRKLGNKLHPEGRIRIPYKIIIYNDLDLTREDN
FT                   YKIVIPEYVNSSNVFLVNANNYLCGILSLEKDLDSMDEYYLVSKKEFLNLDGLKNSKFS
FT                   LIFFKERDAKIPYEFYNMEDIGEMSRYPGKIDYYCIGIENFEYRELEKTTAVLCIDFGT
FT                   ANTTAGVYLDRNYVSKLPSNDILNGNIKLDEINYVKFPDGEWDYSIIYPTITYIENCKD
FT                   VKDIKYLFGHDARRKLESNDYIVNGTIFYGLKKWVYENNKKEKIVDEYGNMREVERKEI
FT                   IKAYLKYVISRAEYLFKCKFTKIHATSPVRLKEQFLNMLQDIFTLEIKKTGRREIITKI
FT                   PVPRKEIKINLEKKSDKIENTETKNLTNEEILEKFGGHGERADELKNELLISQIEIDNE
FT                   FAEEEIKAVKTDEINVIEQIMEDDEYITEITYVDEVIGKETVMEYEVISENAMDEAVAV
FT                   LYNTIESGLGKKNYEEGTEYKALVIDCGGGTTDLAACSFQIGSTLDVAYHLEMKTSFEN
FT                   SDENFGGNNLTYRIMQYLKIILANNYINNTEISIENLIPYAKESIYNSINEIGIDKIFE
FT                   VFEEEYQKAEKIIPTKFSKFENKLSEEYRKIKSNFYLLWEAAENLKREFFKKDDTLRTR
FT                   FDKEKNYEKRNDFHITALRTWNLYINENGRLEKEAEFPKNIFTIRELEKIIRIDIYEML
FT                   RKFLDTYYDGGELQEYALIKLSGQSTKIGIFQDVLKEFVPGRQIEFKTKDNEKDGYELK
FT                   LACLNGAIKYLDYRRFGHMNVTIKNEIPVIPYSVWGKTYKNDDVEIIKTSNRANENLGY
FT                   IDKVSSVMELKLYLKNMEDDVIREIVYKNDIDFVDKDAKPLIEGLRMKISQNETDNVPN
FT                   DITRFLVYTDENCWGFYICPIRRKDDQIWMGRIDYYPFEDKINEISFFDGEH"
FT   gene            464408..466264
FT                   /locus_tag="Sterm_0407"
FT   CDS_pept        464408..466264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0286 rhs element Vgr protein:GP5-
FT                   like"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07289"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07289.1"
FT                   /translation="MSIKNKSLKELIEQDKKEQRELYGGNKSSSGSSVNKDLPENQQEI
FT                   QERLNALRGDALNSGDRNSEGNSAVNNAFSNVLSKSNFVKGMAAGAAGSGLANNIVANN
FT                   NRDMTDYVQYQVKNADITINDEILDLKDVDFKIRKIMNKHDVLELNFNFFTKDADKYKG
FT                   YVYTLMNTIGIGLNRVKESGEDDFKAVFDGIIEEIEVIQSKGELSSGRILAYSKSILLD
FT                   KVLKFRTFTNPELTVDGVINEIAAEYTDVVFHIDDSLVGKPIPHILFQFGETDFEFLNR
FT                   MLNIMNYGLTTHLGSVVCGLLELTVYDLPVETEIYTTIRRDKNLSYKIKGTNPFNVVEK
FT                   VNMIMEDEEAVRVVYSSDMWIENKTVQCEMVLVDLNDKQLRHDFPLIINEKMSGSAVEA
FT                   KVVEVGGENGIATVTLDFTDGLARLTDRKSQAYKDNYAGIFKFPYTTMYSSTNSGMFVT
FT                   PEANDVVSVYFPNGNDSLAYVQGCVNNPGNERASNPNVRNYTLGGDDNAGGAPLFNFQL
FT                   SSNSFNVSTTDHVGLSSKNMMNISTSEQLVVNSNNRTVTTKGNSFEEADSMCMISKSKT
FT                   SVISNDSVAVVSKNKVTVGGQSSTNVGGGSFTHITGKAAKLN"
FT   gene            466273..467079
FT                   /locus_tag="Sterm_0408"
FT   CDS_pept        466273..467079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07290"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07290.1"
FT                   /translation="MKFDLLKTTGKKIYRIKKIREVQMIDEKAKKIEDFVLQIESEKND
FT                   SDKIIINFEILKLLHTDNYIIEQKYYNLMRNRKVLFNLEGKYIDTLNKNKILTEWDEFR
FT                   ELMSKDIETPNLKTEKEFKLMRGFLVEEKYIVNSYDIFSIFFPKIYNKEFINEIYYNDS
FT                   MEYFFGAVNIPVKVKVNVKNENENFRISTTHDIDDIYFRKYEIKEVLEYNKINVDYNKN
FT                   IIMSFFSYDLLFDKERHLLKSGEIELGGEIKDIYKNYTKFQIEEMV"
FT   gene            467079..468569
FT                   /locus_tag="Sterm_0409"
FT   CDS_pept        467079..468569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07291"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07291.1"
FT                   /translation="MDKDIVYEDYLLVCEAGAAICQLKCHNKMSVDVGGKCSIPFGIAT
FT                   TADNKEENIGSLDEEYFGMCLYKGKCDLQVLGEWTKQHESLYIGSSKALLIDSKLPCNI
FT                   SLSTNVSDMRLSKLKQFVASDNNMTMSVNATHEGDPSDITASGGQLSPGSADITITGTK
FT                   YISIFKDFDSAMGMMANSRVLQEKAEGDLINAATIGAVGGTMMLLFPQVGAAIGSYAAK
FT                   DMAFSSILIGGTLDNLKSRYDKYKDLERKADTPEMKEFWSRQFWLEAGAEYGPMMLVGA
FT                   YQAGPAVKSKFTELKAYYSRGLSEEEMILYGLRNNGATVAAGKSVEGGVIGDDGRFYTA
FT                   LDDELLYGYNEAQDAYSRILGKRKFSELSVQDQRLLAREFSKRSPVKIPENAKIKVQTK
FT                   LGGYEQISYRWRDANYKYEIRWHTRTPGAPADQGNTWVVMRETPGTGGNTKRSYHYLLD
FT                   DNTWVTGKEWYDAIDARGSGMSTLRQIEILNMGHWSDY"
FT   gene            468569..468964
FT                   /locus_tag="Sterm_0410"
FT   CDS_pept        468569..468964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07292"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07292.1"
FT                   /translation="MIEVDDEYYKGFEGEIEIDFVYRRDGEVVKRMEIWFGYFLNLITG
FT                   MVPENEEPTGILYDLLIGEDWEEEPWKILDIQQTIEQFCGYNECNFNVTEKPSKGILLK
FT                   LPKVLEKILNFLKEVKKNDGEVYIEYL"
FT   gene            469125..469640
FT                   /locus_tag="Sterm_0411"
FT   CDS_pept        469125..469640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07293"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07293.1"
FT                   /translation="MEGGVIGDDGRFYTTLDDELLYGYNKAQDAYSRILGKRKFSELSV
FT                   QDQRLLAREFSKRSPVKIPENAKIKVQSKPAGYEQISYNWRDTNYKYEIRWHTRTPGAP
FT                   EGQGNTWVIRRTIPGTGGNTKPANHYSLDDNTWVTEVEWRNAIKARKYGVPTLRESEIL
FT                   DRGHWRDY"
FT   gene            469640..470038
FT                   /locus_tag="Sterm_0412"
FT   CDS_pept        469640..470038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07294"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07294.1"
FT                   /translation="MEKIRESEFYEGFEEEEIDLIYKKDGEEIRRLEIWEGYFSTLLNE
FT                   MITEETEAEGLLYVYSVYEGWYEDENPWKIPDITQAITQFKNYEKKLMINKKEIDKIWP
FT                   EIPKILERILKFLEEARKNNGEVYIEYL"
FT   gene            470135..470728
FT                   /locus_tag="Sterm_0413"
FT   CDS_pept        470135..470728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07295"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07295.1"
FT                   /translation="MWKEVIFYSLKNNGVTVAAGKSVEGGVIGDDGKFYSNKLSDEFKR
FT                   LEYKTFISEKTENKILRGELNSKKIVIGGHSPEINDMSTKYWIKETIKINPDGTRVVRY
FT                   KKIFPDGTSSKLKKSIIFPETWSDTDIINSIKQIGDTEAIGVRVRDQTTIHRGTVNGVQ
FT                   IEVMKIGSYTTSGYPTGGYPMDLIKNDFIPIIFE"
FT   gene            470743..471039
FT                   /locus_tag="Sterm_0414"
FT   CDS_pept        470743..471039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07296"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07296.1"
FT                   /translation="MAVSLYEELNSYLKNSEYWYEECWYEEGSGKVSEMLSKFTQEDWN
FT                   NLTREIFNKSVDYQEKIAYCMNDIDNKNELEFLIYMTKNAKDSIVFENCLDSL"
FT   gene            471068..471406
FT                   /locus_tag="Sterm_0415"
FT   CDS_pept        471068..471406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07297"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM29"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07297.1"
FT                   /translation="MGEFVQERVEIEKFGQKLKNVKTNEIAAEIDIETKTQIIEIKKSA
FT                   SSIELEQIEKYINPLDNNFINYSGKEVIIYIDKPLAGSKIPRYKINFINSKGIKIVNSL
FT                   EELSEVLK"
FT   gene            471406..471888
FT                   /locus_tag="Sterm_0416"
FT   CDS_pept        471406..471888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07298"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07298.1"
FT                   /translation="MGISAFVMFERGKSISIERMLQELKEECEKSGLYFKLSEYGYELG
FT                   VGGIRMHVVVDEMANYDSDNKDTALYMDFYEEPNKFNYVFLDEYDDIELFQAIIINRFS
FT                   DREKLLLKFLYIVLKKYPHGIAWPETDWIYTLEDLEKIVKKPYDEDWFIKNPKKLI"
FT   gene            472333..472680
FT                   /locus_tag="Sterm_0417"
FT   CDS_pept        472333..472680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07299"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07299.1"
FT                   /translation="MVWQGLQIGNHWHIKIIMLGYLSFFILHGTSSKLKKSTIFPETWS
FT                   DTDIINSINQIGDTEAIGVRMRDQTTLHRGTVNGVQIEVMKIGSYTTSGYPTGGYPMDL
FT                   IKNDFIPIIFE"
FT   gene            472694..473152
FT                   /locus_tag="Sterm_0418"
FT   CDS_pept        472694..473152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07300"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07300.1"
FT                   /translation="MAISLYEELNSYLKNSEYWYEEYWYEEGSGKVSEILSKFTQEDWN
FT                   NLIKEIFNKSVDYQEKIAYCMNDIDNKNELEFLIYMTKNAKDSIVFENCLDSLIEFVTP
FT                   ETKFRFLSDDQLIILITGGIRKETIEGNGRNKIYKTIYEQFFEKLNNK"
FT   gene            473179..473652
FT                   /locus_tag="Sterm_0419"
FT   CDS_pept        473179..473652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07301"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07301.1"
FT                   /translation="MGRNNILWLRNNGATVAAGKSVEGGVIGDGGRFYTALDDELLYGY
FT                   NEVQDAYSRILGKRKFSELSVQDQRLLAREFSKRSSVKIPENAKIKVQSKPAGYEQIVY
FT                   KWRDANYKYEIRWHTRTPGAPEGQGNTWVVLRTTPGTGGNTVAVDHYLLNDNT"
FT   gene            473757..474161
FT                   /locus_tag="Sterm_0420"
FT   CDS_pept        473757..474161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07302"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07302.1"
FT                   /translation="MDRIRDSEFYEGFEGEGEIDLIYKKEGKEIKRLEIWYGYFSKLLN
FT                   KMIQNEMEIEGLLYEHSIHAGWYEDEEPWEIMDVNQAITQFKNYKEKKLTENKREMSEI
FT                   WPEIPKVLERILEFLEEAKENNGKVYIEYL"
FT   gene            474324..474839
FT                   /locus_tag="Sterm_0421"
FT   CDS_pept        474324..474839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07303"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07303.1"
FT                   /translation="MKGGVSGDDGRFYTALDDELLYGYNEAQDAYSRILGKRKFSELSV
FT                   QDQRLLAREFSKRSPVKIPENAKIKVQSKPAGYEQIVYKWRDANYKYEIRWHTRTPGAP
FT                   VDQGNTWVVLRTTPGTGGTTKAVDNYLLNDRTWVTGKEWSDAITARKYGMPTLREIEIL
FT                   DRGHWRDY"
FT   gene            474839..475240
FT                   /locus_tag="Sterm_0422"
FT   CDS_pept        474839..475240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07304"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07304.1"
FT                   /translation="MVIINNKYYEGFEGEIEIDLIYKKNGVEIERLEIWNGYFSALLTG
FT                   MLQLGTEPIGILHEYNLREGWYEDENPWKIPDIAQAITQFSNYSESNFSEEERPGKLLL
FT                   SSLLKVLESIIQFLEKAKKNCGEVYIEYL"
FT   gene            475401..475916
FT                   /locus_tag="Sterm_0423"
FT   CDS_pept        475401..475916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07305"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07305.1"
FT                   /translation="MEGGVIGDDGRFYTTLDDELLYGYNKAQDAYSRILGKRKFSELSV
FT                   QDRRLLAREFSKRSPVKIPENAKIKVQSKPAGYEQISYNWRDTNYKYEIRWHTRTPGAP
FT                   VDQGNTWVVLRTTPGTGGNTVAVDHYLLNDNTCVLGDDWQQAIRVRKYGVPTLREIEIL
FT                   DMGHWSDN"
FT   gene            475916..476311
FT                   /locus_tag="Sterm_0424"
FT   CDS_pept        475916..476311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07306"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07306.1"
FT                   /translation="MLIIDDRYYREYEGEGEIDFICQKNGRKVKKIQIWEGYFLSILNG
FT                   LIKNGEKPVGMLCMLLISDTWDKEPWRIPDIQEMIIVFEKYDENNFSESERPSKLLLDL
FT                   LPEVLESIIKFLKEVKENNGDVYMEYL"
FT   gene            476457..476653
FT                   /pseudo
FT                   /locus_tag="Sterm_0425"
FT   gene            476868..477296
FT                   /locus_tag="Sterm_0426"
FT   CDS_pept        476868..477296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07307"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07307.1"
FT                   /translation="MNVFKLKKFTRSDFNYFNNLNLMSEVSLVSACLNEFSFRTEEEKR
FT                   GEIVVYLELFMCTEHTGEFLKYHYDELEKIIKKYETIDNKYFSDFENEEIKSMLKKYRD
FT                   RVKDMDITEVTENGEYRIYSVKENNELELKFNKLRVLE"
FT   gene            477322..477444
FT                   /locus_tag="Sterm_0427"
FT   CDS_pept        477322..477444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07308"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07308.1"
FT                   /translation="MYLNWRNFKKMILIILIVDKYQNLKGLSILLFIERILSKK"
FT   gene            477532..477885
FT                   /locus_tag="Sterm_0428"
FT   CDS_pept        477532..477885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07309"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07309.1"
FT                   /translation="MRNVTELKEETKECFEYFEKLTEELGGYTKASLIGICLNEFSFSS
FT                   EEKKIEKIVIYLELFNCIEKYKEIYMYHYNELNEIIENFKVKDFKYFNEKDRKDIEKMI
FT                   SFYKSRIKNMLII"
FT   gene            477909..478496
FT                   /locus_tag="Sterm_0429"
FT   CDS_pept        477909..478496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07310"
FT                   /db_xref="InterPro:IPR029501"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07310.1"
FT                   /translation="MKISSFGATNDISKKYQAGPSVKSKFTELKAYYSRGLSEEEMILY
FT                   GLRNNGATVAAGKSVEGGVIGDDGRFYSNKLSDEFKRLEYKTFISEKAENKILRGELNS
FT                   KKRIMGGHSSEINGVTTEYLLEETVKINSDATASKIKTSTLFPETWSDADIINSVKQIG
FT                   DTPAIGIRMEDKATIHLGRVNNVEIVVIKIGG"
FT   gene            478498..479007
FT                   /locus_tag="Sterm_0430"
FT   CDS_pept        478498..479007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07311"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07311.1"
FT                   /translation="MSFTMYEKFDLYLMKGYIKEFISLENESQTIGEKYWFDEYWYEYG
FT                   CDKAIEILSKFTQDDWNKLTKEIFTKSLDYQEKVIYCMENENNENELEFLLYMIKTTKN
FT                   SMIFEACMEFLIEFVKPETKLKFLNDDKFMVLITGGRGKQENSINRKNNIYKTIYEQFF
FT                   EKLNSK"
FT   gene            479588..479989
FT                   /locus_tag="Sterm_0431"
FT   CDS_pept        479588..479989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07312"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07312.1"
FT                   /translation="MKLIDDEYYIKFEGEEEIDFIYEKNKAEISRMKIWHGYFYFLLNG
FT                   MITKEKKLIGLLYEHNKHEGWYESDEPWEIPDIKQAIEQFNNYSENNFSENEKPSEGIL
FT                   LKLPHILEKILKFLEEARKNNGEVYMEYL"
FT   gene            480114..480278
FT                   /locus_tag="Sterm_0432"
FT   CDS_pept        480114..480278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07313"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07313.1"
FT                   /translation="MEGGVIGDDGRFYSNKLNVEIVVIKIGSYATSGYPTGGIPVNLVR
FT                   ERFTPIIFE"
FT   gene            complement(480387..481523)
FT                   /pseudo
FT                   /locus_tag="Sterm_0433"
FT   gene            481799..482614
FT                   /locus_tag="Sterm_0434"
FT   CDS_pept        481799..482614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI24505 gene product from transcript GI24505-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07314"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07314.1"
FT                   /translation="MKFRVSIMPRSDMPGTGAGGSSIGGALSEGKGTFGAPTGYFGNTT
FT                   SGLVASNSSSNSGFGSSGLPGLGSLTGLLGGGQSGLILTPDEITDVSFSASDFSVSSTA
FT                   NTESNVTVRIAGKLFSQIEEGSTSFDSPLSMNSLLTGFMDDKLSGLTDGLNKGMQILGN
FT                   TFTSGLSSTLTGMIGKFGGNKFGLNNLYSMNFENTIELANWALAYGEKTDYRDVVVEIM
FT                   INEGVSKTYVLPDMFAIDYDENLGVGRGEGFFNLVLRQKRYSSRKIEIR"
FT   gene            482625..483518
FT                   /locus_tag="Sterm_0435"
FT   CDS_pept        482625..483518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07315"
FT                   /db_xref="GOA:D1AMT9"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07315.1"
FT                   /translation="MNKFLYFFYLFLLGRNILLLSNSYSNKTTGVLLLINMLFCFILAL
FT                   ILLFKSKKYNVYLIVTILSFSIFYIYYSGYSDMNKDFNKMVYYIFILLSIVEIIMFIFV
FT                   KMKESKKVKTTLYLCFCFIAGILFLRFLNNYYQEPKKIVYSTRITSLKDKQEMLEIIGK
FT                   MPGIKSADIIEDYEKSSLSYEDNVYYHYNFKESLEPSDLIIDISLKTLVDDTSLDSLAY
FT                   KIQKYIKLSGLENDLVRIYIVTDRDDRRAINIYDFQNDNIKVRYKRTEPYIAGSSPLLN
FT                   IFSLAVKILKGVVSEY"
FT   gene            483531..484106
FT                   /locus_tag="Sterm_0436"
FT   CDS_pept        483531..484106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07316"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07316.1"
FT                   /translation="MRVKYTVDSTAYYLNIHTNNKTSSLGIKVASKDMLILCYQKDIAV
FT                   LRDISNHLKNIYENERKGTKNKIKYIKTLHFMAQEILFHIDAYVHVLAEAQIKGIKVDS
FT                   NKYTEKLAELIDKLIVEPSKVADVGANITKDHDSAIINVGYTARIPSGFMINKQFYKIG
FT                   ELLGFPLENTSDVWYECSYKGETKKVKK"
FT   gene            484121..486151
FT                   /locus_tag="Sterm_0437"
FT   CDS_pept        484121..486151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07317"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07317.1"
FT                   /translation="MSEKKKLMMDLIEKDKKEQRELYEGNKSLGSTLDTRNKAFSENSE
FT                   EIKRRLEEVNGQVSGNSEKTSLGTSDMISGAFSEVLSKNNFVKGMAAGAGSGLLSAAGL
FT                   GNIMGIHDFVEFHSKNADILVNDEKLDFKDVKFKISEVMNEHSVLYMDFTFSTKDTDKY
FT                   KGYVYSLMNTVKIDLNRIKDTGEEDFKAVFDGIIEDIEITESKGEHSSGRILAYSKSIL
FT                   MDRVPKFRSFQNTDLTVDEVIKEIGAEYPEITIHIDDSLVGKKIPYMMLQIEETDFQFI
FT                   NRMLNIMNYSVSCHLGSLVCGLLELTVYDLPIETEFYTAIRKNKNLLYKIKGTNPFNVV
FT                   EKVNIIDGESEVVRVVYSSDIWIENNIIQCEMVLLDLNEKQLRYDFPLVKNRNMLGRVI
FT                   EGKIMEVTSEEGIAVMTLDLTSGLAKLTDRESVAYPDKYAGSFKFPYMTPMSQTNTGFW
FT                   PSPEANDQVVLVIDDFNESLSYVQGAVNNPGNGRFSDPTVRNFTLPPDPSVISPENAAP
FT                   YNEMGIKNSSSGTYGRKGDSSGNKAAHKSGGRPAAHFQLDSSKFVVDVTSFISLSAKSS
FT                   VSINSQDTMGISAKSVMGISSDNVMNIDGKNMLTVGGSAGTITVNSKGLMLVGSEASIF
FT                   VNATDNIAHTSKVIMSSGSDTATYGSGSVAVITADDIKLNG"
FT   gene            486159..486905
FT                   /locus_tag="Sterm_0438"
FT   CDS_pept        486159..486905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07318"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07318.1"
FT                   /translation="MKYQIEAVSIVEKEEPVDITLLKMTLTTRIEKDVMIFHILDTKIY
FT                   NKSFFIQYMNPFNAVREIKMVLDRNQRIQGVVNYKEVREKTEKYYTEMADKMKKANKKD
FT                   LEEIFFDMAYQSFQYEENIIRELLRTSYFYPFIGGNYRNNESDNISLEGFLPNYNIIEK
FT                   LEKIFFRDKNSTYIRGGVDQSKVYAYSLSEQMKELGLEYKPEMLNLSSESRIYYKEREI
FT                   DRVESYKQGGIKGYYQKKEKIFIDRI"
FT   gene            486915..489020
FT                   /locus_tag="Sterm_0439"
FT   CDS_pept        486915..489020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0439"
FT                   /product="Hedgehog/intein hint domain protein"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   hch:HCH_02073 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07319"
FT                   /db_xref="GOA:D1AMU3"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR032869"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU3"
FT                   /inference="protein motif:SMART:SM00306"
FT                   /protein_id="ACZ07319.1"
FT                   /translation="MGEIKFEEVFVCHQAYIYCPFGEFIQPVEATVNETATFQGKRVLT
FT                   KDDDVVGRNIHPFKKCDKKGECLLSGTVSWQKARTDIKVNGSRLLTGESYFMCPHVRGT
FT                   KIEFKDVKQEPGPEVDKRSKLEIFTDEASGLMSALMGINGVFQATEGAVQVKKRYENIY
FT                   NATVKDVKYFSKDNLRTLEEIWSYSLPGQFTHGDPYSKDMKSYIKNEGIFAYEEGEEGY
FT                   SSVTGSVLSSMALDVIHPAYGAMEDAYDFKNAYNDGDKLGMALSAVGFIPVLGAGIKKG
FT                   TGKAMKIAGESKMLKKGSKIGDAIVDSKAVKLFQNTLSGKVNKVVRGFGDTLKSITEAG
FT                   LNLKKRFVSSTKALNRKINMAICNLIESGCFVGGTLVNTEYGLKKIENIKIGEKVYTYD
FT                   LVNREVILKEVTETFNERVSKIIKIEIENNVIIETTVEHPFYVKDIGWVEAGKLKEGDK
FT                   LFSRELGDTEIAAVREDIYLDRDVYNLQLEGNHNFFVSELELLVHNDTACAELLKKLDD
FT                   DIAKLIKEGASEDVINSLRKQRKHIIEKNLNEFLNGTKKFDDVLDDYARLYADVVDSNE
FT                   IWRWERDMIGGSELTARQRKAIRTKAFDDGLLPIVEFKAGTKYPDFEKAGLIIKEDMLP
FT                   EELWKASDRRQFDWLDNRLVDGRPRGTTWNHSDIAGRMELVPFGIHNVINHRGGRSPGQ
FT                   WAYVLRR"
FT   gene            489030..489509
FT                   /locus_tag="Sterm_0440"
FT   CDS_pept        489030..489509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07320"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07320.1"
FT                   /translation="MIEVDKKSIVYPLPSNERIADFEKAYRIEFPSEYKDFLKKYNGAT
FT                   LLTNILKIRDFEYIVERFLCLLDEPNENKIDGWYDLSVVLTQLDDRLIEDEDMVGMNII
FT                   PIASMFAGNFICLDYRNNSDPEIVIWFHEESGEFSPVTDKIADSINDFFNMLSKD"
FT   gene            489536..490441
FT                   /locus_tag="Sterm_0441"
FT   CDS_pept        489536..490441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0441"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bac:BamMC406_5979
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07321"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACZ07321.1"
FT                   /translation="MSAKNKEIELKDEIYNNILELTETGDEYYEEGELKKAEKAYLEAL
FT                   ELLSEPKYDWEAGTWIYTALGDVYLEEQDYLKAKEVLYDALNCPNSQNPYIYYNLGIAL
FT                   FELDEKDKAQDFFMRVYMLDGETLFLDGEDKYFESIKNEISKDRSMAKKKLEKTDNVIT
FT                   DEANKNFEAVHFYDEMNIAYEKGDYDEVLKLLNKKWEEIPLPKEKNKESPYILRSIIEI
FT                   LLIKHDYMEAKKVCADYFDYDFFMNDFGEGYLLSGKIFYELGNKEEAKKTLLLAYKISG
FT                   KRLFMDEKNKKYFEFLKQYL"
FT   gene            490656..491450
FT                   /locus_tag="Sterm_0442"
FT   CDS_pept        490656..491450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07322"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07322.1"
FT                   /translation="MEAGKLKEGDKLFSKELGDTEIAAVREDIYLDRDVYNLQLEGNHN
FT                   FFVSELGLLVHNDTPCMEALKKLDDEIAKLVKEGASEDVVKKLTKERNKLGKKLDILND
FT                   ISKHFDLEKALEYERKINNNNFFRHEVGDYGEEIVGVIGKNNNWGKDISEQFQTGRNGL
FT                   DKVFLSEGPPPKLTIIESKASRKGIYTYSDVQKLGGEGYFNNMLNSSDARYRGYAEKLQ
FT                   DIKDEFPDLVVDYKRVETKVKITDIGFGAEDVTVKDWSNPIY"
FT   gene            491467..492429
FT                   /locus_tag="Sterm_0443"
FT   CDS_pept        491467..492429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07323"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07323.1"
FT                   /translation="MNNKKLDMAYKRYKKNFIEGYPMQEMEAKYEEAEKKIKDIIKNNE
FT                   LKKDHIFLTRLARIRLYYLTLWKHINFLDNKMDKQSLKKIQIIVFFQCFSQELYKERYP
FT                   NMLLEYNLKFVVIALIHFNFWGWEKEEGILLEFIKNNISSNILNTNDDNKHVWFLLELY
FT                   LKFKNETILGVNENLNLKVKENLINNDMKANMIPNDLEIYEKVFKNLKAENIDGLINGM
FT                   IIYHSEMLKNLGEYGEFRDYVYGFYPIEILYLIHIRKKLGLSVPEKFDDFLMNTPEAKM
FT                   EFKEKELYPEMDELVEEIDKFYRRNYPEYIPNKHGELFK"
FT   gene            492452..492895
FT                   /locus_tag="Sterm_0444"
FT   CDS_pept        492452..492895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: RING Zn finger-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07324"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07324.1"
FT                   /translation="MTINKLAEIIFNEAYEVYDKNDVCMEILDYGLENKKLLYIDYKGE
FT                   ENQEIVNYILDYEFENGLELANEEELEYLEDFDYTELPEKIKEVNKIIKKNNYGLFSYP
FT                   TFSDFYALFLSELKNKEELLKSDICINSTDERVPLEAKTIQYY"
FT   gene            493084..493425
FT                   /locus_tag="Sterm_0445"
FT   CDS_pept        493084..493425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce7826 Rhs family carbohydrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07325"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07325.1"
FT                   /translation="MKNIGWVEARKLKEGDKLFSKELGDTEIAAVQEDIYLDRDVYNLQ
FT                   LEGNHNFFVSELGLLVHNDTACVEMLKKLDDQIAKLVKEGGDIQRGIKKTKREDSGRDT
FT                   KKYKKDIIG"
FT   gene            493382..493654
FT                   /locus_tag="Sterm_0446"
FT   CDS_pept        493382..493654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07326"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07326.1"
FT                   /translation="MGGILKNTKKISSGKNFKDHFLRHKKLLEKITGEKYSKFKEHDQG
FT                   TLNATNIRYNIYRGEGITIVTKSDGEWVTILESGKGMDKNIKFIQ"
FT   gene            493668..494162
FT                   /locus_tag="Sterm_0447"
FT   CDS_pept        493668..494162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07327"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07327.1"
FT                   /translation="MIKHDIIKILKENKIENIYYTGCFDMEDQDFIINSNYVYFKLGEN
FT                   FICFEAIESYSKLEISITDSIIYRNDIEDFIDGKVEISDLILKSILTDNKVVQEITFYN
FT                   LFEKENSIITNVLACVLNDKDYIFLDPGFLGIKVGGLEQKEFWEKNSNNNEKINIEEVC
FT                   I"
FT   gene            494183..494590
FT                   /locus_tag="Sterm_0448"
FT   CDS_pept        494183..494590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07328"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07328.1"
FT                   /translation="MLKEKIMEILSTDTLENLYFSGDFDENIREFIINKKKLYLEFSKN
FT                   IICVNSDENILKLSIVLNNKFENQPRVKINEIVFINSLIEERKVVEVTFDNLLYKMDEL
FT                   LVEGLMLELSDHEYICLKPAFFGIEICKNKS"
FT   gene            494819..495415
FT                   /locus_tag="Sterm_0449"
FT   CDS_pept        494819..495415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0449"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   ecm:EcSMS35_4879 pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07329"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV3"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACZ07329.1"
FT                   /translation="MFEKDDIMKKLENHLIFSKSLGVDGERMEEEGIDFREYNLKNYIL
FT                   TEGIFYNCNFSKMNLEEQDFYKTILEYSDFSESNLQNAYFVKSETNNAIFDNANLIGAN
FT                   FSKSDLLEASFINSKLNNVKLIFTTLIRTNFTNSNLVNVDISDSYIEETIFTNAILTGM
FT                   KNLNQAFVHSINIGTIEKPIILKEKKAKEWLKNRV"
FT   gene            495802..496314
FT                   /locus_tag="Sterm_0450"
FT   CDS_pept        495802..496314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07330"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07330.1"
FT                   /translation="MEINSYILKPGHGTVPLKTYNDFINVNDSDGLLEIEDFLDDFYLD
FT                   GAIEIKYEEQIFLDINNWDLIDQLWSYILNLIEKYIENDKSRVYFPDSPNEICMEKVNR
FT                   NGMMLAITTDKKRKIIQNERKMIELLLREAKFFFNNISILRDYKQESLEEVERIEVIEK
FT                   KLIMRNS"
FT   gene            496402..496731
FT                   /locus_tag="Sterm_0451"
FT   CDS_pept        496402..496731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07331"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07331.1"
FT                   /translation="MKEKRINYQTLIGNVFELKYMMGKYALLLNNELFSGKLILEYDNG
FT                   NLHSSGIIKNGFKHKEWITCYENGEVQIKELFTANLHQGEYLEYHKNGKLKGKSFFMFG
FT                   DSHGE"
FT   gene            497069..498043
FT                   /locus_tag="Sterm_0452"
FT   CDS_pept        497069..498043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein similar to DNA-binding
FT                   chaperone; K09522 DnaJ homolog, subfamily C, member 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07332"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07332.1"
FT                   /translation="MSYRKKIDISYKRYKSNFEKKIRFEEIEEEYNEIKDEIFGIINSN
FT                   NLNEDHILLIDLDTIYQYYISKWKKNVLIENKKETIELKKMQVAVFYTCIVQDLYKTRY
FT                   PNMRLQYNFRDIVLALVHFNLFGWTKEEDILFKFITENIGSNILDMNDYNTHVWFLLEL
FT                   YLRYTNKTILGTNKNVNLMIKKELSAKDLNTNFIPDTLNVYENTLNSWETKDLKEITEL
FT                   MKQMIEYHTIKAENIGDLDEFTNYIYGFYPIEILYLIQIRKKLGLSVSEEFDDFLMNTP
FT                   EAKMEFKEKEPYPEMDELVEEIDKFYRRNYPEYIPNKHGELFK"
FT   gene            498066..498509
FT                   /locus_tag="Sterm_0453"
FT   CDS_pept        498066..498509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: RING Zn finger-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07333"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07333.1"
FT                   /translation="MRINKLVEIIFNEAYEVYDKNDVCMEILDYGLENKKLLYIDYKGE
FT                   ENQEIVNYILDYEFENGLELANEEELEYLEDFDYTELPEKIKEVNKIIKKNNYGLFSYP
FT                   TFSDFYALFLSELKNKEELLKSDICINSTDERVPLEAKTIQYY"
FT   gene            498614..500218
FT                   /locus_tag="Sterm_0454"
FT   CDS_pept        498614..500218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0454"
FT                   /product="MORN variant repeat protein"
FT                   /note="PFAM: MORN variant repeat protein; KEGG:
FT                   shw:Sputw3181_3567 MORN repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07334"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV8"
FT                   /inference="protein motif:PFAM:PF07661"
FT                   /protein_id="ACZ07334.1"
FT                   /translation="MKEKRINYQTPIGNVFELKDMMGKYALSLENELFTGKLILEYDNG
FT                   NLHSSGIIKNGFKHKEWITYYENGEVRIKELFTANLRQGKYLEYHKNGKISVKGLFLNG
FT                   MKTESWKWYHENGVLKMIGSYIAGNKTGEYKEYSENGKLIRIAQFLDNKEHGEGIWYYE
FT                   SGKLKGKRLFMFGDSHGEQRIYYENGNLKSVGKYIRDERVGEWKEYYENGNLKIISNWT
FT                   NSRQNGKAYEYYESGAMKAAANYHRGRQHGETAFFHKNGNKRKVEMYNNNTLDGKSYVY
FT                   DEEGNLEKELFYKNGKINGLVTAYYSTGKVKYKAHYKMGVIYGEYKAFDKNGNCTERGF
FT                   IDEMNNIFDIKAIEIKKEIKKKERAVIKNIEIRKIEKEKVTIREDKKEVNYYKSIIQPE
FT                   EPKQNIRTEGSPFLRYDEVLELREKNKKALGIIDFNDWRDMFDLINEIKGYIENRDMER
FT                   AVNKILILSNIDKQLAENNSAVKKNLSVLLKETSRFFMVKSKDFEEYWGFFEGKEKLKT
FT                   EFVKSIEGLKEKFGIGS"
FT   gene            complement(500762..501780)
FT                   /pseudo
FT                   /locus_tag="Sterm_0455"
FT   gene            complement(502341..502841)
FT                   /locus_tag="Sterm_0456"
FT   CDS_pept        complement(502341..502841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0456"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sml:Smlt3786 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07335"
FT                   /db_xref="GOA:D1AMV9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMV9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ07335.1"
FT                   /translation="MELKEWSLDYVHDLVHHANNQIISRNLGNIFPYPYTEEDAVRFIE
FT                   FCQTQDLQKIRNLAIVIDGQAVGGIGITVGSDIYEKSAELGYWLGEDYWGKGIMTKAVK
FT                   QMVQLSFQNRNIIRLYATVFSHNLGSCRLLEKNGFELEGVLKKAVYKNGHLYDSKLYAL
FT                   LRE"
FT   gene            complement(502852..503772)
FT                   /locus_tag="Sterm_0457"
FT   CDS_pept        complement(502852..503772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07336"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07336.1"
FT                   /translation="MDKICKRILQKIEIQDFFDRICSLNTADFNSILLKLFSLRTAKST
FT                   PQKVLHTFRENRFVAPSSFDPIKLHQLELELLSMTSKAGITNKLLSPVAPIGSCSVFGC
FT                   VNQNNVLSAVRNVEVLSDPSNILAIMLSNDILNNQIDHTRCTHYATTTRVVRGQKWEGE
FT                   NQYAHFGIFCIVSTAQDKGSYLCEKELLKHHLQFYDNLIQTRYHRKMTIVLRRRTGYTA
FT                   YEDFFEKMYSATKEMFPDTPISVVLDSENNNYYKGINFKIYMQKDNEQIEIGDGGFVDW
FT                   IGKMTGSKKNRCLISGLGLERLLLL"
FT   gene            complement(503838..504458)
FT                   /locus_tag="Sterm_0458"
FT   CDS_pept        complement(503838..504458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0458"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; KEGG: sat:SYN_00574 cAMP-dependent
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07337"
FT                   /db_xref="GOA:D1AM15"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AM15"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACZ07337.1"
FT                   /translation="MFFYDIIPNRVKEKLETKMYNPNETILFAEQENNYIYFLIEGTAE
FT                   AYIQSPYGTFATLYFYEKGSFFGEIEPFYDGRKPVEITAVTSCIAKRLYKTDFLSWLQS
FT                   DFEATKFLIKELANKLIINTELVEHLLSLTVKERLLRSILLHYRRGTLQNLTKANLSKE
FT                   INTPIRSLNRAISTCESEGIISYSNNTFLIKDMAKLQKSVPYL"
FT   gene            505196..505357
FT                   /locus_tag="Sterm_0459"
FT   CDS_pept        505196..505357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07338"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07338.1"
FT                   /translation="MTKVKIFESFIHSSLERDINSTLEGYYIISSSICTAITNNRVLYT
FT                   AIVVYEVD"
FT   gene            505495..505909
FT                   /pseudo
FT                   /locus_tag="Sterm_0460"
FT   gene            complement(506213..507093)
FT                   /pseudo
FT                   /locus_tag="Sterm_0461"
FT   gene            complement(507132..507938)
FT                   /locus_tag="Sterm_0462"
FT   CDS_pept        complement(507132..507938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07339"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07339.1"
FT                   /translation="MINNYKLNLPANVRINYKAISFLHEIDMEEGINEKVFTDTMIMLA
FT                   FFENNIVRFKEYKNIKINNFLDNLNKVIGNDYLFKLSASGRISNIENRKEILNNLEKEK
FT                   IALLTYDPVNSSDNLSTIMSYEELLKMEKMHLLFEFNGITNSMFVPVYNKHLNNNNIKI
FT                   TIGDLIPMQFIPMVLNTEIVNLPNNGFLLKFVGELDEEIISKNKFYAHLRDIYRIPMYE
FT                   SLNLTLGIKGYYVFKENNQYYESFLVKKTMRENYNLKEYIDYGYRI"
FT   gene            complement(507935..508714)
FT                   /locus_tag="Sterm_0463"
FT   CDS_pept        complement(507935..508714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07340"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07340.1"
FT                   /translation="MPIKYKFTHTIEEKERKEVKIEKSYELLNIINKSNNFKEFFFYNN
FT                   DVKIYNGKISELETLFYNILKYLEISIDRNFQLYKIINISEIQKIFNNLYTQQFSNRFL
FT                   KFLHESEKILANEYELKNLISHIPFFQIFFNCIISSKYNEVKKEYITEEIKNIIPEMSL
FT                   PLRYYLKETVYKEKSIIYKMYGKLDDILFDFYKFMEIYKKNSKITEELKQENFTFDINY
FT                   HIEIYKEAELVRRCNREIEIKYCKERYIKNAYLLEEM"
FT   gene            complement(509067..509990)
FT                   /locus_tag="Sterm_0464"
FT   CDS_pept        complement(509067..509990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07341"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07341.1"
FT                   /translation="MFLDNIDIKYMIFYTNEDITGQNDITTHDLDNTSGERLISDGATL
FT                   TCKEQLGYHTYSQSSNINPYNGATPLITMSLPSDRNVFLFGLLPLALTTDLDIKYFSGY
FT                   EKLKCPIDGAPCTLEPVEWISYYDGIEVNGGYPLLMGSRLKCQKAVDHGKDLLQLVFMS
FT                   NGQEELGDIRAMMWWSERAPYYGVDPNTNNIFIKGYIKAMDALSAYNGVKKIISLAQGL
FT                   GTATASSGAVGTITYTSVKLVYAVDGGISSINKLITGKNYSIVREIVQTKLAKEAYLKE
FT                   YEKEHPIKANICRASGTPTDLMPPLS"
FT   gene            complement(509991..510758)
FT                   /locus_tag="Sterm_0465"
FT   CDS_pept        complement(509991..510758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0465"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; Sel1 domain
FT                   protein repeat-containing protein; SMART: Sel1 domain
FT                   protein repeat-containing protein; Tetratricopeptide domain
FT                   protein; KEGG: gur:Gura_1985 Sel1 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07342"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW6"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACZ07342.1"
FT                   /translation="MKKKYLKFLLIIFLALLGLFCEKQNSRNDVISKASEEYLSQVDGT
FT                   KPGELDSLLISGIASYGDGNKALAIRYFEKAYELGDVRGAVKLYELYNSEKDEEKIKEW
FT                   EVKAAEMGEASVQNNLGVRLYKQGNFNGAEKWYLKAAEQNHLKAWKNLGYLYLKQQKYK
FT                   EAEKWYLKAAENKDSDSQNNLGIIYKKTGDFNEAEKWYLEAITQGNLAAQYNLGILYEE
FT                   NLNNIEKAVYWYKKSAKSGYKNSKKKLKELKEK"
FT   sig_peptide     complement(510687..510758)
FT                   /locus_tag="Sterm_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.527 at
FT                   residue 24"
FT   gene            complement(510803..512431)
FT                   /locus_tag="Sterm_0466"
FT   CDS_pept        complement(510803..512431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07343"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07343.1"
FT                   /translation="MGNKTLDDIFNELEEKYSGNRGLINNSARGQNTKEINSSGLNGLL
FT                   EKSRNKISELYTGKNIILKLNGEILDIKDINFELDKTLFCHDYLKLTFTIPSEEIDKYY
FT                   GYVFTLNNTLEIELINNDEKFKKIFHTFNIENINIEESMGERAVVLINTPSATFQMSKI
FT                   TKFRSFQSLELTYREIAEAVIADYPDITLYLGNEFDRNIQKIYIQYNENDWDFLVRICK
FT                   DMGIPMASHLDEIIMGNEINLEIYNAELDNAVYGRGREGENIIFKVREAATPYNTGERV
FT                   KITLKNQGSQGEDGTDTRIVSKALLRMKDNYVVNDYELIEISHEFEALKNSVGYIIEGK
FT                   VLKIGGTDGIATMTVDFSHGLEKSAEKKSQAYEDEYAGSHNFPYCTEYSSSNSGMFCSP
FT                   EKGDIVTIYVPQNNENFSYVTGAVNNPGSERFSNPNIRNYTLSGDDSAGGAPMFNFQLN
FT                   SKVFSVNTTDFIGLNSKNNMIMNTTNANMTAENYTANTKNITEISSGVKSTIAKEISQV
FT                   SSGKTVATSGGIYNINGGGNVIINK"
FT   gene            512746..512934
FT                   /locus_tag="Sterm_0467"
FT   CDS_pept        512746..512934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07344"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07344.1"
FT                   /translation="MAEYKKMVFENIRITNLDKKEKLEYVKYIEKHIEILKNSKLKKEI
FT                   FMNRIHTFFSTTSEKRI"
FT   gene            513756..514238
FT                   /locus_tag="Sterm_0468"
FT   CDS_pept        513756..514238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07345"
FT                   /db_xref="GOA:D1AMW9"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07345.1"
FT                   /translation="MKLLTEPKLKMCIVLLTGYLLTIFTNTFKNDYLLVMMCMIFSSIP
FT                   NVSLYLTSKKMIALSMICSIFGWTVGAVSSYIKNVDLLLFPIGGYITMKLIDNTMKKKS
FT                   GLIVITYLASFLFRGNFGDLMRIWKSYGEAIFASLIISYITEILIKKIGNKNENRY"
FT   gene            514222..514680
FT                   /locus_tag="Sterm_0469"
FT   CDS_pept        514222..514680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07346"
FT                   /db_xref="GOA:D1AMX0"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07346.1"
FT                   /translation="MKIDIRALKLSLYFLFILIIIKIYPDPNQFYLLYPAVVICEYSSH
FT                   ETLDSFKKRTFGFIKGGIFGMILALYVGITPFTVVTALIIIVIISEHIGSSFLVPTLTT
FT                   FLPTVMKSTHIKYLEIKIQHYLIIMLLCIIIDYTINRVFRIPKEKLHL"
FT   gene            514693..515832
FT                   /locus_tag="Sterm_0470"
FT   CDS_pept        514693..515832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0470"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   shl:Shal_3506 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07347"
FT                   /db_xref="GOA:D1AMX1"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX1"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACZ07347.1"
FT                   /translation="MNNKRRRGRKKKKIFLKKKIEFFNENKGIKIFCITLIAMISFYII
FT                   YSIRMDYITPYSSNAVVEYDVIPVYSRVNGIIKSINVKNSDIVKKGDKLFDIESEQYRI
FT                   LYELAVANKESAERHIDTMDKEISVEKAQIEKAQKNLDTLSKEHEKYKMLFEKEMISED
FT                   LYDDIKIKYDNAKNDYEIAKRQLKQLEVSKGKEGSDNDLIKVSDSQISKAKLDLEYTEI
FT                   ISPINGIVEMKQLYSGNAVNTSVPLLYIINKDELKISVETKEKTINAIKNSDLILVVFD
FT                   AYPNKIFHAKLVDITKISSSSYTKPGNLEDVEQIDNKVVRPQGFGKVNIKITDKIPENY
FT                   DIMGGGKASVLFFSKDVGKPMKLFGKVWIKAVQLFKYIQ"
FT   gene            complement(516438..516644)
FT                   /locus_tag="Sterm_0471"
FT   CDS_pept        complement(516438..516644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0471"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   rpi:Rpic_0753 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07348"
FT                   /db_xref="GOA:D1AMX2"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX2"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ACZ07348.1"
FT                   /translation="MPTIYVEILEGRSDEKKKKMIKDMSIACAEALGCPLSAVKMIVSE
FT                   MAPKHYASGGVTWDDQSEKPYDI"
FT   gene            complement(516670..518076)
FT                   /locus_tag="Sterm_0472"
FT   CDS_pept        complement(516670..518076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0472"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   vsa:VSAL_II1024 putative 6-phospho-beta- glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07349"
FT                   /db_xref="GOA:D1AMX3"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX3"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ACZ07349.1"
FT                   /translation="MVHKPIKIVTIGGGSSYTPELFEGFIKRSKELPIGEIWLVDIEEG
FT                   KEKLEIVGALAKRMVKAAGLDWKVHLTLDRKEALTDADFVTTQFRVGLLDARIKDERIP
FT                   LSHGILGQETNGAGGIFKAYRTVPVILDIVEDMKKLCPDAWLVNFTNPSGMITEAVMRY
FT                   GNWDRVVGLCNVPILCQKIASGSLKIPEEELFFKFAGLNHFHWHRVWDKTGEEKSSQIL
FT                   RDTYSNAESMAEAMEFVRKSAGESGNTNDSGVKNIPNISYLAEQVQNLGIIPCMYHRYY
FT                   YITQDMLDEELENFAKGETRAEVVKKTEKELFELYKNPDLSIKPPQLEQRGGTFYSDAA
FT                   CELINAIYNDKRIHMVVSTKNNGAISDLPNDVVVEVSSIITSQGPVPISWGSFDPSPKG
FT                   MLQLMKNMELITIEAAYTGDYGKALQAFTINPLIPHGKITKTLMNEMLIAHKKHLPQFK
FT                   EVIEELEKIK"
FT   gene            complement(518095..518943)
FT                   /locus_tag="Sterm_0473"
FT   CDS_pept        complement(518095..518943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0473"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: CAT RNA-binding domain protein; PRD domain
FT                   protein; KEGG: eca:ECA0858 putative beta-glucoside operon
FT                   antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07350"
FT                   /db_xref="GOA:D1AMX4"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX4"
FT                   /inference="protein motif:PFAM:PF03123"
FT                   /protein_id="ACZ07350.1"
FT                   /translation="MIKKILNNSLVLVNDGDEEKIIMGKGVGFSSHIGEKVDIKKIEKI
FT                   FSLEKKNTLQNYERLAMEIPEIYFEIAGEIVERANKEFTGIFNAQLFLSLTDHISYSVE
FT                   RVNKGIVLQNRLIWDIKAFYSKEFTVGLWALTLIKEKIGIQLPEEEASNIAFYLVNAQS
FT                   SALKMGETILSITMLKEILNIIQYHTNHLLNKDDLHYLRLVTHIQFFVQRVLEGKMLKN
FT                   REIFLLNQYVRLYPSETKCLEKINQYVKNCVGKDISVDEKFYLLIHIIRNVQELDGTDE
FT                   Y"
FT   gene            complement(519047..520903)
FT                   /locus_tag="Sterm_0474"
FT   CDS_pept        complement(519047..520903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0474"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, beta-glucoside-specific IIABC
FT                   subunit; PTS system, glucose subfamily, IIA subunit; PFAM:
FT                   sugar-specific permease EIIA 1 domain; phosphotransferase
FT                   system EIIC; phosphotransferase system PTS EIIB protein;
FT                   KEGG: eca:ECA0860 PTS system, IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07351"
FT                   /db_xref="GOA:D1AMX5"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX5"
FT                   /inference="protein motif:TFAM:TIGR01995"
FT                   /protein_id="ACZ07351.1"
FT                   /translation="MDYKKIGKEIFDLVGGNNNITQMTHCATRLRFVLKDFSSIDHEKL
FT                   KAIPGVLDVIFKGGQLQVIIGPDVPEVYRAADALYTGSKNNNNEKGENQNILNRIMAVV
FT                   VGIFNPMLPAITGAGMIKAVLALLKAFSLIDVNGQTFAILSFISDSAFYFMPMILAYSS
FT                   AKVFKCSPGLAITLAGVLLHPNFIAMKNAGEAVKFAGINVPLAGYASTVIPIILIVFLM
FT                   SYVERFAEKILPVHIKYIGRPLIILLVMAPLSLIVVGPLGFNIGNILAAGIAFLDNKAG
FT                   WLVPTVIGTFTPLLVMFGLHNGLFPIATTQLGVSGHESIMGPGMLPSNVAQGAACMAVA
FT                   VKTKSKEMRQQAISAGITALLGITEPAMYGVTLRLKKPLIAVMIGGGLGGLYAGLTGVV
FT                   RYSFGSPGFATLPVFISDDPANIRNALISAFIGIIVSFVLTLLIKFDYNYGSPEEVITD
FT                   QALSAARPILQTAVINSPLSGEVTSLSEVNDEIFSKGLLGKGVAVIPNEGKVTAPYDAE
FT                   VSIIETKHAVAFTGDNGIDLLVHVGIDTVELNGKYFNCKVKNGDKVKAGDVVLEFDINA
FT                   IKKAGYKIITPIIITNSNEFESITQISSENIISGKPILNLEV"
FT   gene            521285..521386
FT                   /pseudo
FT                   /locus_tag="Sterm_0475"
FT   gene            521603..522613
FT                   /locus_tag="Sterm_0476"
FT   CDS_pept        521603..522613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0476"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: swp:swp_3961 regulatory protein,
FT                   LuxR:response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07352"
FT                   /db_xref="GOA:D1AMX6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX6"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACZ07352.1"
FT                   /translation="MEVTIFIYNIFLIILCSIVLTLSGFYYLKTKNKCYFGIIVLFSLY
FT                   LFNNIVVYTTEFIKTFSLSYNNLFISIPTYKTLILISILAAYIMINNIFLNLKNPKIWY
FT                   FALAFLTFFLLIILVMERTAFKVWLFFLPGDIFFIVFNIYILNILRNKELTKGNELLRC
FT                   YKKIMKYFLLMSCFVLIEDIFVIFKIDIYTDTILHITNRNFSEDILRISQSIMIVYYFF
FT                   NYYPFESNQKEERHIILSGSNYKPASKDKKNEDKYNYYIFHLFCKTYLFTIREQEVFQH
FT                   LLEEKNNKVISESLYISVGTVKAHVHNIFIKAKVSNRRELAQTYNKWKENQIASI"
FT   gene            522636..522779
FT                   /pseudo
FT                   /locus_tag="Sterm_0477"
FT   gene            523086..529715
FT                   /locus_tag="Sterm_0478"
FT   CDS_pept        523086..529715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0478"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: cha:CHAB381_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07353"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX7"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07353.1"
FT                   /translation="MKNKKLLFALALNAFSTSIVNANDQAVKKYNILYNNMVKNIDLEK
FT                   TNESNYGLIEKVLNQRNKELKDLYLQNDYIVKPEYLEWQIFFTGFYNYADRGGNQKNIF
FT                   NKTAADAKTVDLGMVIPIKGIKRNDLILNITSVNEPIVNVNLNPIKAPEMTAPEVVYTE
FT                   IDFPNIPIIGSIPLNQQNSLNAIKFGERKSEVKYNVLGSSIFNNLNVDSTNGTSLLLDE
FT                   NTRDILITGEMLYSNGTVAGTSAYTYNHTGYPDGFSVNNIGNGGNFEIKGNWDMSVVDG
FT                   MVYQFGVGFLSYMPYFSNVDSKVLFSGNLELTAKSTSPSYFSRSIVGLSLDLSNQNLDP
FT                   STKAVLENSGKIILRSGNSVTKNIIAMQLIGGSSTSTQAGELINSGNIIIETRTDLIGD
FT                   AGGVGILVSVEPVTKPVLVKSGNILVNGKGNTGVLLGQENFQTDYVNSNITIDGSNGKI
FT                   ILEGERNSGLNAKRAVTSTGNSLLDNVKNMNILINGLNTPAIVRHTENPIEMTMDMKLN
FT                   DSIIQSVEFGENSVKSSLVQVGSNSSYSFGNVILESSLANSIIPINAGRQNIIAAGSSS
FT                   SIIINYMPITINSGAKAMIGIASEGTIENYADIVNNSSVYEENNYKYGSVGLALTKYYS
FT                   GSSALNKGNIDMNGDYATGIYNLGKMFSSDSDHIVINGKNSTAVYAGTSHPNYYSQTVI
FT                   NADKIVVNGDKSTLFFSNGGNIEIGTHTLGQAMELTAAGKDTFAFFINKYYNLFGKFSL
FT                   NSDVNLSLKDGAIGFYYKGAGASNIVDIPLYLSTIVDTANGKLSINSDDKSYNIAIENS
FT                   GIKLSDLANISGSGIEFNGSKKAKLLKSKLVLDIDSNIDKNNTTGDKTYRDLEIGKSGV
FT                   SILEGITLSGTENDLIGIGQSYNYNDPVNSYISSENAGIIDLSGNNSIGMYSKRSQLTN
FT                   AGKISAIGDKSTGMYIKSGTVTNDGEIIIGDSGVGIYGETYLEPSDNPSNSSSSININN
FT                   TGKITATAGNKAIGIYGNQNAVAGTNSSGNISLFTGTEIDMSSSKGGVGIYSNGISISG
FT                   LGNTKITVGENGTGLYIKDSNANFVDLDLNLTGDNSVGVYTDGSASFGGTGNINIDGKG
FT                   IVVFNVAGSGTFNENFTVNSTEESQYILQNIKDKILYYNSTANLGGGGTFVSGVNSAVL
FT                   LGEDSILNSENSNLVGIALTGGYVNGLPVNINGEILEHEATNKGKINFGDNSVGIYVIN
FT                   GASGKNTGEISLGKSSVGLYGSGNGTNIDNAGKIYIGENSVGLYNKDGNSISNSGSIES
FT                   IDLRVIGLYLDGNSNSIGVNTGEIKLLGDKSIGIYISENGTKTINNTNRIEIGSSNLAE
FT                   DPSIGIFNNNINGTVNNSSDIISGKNSINIYNKGGQINHLLGNIEVGEKGTGIYTSSGS
FT                   VKLTSGTLNLNGIAAVGVYGTNNAIIDINAKINVSQESYGMVLIGESDLTNRDVSTLAD
FT                   KGVLLYSDGNVNVKNEYGANINVAGSNSIGFYMKNGGTLVNKAEIIGNSGIGNIGIYNK
FT                   SGNIDNSGNIKIGNSLIIDPQNPFVNEYAVGIYGDGVKNIKNTGNIEVGANAVGFYITG
FT                   NLNEALNTGNISSDSEKAIGIYSEQGAVRNTGNITLSGDGSIGIAAARNSKISNSGTIT
FT                   MNGNENIGIYAHSNSQIINESTGKIYINGNDSIGVQLSGGSVLENYGLIEVTAGTIGSM
FT                   QIVTGDPAYTPPSIINAGVIKVDEKFELDGLNLIIKPDPESFRAPTMEELIKNEYALED
FT                   INAGFLLSNKVNIAAPSFDFGNNTVGIDPLFTQGTNARVYKFENVFDPTTPEGGPNTGK
FT                   VAVKSGSLTFDAIPVTNDKGKIDIWMEKINYNEFTQGSWQNEFAGNIEGNYLNATGDAL
FT                   KLYDRLDLITEKNELYKRFDQLAGSVYANINQRESDIAGVFENSLYLLQDSKNNTKENV
FT                   KINVITGQGKMKDDTAGVTGYDFGTVGVLALREVERTYKHTFGYSLGYLHTSFEMDDNN
FT                   NSEEWVDTIQLGVHNKYTVSGWILRNDLTGRASIHNIDRNIDWADGRSEMNGFYETYSI
FT                   TSDNKLGKEVLGGKNVSITPYAGLKAMYVTRPSFEEKGLEKLQVEGNDAWSVKPKVGFE
FT                   FKASTNESKNGWKLKGALDITYEYELANLNTQEKARLVSLEDGYHNLAKPEEENGRLRT
FT                   KVVIGTEIEDRYGIFLTGEYSIGEHSQDDYRAGVTLKAVF"
FT   sig_peptide     523086..523154
FT                   /locus_tag="Sterm_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            530370..531044
FT                   /locus_tag="Sterm_0479"
FT   CDS_pept        530370..531044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07354"
FT                   /db_xref="GOA:D1AMX8"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07354.1"
FT                   /translation="MNKLIRFYLGEVRNFIELFIGFHILNNILEILLKGQGLTSVWSMI
FT                   LPLIILIYLIKFNLSDTGKETFTFVSMTDNSPTKILLSKLIVSYVFVLMLSAVNCIFII
FT                   IHNIYQYESSWKSILMLPAWSIFVTTMAICYISYFIIWIKSFSINKISRKIIVISAVVI
FT                   WLVINATVRNHVFLFSIDAVHGSRYFGGSTMTVWSILWHLTWCTIFFLVTAYLQKKKIN
FT                   QI"
FT   gene            531263..531877
FT                   /locus_tag="Sterm_0480"
FT   CDS_pept        531263..531877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0480"
FT                   /product="TraX family protein"
FT                   /note="PFAM: TraX family protein; KEGG: rms:RMA_0932 F
FT                   pilin acetylation protein TraX"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07355"
FT                   /db_xref="GOA:D1AMX9"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMX9"
FT                   /inference="protein motif:PFAM:PF05857"
FT                   /protein_id="ACZ07355.1"
FT                   /translation="MSSFSLKIIAIIAMTLDHWNIILGGSIYMRILGRLAFPIFSFLIG
FT                   EGYRHTRNKKNYFLKIFFYSVLLQIPVFLFYSSNEDLNIFFTLATGILFISILENNKMN
FT                   KLTKFLLVLFLVIGSEYFKFDYGAYGVLSIVIFYNFRERKQKIFWLFLFINIVYIYLDR
FT                   VFLIQIFSLFSLFLIFKYNGKEGIKNSFISIIQLIYCCYIY"
FT   gene            complement(532367..533350)
FT                   /locus_tag="Sterm_0481"
FT   CDS_pept        complement(532367..533350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0481"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   geo:Geob_1659 aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07356"
FT                   /db_xref="GOA:D1AMY0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY0"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ07356.1"
FT                   /translation="MKKIIFLIVIFNLFISCQKEKIEIKKVRIGFPGSVNVLDGVAGIA
FT                   QQKKFIENELKNIGYEVEYINFSGNGPAVNEALIGGKIDVAIYAEVPGIILKSKGIDNS
FT                   LYAIADNHINAGIIVKKGSTIKSVSDLKGKKIAFPKGTYIHRFVIEILKRNGLSENDVE
FT                   FLQISSDAESALLGGSVDAVAFTETFTERLTRDKGLTEIIADTEKNPDLAGKSIFVGNN
FT                   NYTKKNPEAIEAVLKGLKKGVDFIFENEDEAYRILAESHNMNVNTVRKIYDFNKDNINK
FT                   RYMINITPEIIFQLEQCKEFLLENNLITKDFSIEEWSDKSFYDKVF"
FT   gene            complement(533384..534151)
FT                   /locus_tag="Sterm_0482"
FT   CDS_pept        complement(533384..534151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0482"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: geo:Geob_1661 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07357"
FT                   /db_xref="GOA:D1AMY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ07357.1"
FT                   /translation="MSDTILEIKNLEKKFIINKNEIKVLENINIDIKKGEFITIVGHSG
FT                   CGKSTLLKIIAGLETSDSGIIRLNGQEIKGPGINRGVVFQEHRLLPWLTIKENIEFGLD
FT                   NLLKKERENISLELLEMVNLLEYKNAYPKQLSGGMAQRVAIARGLASNPEILLLDEPFG
FT                   ALDALTRIKMQKEILKIWSKSNKTMIMITHDIEEAVYLGTRIVILSSKSAGEKIIKVEH
FT                   PIRDRSSYDFLYIKNKVYRELFEDKNNELEYNI"
FT   gene            complement(534173..535000)
FT                   /locus_tag="Sterm_0483"
FT   CDS_pept        complement(534173..535000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0483"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: geo:Geob_1660
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07358"
FT                   /db_xref="GOA:D1AMY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ07358.1"
FT                   /translation="MEILTEKIRINPKKAAFYFISGFVNKGLGIFNYIALPVIIVIFWI
FT                   SATKNELFSPVILPSIAMVFTSLISQISSGQIFQDVLISLSRVMQGYGIGLILGVFMGT
FT                   LMGISGSTNKFFSGTFDAIRQIPPLAWIPLVILWFGIGETSKVILIAKASFFPILLNTI
FT                   SGIKSTPKAYIEVAKLYNKNSWKIFRQIYLPYALPNIFVGLRLGLSSAWMTVIAAELIA
FT                   STSGIGYRINDARNLLQSDVVITGIIVVGLLGVIMDRILDRILRELTPWNTTK"
FT   gene            complement(535045..536847)
FT                   /locus_tag="Sterm_0484"
FT   CDS_pept        complement(535045..536847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0484"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: eca:ECA1555
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07359"
FT                   /db_xref="GOA:D1AMY3"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY3"
FT                   /inference="protein motif:PFAM:PF00085"
FT                   /protein_id="ACZ07359.1"
FT                   /translation="MGHPTVYPTGVTIYNSDKAWNGYTIIQACELGAVLLDMNGKELRL
FT                   WEGLHGFPNKIFPGGHILGHSGSRNPKYGMQDMIDLIQIDWEGNIVWKFNRYEYIKDGE
FT                   NEAEWMARAHHDYQREGSSTGYYSPGQEPKINSGNTLILVHKNLYNKKISDKLLLDDAI
FT                   IEVDWEGNVIWEWICSDHFDELGFDEAAKNVLFRDPNMRKAGEGMGDWMHINSMSTLGP
FT                   NKWYDQGDERFHPDNIIWDARESNIIAIIEKRSGKIVWKLGPDYSKEELKHIGWIIGQH
FT                   HAHMIPKGLPGEGNILVFDNGGWGGYGEINPMSKIGQKNALRDYSRILEINPVTLDIVW
FT                   QYTPAEAGFPHPTDSFRFYSPYISSAQRLENGNTLIDEGADGRIFEVTPEHEIVWEFIS
FT                   PYWGKTTKNNMIYRAYRIPYDWIPQLEKPEEKSITAPDIRNFRLPNAAKTGAASIIKVE
FT                   GLRPYEDSSDALCIIVDQENIKRSPKLFTIDREIFTENNTAEKKEAENRNEEKILVLFG
FT                   AERCVHCKNLYLILVKIISKYKNKLKFEYIDVDKKTEFIEKYQIRGIPTLIVFEKGKIL
FT                   AQSYGEKSEAELIEFFNDIENRFL"
FT   gene            complement(536872..538344)
FT                   /locus_tag="Sterm_0485"
FT   CDS_pept        complement(536872..538344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0485"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: wsu:WS1004 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07360"
FT                   /db_xref="GOA:D1AMY4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY4"
FT                   /inference="protein motif:PRIAM:1.8.7.1"
FT                   /protein_id="ACZ07360.1"
FT                   /translation="MDIYNFLNVLDIINTEKGETEFSKIRSSYGVYLERTGNFMVRGRV
FT                   NSGEITPEQGIKLISLGRRLNKESIHITTRQDIQFHDISKEELKITAKELEELGFSVVG
FT                   TGGNTIRNIVISPKSGYENEEFDVSVHVKEVSKKLKDAGIKNDFPRKYKIAFSNNETDD
FT                   INAQINDLGFIAIKKNDIKGFKVYGGGGMGKNPRQGILLQDFITEEEVYVSITAMAELF
FT                   NKYGNRENKHKARIRYILDNFGETKFKEEYLKLFFEKSKEKDLKLNLDNSSNKFEYTNK
FT                   ENLYLHPLHGKLKINDLEKIIIFIKEIKYKTKIRLTNTQGLYILGLNKEDKKKGEEIFY
FT                   DLYNQHKVLSLTACTGASTCTLGFLKTDILVKEIIEFLKTKNEKVLEILPNIGISGCIN
FT                   SCGQHLIFPIGFMGKKRKTENGNQLDIYEIFLGGRRAEVLKIGESYGDIERSKIKDFLF
FT                   YLGEKILESKKDYQTFVDENKIEIENFLNYFK"
FT   gene            539269..539850
FT                   /locus_tag="Sterm_0486"
FT   CDS_pept        539269..539850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0486"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: hypothetical
FT                   protein ; K03152 4-methyl- 5(b-hydroxyethyl)-thiazole
FT                   monophosphate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07361"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY5"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACZ07361.1"
FT                   /translation="MKVLLFCAKGFETMEFSVFVDVMGWARNDYDYPVEVETCGFTKTV
FT                   YSTFNVPVIVDKTIDEISADDYSALAIPGGFEEFGFYEEAYNPALLNLIQAFDIQKKPI
FT                   ASICVAALVLGKSGIITNRKATTYHLKNGYRQKQLAEFGVNVVNERIVIDDNVITSYCP
FT                   ETAADVAFELLNKLCGKEKMLVVKSAMGYR"
FT   gene            complement(540242..540664)
FT                   /locus_tag="Sterm_0487"
FT   CDS_pept        complement(540242..540664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0487"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: cjj:CJJ81176_1547 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07362"
FT                   /db_xref="GOA:D1AMY6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY6"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACZ07362.1"
FT                   /translation="MNYSINDVAVRFKLSVHTIRFYDKKGLLPFVLRNQKGNRVFTESD
FT                   LNMIQTICCLKDTGMPIRDIKKYIDLCMKGTETIALRNELLNKHKKEILKQIDMLKDNL
FT                   SLLNLKIEAYESSNAVEIITERLKKAAEEKRISNLK"
FT   gene            540766..541527
FT                   /locus_tag="Sterm_0488"
FT   CDS_pept        540766..541527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0488"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rle:RL1343 putative short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07363"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ07363.1"
FT                   /translation="MDIKEKTAIITGGSRGLGRNTALNLASRGVNIIFTYNSNKFEAEK
FT                   TLQLIQEYGVNGAMLNLDTANTKLFDAFVQNVEKILQEWKCKTFNYLINNAGTSHHNSI
FT                   ENTTEEELDTLYNVHFKGVFFLTQKLLMLLNDGGSIINISTGLTRFTSPGSAAYASIKG
FT                   AVEVMTRYLAMELGPRKITVNTIAPGAIQTDFSGGVVRDNPEVNKMIAEHTALGRAGVP
FT                   DDIGPMIASLLSDSNRWVTGQRIEVSGGMFL"
FT   gene            541788..541916
FT                   /locus_tag="Sterm_0489"
FT   CDS_pept        541788..541916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07364"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07364.1"
FT                   /translation="MKKTISILALTLTVSFTALADAVSYDSSKEIIDRIQLEMKHK"
FT   sig_peptide     541788..541850
FT                   /locus_tag="Sterm_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 21"
FT   gene            542090..542218
FT                   /locus_tag="Sterm_0490"
FT   CDS_pept        542090..542218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07365"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07365.1"
FT                   /translation="MKKILLIPALTLAVSFTALADAVSYDSSKEIIDRIQLEMKHK"
FT   sig_peptide     542090..542152
FT                   /locus_tag="Sterm_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            542223..543224
FT                   /locus_tag="Sterm_0491"
FT   CDS_pept        542223..543224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0491"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rlt:Rleg2_2710
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07366"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ07366.1"
FT                   /translation="MKNINIKQNNYWRKKMEYKGFGLGCMSLSTADQAESSAVIHTALD
FT                   EGISFLNTGDFYGSGESEMAVGEALKGYSREKYYISVKFGALTMPNGGLYSLDVHPDRI
FT                   KNYLTHSLKRLKLDYIDLYQPCRIDLGIPVEETIGAISDLVKEGYVRHIGLSQVDSETI
FT                   KRAQAVHKIELVEMEYSLFNRGIEKDILSTARKLDIGVVSFGTLAHGLLSGSWTKERLK
FT                   HGEFPLHMMSPLLSKENVEKNIEFVENLDQIANEKNVSVSQLAHAWILSKGDDIIPLIG
FT                   TSKVKHLKNSLESKNLFLSEEDIQRIENAVPQDKISGESLRRMQFKNGVIVR"
FT   sig_peptide     542223..542327
FT                   /locus_tag="Sterm_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.779 at
FT                   residue 35"
FT   gene            543289..543687
FT                   /locus_tag="Sterm_0492"
FT   CDS_pept        543289..543687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0492"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: gur:Gura_3514 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07367"
FT                   /db_xref="GOA:D1AMZ1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACZ07367.1"
FT                   /translation="MNEVLEFLKNCKVFFVATAEQGKPKVRPFSFVMMHEEKLYFVTGN
FT                   QKPFFKQIQANPEIEICGTSQKMEWIRLSGKAVPDSRLEIKQRAFEELPFLKNNYKSVE
FT                   NPVMECFYLGEAKADFCKIDGSSKTVVL"
FT   gene            543842..545278
FT                   /locus_tag="Sterm_0493"
FT   CDS_pept        543842..545278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0493"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dal:Dalk_2314 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07368"
FT                   /db_xref="GOA:D1AMZ2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ2"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACZ07368.1"
FT                   /translation="MNTEKYEQYKNKNVILITVLLLAFMTSLDGSIVNVALPMMSESLS
FT                   VNTQSISWVFSSYLIGICTLILAFGKLGDLKGKMKVFKTGILIFTLGSMMSGLSAAFPF
FT                   LITARIIQAVGAAASMATSQGIITEAVPRNEIGKAFGLFGTCIALGTMMGAPIGGFIIS
FT                   IFKWNYIFFFNVPIGIIIFILCFKFLPKEHVNNGKFPDIRGFLLFVITIVSFFIAVMQG
FT                   GAVGYGNPFIISCFVISIAAFIFFVFTEKRADDPMLDLDIFKSKSFSISIFCSFLSFVA
FT                   IFCLLIINLFYLHYAREYDPSFIGLLMMFYSIILTLSSLFSGILSDKIRPELLTFTGLA
FT                   IMGAGFFFMTLLNISTPIFLLLIFMALIGLGAGLFQSPNNSLVMSAASKDKLGIAGSVN
FT                   ALVRNIGMSIGIAVATILLYDRMSQKAGYKVSTYVAGSDDIFLYGMRYVYVVAGILCVI
FT                   GAIITFMRFYHQKISFNNKN"
FT   sig_peptide     543842..543934
FT                   /locus_tag="Sterm_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.615 at
FT                   residue 31"
FT   gene            545293..545505
FT                   /locus_tag="Sterm_0494"
FT   CDS_pept        545293..545505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK14728 gene product from transcript GK14728-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07369"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ3"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK14728"
FT                   /protein_id="ACZ07369.1"
FT                   /translation="MKTIIITGANSGLGFECAKNILLENSDYFIIMACRNIEKSEKAKI
FT                   ELIGKTKNKNIQVMELNLSSFDSVR"
FT   gene            545702..546283
FT                   /locus_tag="Sterm_0495"
FT   CDS_pept        545702..546283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_7384 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07370"
FT                   /db_xref="GOA:D1AMZ4"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07370.1"
FT                   /translation="MKKIAKIFLCVLFISISMISCSQGNKGGKISNTNKTLIIYYSASG
FT                   TTEKVAKELQRKTKGDIYFIKTNMPYSTDQEVLGKEMALERENGNIRELSGELPDLSNY
FT                   DLILIGGPVWSGEPSNPIQKYLSITDFNGKKVAGFWTAYGEPGDYANVFKKLVKNVELH
FT                   EGLSLINTDVSNEKELESKINTWLSTLGIL"
FT   sig_peptide     545702..545770
FT                   /locus_tag="Sterm_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.567 at
FT                   residue 23"
FT   gene            546328..546747
FT                   /locus_tag="Sterm_0496"
FT   CDS_pept        546328..546747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07371"
FT                   /db_xref="InterPro:IPR024422"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07371.1"
FT                   /translation="MRNILVLFLTGFLSLAVISNTVINNKQKNPAVSEETKTKSANTYD
FT                   LLEEYKKDASKRQPTYTGENITVSGVVVYKGPDIHGLPSLELSDKVNGTSHVLCVFDSA
FT                   DSLNKISKGDNLTISGKFHIVSSDDMVVLKQSKIQ"
FT   sig_peptide     546328..546387
FT                   /locus_tag="Sterm_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.758 at
FT                   residue 20"
FT   gene            547212..548984
FT                   /locus_tag="Sterm_0497"
FT   CDS_pept        547212..548984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0497"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="PFAM: 67 kDa myosin-cross-reactive antigen family
FT                   protein; KEGG: oan:Oant_4631 67 kDa myosin-cross-reactive
FT                   antigen family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07372"
FT                   /db_xref="GOA:D1AMZ6"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ6"
FT                   /inference="protein motif:PFAM:PF06100"
FT                   /protein_id="ACZ07372.1"
FT                   /translation="MYYTNGNYNAYMKPQKPKNIDGKSAYIVGAGLAGLAAAVFLIRDG
FT                   QMEGKRITIFEELPVSGGSMDAILKPERGYVMRGGREMEEHFETLWDLFRSIPAQETPG
FT                   ASILDEYAWENQNDPSFSYARIIENKGQRVSDDGQLTLSQKAIREILDLALTEEKDLQD
FT                   KKINEVFTEEFFKSNFWLYWATMFAFEPWASAMEMRRYLLRFVHHIATLSNMSALRFTK
FT                   YNQYDSLILPLETFLKEQGVTFQYNSKVSNVIIENFGNKKTAKKILLIENDTEKTIELT
FT                   ENDLVFITNGSITESSTYGTNTEPAPVPTEIGGSWQLWKNLAAQNSDFGRPEKFCENIP
FT                   EANWVISGTITLTDDKVIPYIEKISKKNPHSGSIVTSGPVTIKDSNWLYGYSISRQPVF
FT                   KTQKSNETIVWVYGLFSDKIGNYITKKITECNGIELCAEWLYHIGVPEKDIMDIATNYA
FT                   NTVPCYMPYITSYFCPRALGDRPLVVPEGSVNLAFIGNFAETEKDTVFTTEYSVRTAME
FT                   AVYQFLDIQRGVPEVFASSFDVRKLLNTLYYLNDQKSLDEIKKPLRDSILEKYVIRKIK
FT                   GTYIEEIFKDEKLI"
FT   gene            549532..551232
FT                   /locus_tag="Sterm_0498"
FT   CDS_pept        549532..551232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0498"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: gur:Gura_3720 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07373"
FT                   /db_xref="GOA:D1AMZ7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ7"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACZ07373.1"
FT                   /translation="MKITGADLFVKSLIKENVDILFAYPGGQVIDLFDALYGRDEFRVI
FT                   LPRHEQGLIHAADGYARSTGRVGVCLVTSGPGATNLVTGIATANYDSVPLVCFTGQVST
FT                   DLIGNDAFQEVDIVGITRPITKYAVTVRNREELGPVIKKAFQIARTGKPGVVIVDIPKD
FT                   IQKELGTDKYPEKVDIRGYKPSVAVHTGQLSRAMKVLEEAKRPLFLAGGGVNVANAQKV
FT                   MLELAEKTQIPVVTTIMGKGSIPTSHPLYIGNVGIHGSYAANSALSDCDVLFSIGTRFN
FT                   DRITGKLNEFASNKTIIHVDVDPASISKNIAVNIPIVADAGQAIVAMLERSKPFNDAEW
FT                   LTEIQSRKELHPVEMRYPGLTPQIIIEKINKIFDNSIIVTDVGQNQLWCTQFLALDTKR
FT                   QMLTSGGLGTMGYGFPAALGAKLGNPDKNVLVITGDGGFQMNLQELATAVIEKIPVIIC
FT                   ILNNGCLGNVRQWQEMFFEKRYSYTNLTNDSGSYVPDFVKFAESYGVTGIRITREEEID
FT                   EAFIKANKVKDCPVLLEFIIDSTQNVLPIVPPGKSLKEMISTQEKEESK"
FT   gene            551229..551717
FT                   /locus_tag="Sterm_0499"
FT   CDS_pept        551229..551717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0499"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: pha:PSHAb0463
FT                   acetolactate synthase 3 regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07374"
FT                   /db_xref="GOA:D1AMZ8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ8"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACZ07374.1"
FT                   /translation="MKKRWLCLYVENEIGVLARISGLFAGKSYNLNSLTVGTTEDESIS
FT                   RMTISLYGDDKTFEQIKKQLNRCIEVIKVVDYSDIFIHSKEILYIRISFRSESDKIEIF
FT                   RLAEVYKMRVADYGAENIIVECVKEEEKNSFIINKFAKAFPNHIEVVRGGSVAMEGLQ"
FT   gene            551714..552289
FT                   /locus_tag="Sterm_0500"
FT   CDS_pept        551714..552289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0500"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gur:Gura_0986
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07375"
FT                   /db_xref="GOA:D1AMZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D1AMZ9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ07375.1"
FT                   /translation="MKIISNRQITDAAMELIIEKGYSNMTTKDIAVRANVNETTLFRRF
FT                   GSKKEIILRALSEGFWLPVLNTKIFADADWDLRSDLERFMLEYIKKITPDMVKMSIGLR
FT                   SPQIYEDTAPYIMKVPESFINALQSYFEIMKQKGKIIEGEPKVLAQTIFSSIFGFVFLQ
FT                   ASFGNMLSLSKQEKYVKESIKIFVNGIE"
FT   gene            552704..553840
FT                   /locus_tag="Sterm_0501"
FT   CDS_pept        552704..553840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0501"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   nmu:Nmul_A1582 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07376"
FT                   /db_xref="GOA:D1AN00"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN00"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACZ07376.1"
FT                   /translation="MTENKDGGMQNAPRKRRKAVMVLFSIIGIVFICLLLIMANSPGKL
FT                   APLKDEQGNAIENSISEKVWVDINGIKQGMFIRGENPQNPVILYLHGGPGTPMLQFISY
FT                   LEKNERLEKYFTICYWDQRGSGMTYNKSTDPSTMTVEQMVEDTHKVTEYLKERFGQDKI
FT                   YLIGHSWGSYLGVKTIEKYPENYLAYIGIGQVTNQTESERLAYNYMLNHAKEINDKDVI
FT                   KKLEKYDPYSDDFLSLDYLVKVRTGILNKYKIGHLHQGLAFTDILKSLFVFKGYTAGEK
FT                   INWFLGADFSMIHLFPVILKDDLFTSSVKFDVPFYIVQGAYDYQVSQVLAEKYLDALEA
FT                   PKKAFFIFSDSAHSPNMEEPEKFIEVFRKIALENPAQE"
FT   gene            554021..554626
FT                   /locus_tag="Sterm_0502"
FT   CDS_pept        554021..554626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07377"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07377.1"
FT                   /translation="MQAGDKILFGNYEWRVLEVQNNTALIITEYIIEQRAYHNAYKDIT
FT                   WADCSLRKYLNSEFYDRFTAAEKSRIIPVLNKNPDNQWYGTKGGTDTQDSIFLLSIEET
FT                   VCRYFGDSSSKLYSPGKNQRYWFERKDKNNSKRIARLEKRKEGSWWWWLRSPGRVSIKA
FT                   VYIHGDGNIGIQGNNILKGNISDGECKGGLRPALWLKF"
FT   gene            554765..555253
FT                   /locus_tag="Sterm_0503"
FT   CDS_pept        554765..555253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07378"
FT                   /db_xref="GOA:D1AN02"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07378.1"
FT                   /translation="MSRYEEGIKLIEEGCGNGKDNVISLSTIAMEPNAEGKPSPCVREV
FT                   DAHYEDGVFYVTTWAKSNKMQQIAQNKEVAFAVCFEGISGNGIGENLGWVLDPKNAELR
FT                   TKLRKTFTDWYDHANDEQNENCVILAIRITKCKIFRDHGAVRYSLDFVNRAEIEEKIS"
FT   gene            555889..556722
FT                   /locus_tag="Sterm_0504"
FT   CDS_pept        555889..556722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0504"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="KEGG: ype:YPO3960 hypothetical protein; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07379"
FT                   /db_xref="GOA:D1AN03"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN03"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ACZ07379.1"
FT                   /translation="MLVNTKEIFQIARKKGFAIPAPNFYNSDSIKTYIEIAAKNNFPVI
FT                   ASFAEVHTELMSIEEAAEMGKFYADKYDIPVVLHLDHGMTYSVIVKAIKNGFSSVMIDA
FT                   SSKSFDENVRLTKEIVKVAHAVNVSVEAEIGHVGAGQNYENHEQTESQYTKTEEAVKFV
FT                   EMTNIDSLAVSVGTAHGSYIGTPEINFERLKEIYENISIPLVLHGGSSTGDENLRKCVG
FT                   FGIAKINLFTDIVNAGMKAGQEGKAADLLSLNKDISGGMGNCLEHYFKVFKTERV"
FT   gene            556728..557183
FT                   /locus_tag="Sterm_0505"
FT   CDS_pept        556728..557183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0505"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: vfm:VFMJ11_A0798
FT                   pts system, mannose-specific iiab component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07380"
FT                   /db_xref="GOA:D1AN04"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN04"
FT                   /inference="protein motif:TFAM:TIGR00848"
FT                   /protein_id="ACZ07380.1"
FT                   /translation="MINISDLFTEDFILLDVDINSKDELFKAAAEHLYSKNIVNDKELF
FT                   IKALYDRESIGETGVGDGFAIPHAKSEAVNKPAVLYIKSNRKIEYESLDDLPIDNFFML
FT                   VVPENSGNEHINLLSSVACLLLEDEFKAKLENVKSKLEIIDLVNKYI"
FT   gene            557198..558607
FT                   /locus_tag="Sterm_0506"
FT   CDS_pept        557198..558607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0506"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system PTS fructose- specific IIB
FT                   subunit; phosphotransferase system EIIC; KEGG:
FT                   ppr:PBPRA1575 PTS system, fructose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07381"
FT                   /db_xref="GOA:D1AN05"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN05"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACZ07381.1"
FT                   /translation="MKKIVAVTACTTGIAHTYMAAKSLSKAAADMDVEIYVEKQGAAGV
FT                   EDELTSEQIKEADVVIFAIEKGIDESRFAGKKIYKTKPGKAIKEGKKTIEEALEGKGIY
FT                   IGESLNGSSAVKTGNTASKKKTGFSGAYTHMLAGISYMIPIVVTGGILIALSFAFGITA
FT                   FEKEGSLPWALFQMGGGSAFALMFPVLAAFIAYDIADKPGFGPGIIGGYLAYTSGSGFV
FT                   GAIIAGYLAGYLARYINKNLKVPEFLQGLKPIVIIPVVTTLVVGLVILYVVKVPIIYLQ
FT                   DMVSAFLNSLADNNTGAIVLGLAFGCLYFDLGGPVSKMVYSFAIAAYTTGIYTPMGAAM
FT                   VCGMVPPIGMAIATFLKPKLFSEDEREAGKTALILGFSFITEGAIPFLISKPKASIIAN
FT                   AAGSSVGSIVAFLLKLEIKAPHGGMFLAVIPNAVSSVLGLLVAVLAGSLVTALIMVVIL
FT                   KFEDRKKLVIE"
FT   sig_peptide     557198..557260
FT                   /locus_tag="Sterm_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.771 at
FT                   residue 21"
FT   gene            559292..559822
FT                   /locus_tag="Sterm_0507"
FT   CDS_pept        559292..559822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07382"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07382.1"
FT                   /translation="MKKLLFFILTLFVVTNVKIMADCSLVSKINEDILGGSVLSAVNSI
FT                   NLKGDIYCDKEGYYMVYYLQNNNYLQVGLEYKVNSLESSVPIGSFISDADKIYGKIKED
FT                   LKGRDIIFRMYLRTNKNIYQHGSISINKKGKETHYSNVNNKGTSATGAPFGARRIKYSF
FT                   AAPNWDYTDDIIY"
FT   gene            559847..560248
FT                   /locus_tag="Sterm_0508"
FT   CDS_pept        559847..560248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07383"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07383.1"
FT                   /translation="MKKIMLLITLSGMLAVVSFSFNVGGFIKDKVSEKVDETISNQMYT
FT                   MSKPVIKYSKDKKEVFITGTIKNLGPKVNNVYVFVPCYDSKGGTIPDADAHIGTIGAGE
FT                   TWNFSAEAMATNGLTIGSCDLKRIKVRGF"
FT   sig_peptide     559847..559924
FT                   /locus_tag="Sterm_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.541 at
FT                   residue 26"
FT   gene            560289..560624
FT                   /locus_tag="Sterm_0509"
FT   CDS_pept        560289..560624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07384"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07384.1"
FT                   /translation="MKKVLLLLIIVCSGFLYSNTRCELKAKKEVETFLALTGQDGIKAE
FT                   YLGQNKGKPPYYLYDVTGAESKVLLAIDMETGSIYAAENYSRNDLSSGKAVDFELLITD
FT                   VESLKCE"
FT   sig_peptide     560289..560345
FT                   /locus_tag="Sterm_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.897 at
FT                   residue 19"
FT   gene            560738..561268
FT                   /locus_tag="Sterm_0510"
FT   CDS_pept        560738..561268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07385"
FT                   /db_xref="GOA:D1AN09"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07385.1"
FT                   /translation="MKKNVIFIIGFVFFVLILAVGILSYTLISSNKKLADKENNDKVNQ
FT                   KVEELVEKKLQEKIDEEKIAKEENDRTEKKEAKNKTNFITAKEAFEGETQRGVSSDPIE
FT                   CVITAKQKRIPSNVDQKAEGGMLTCEGSKYRVYVGNDRKYNLMSVGDRYGFQVRWIESN
FT                   LYYFYVDVIGGTF"
FT   sig_peptide     560738..560812
FT                   /locus_tag="Sterm_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.472 at
FT                   residue 25"
FT   gene            561290..561607
FT                   /locus_tag="Sterm_0511"
FT   CDS_pept        561290..561607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07386"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07386.1"
FT                   /translation="MNKLIVGIYLVFGIISFSNCDLNAEKLLKTVIKEKLTVSPEDNLK
FT                   YFNPEINGKEYKYEIFEDHETHIVNRAYVILNMETGIVYRENIAEDKVEKIYQNKNLSC
FT                   K"
FT   gene            562547..569179
FT                   /locus_tag="Sterm_0512"
FT   CDS_pept        562547..569179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0512"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: cha:CHAB381_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07387"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN11"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07387.1"
FT                   /translation="MKKNEKFLKTFLMLNAVMTGVAAAGTNNVKYEKMYEKMTKNISTN
FT                   KSNKDNYQLIERILNQRNKELKDLHLQGDYIVKPEYLEWQIFFNSFADKIKINGKQENA
FT                   VTYNEDRVKSVNFAMMLPIKGIQDKNISLDISAIQPPYITPSISAVNPVAMTSPTINHD
FT                   SFTLPAAPAPKAPYFGTGSQSYNTPVGKLTSNVVYNTTGNAVYENLNVSSSAAGTEILV
FT                   KGTVTDITGTADYENGLYSGTTSALTSYTHSFATFDVINIGNNGMFEVKGDWTYRSNSV
FT                   INGHTSYGFLSYRPYYVNTDSQVTFSGNLALRNKANYVNGSATGMVGLSLNADNVTSNP
FT                   TGKATLENKGTITLGVLDPGDSYYRMVGMQLESGSTYKIDSELINSGTIILNSNYTSSM
FT                   AGMQINLSNDSRYTGNSLVKIGNIKMKSSGENYTSAIGVIFGHTSNLGLVDSNVIVDGS
FT                   GGLIDIEAYLGNGIQINRVNKPQSSNNGVENFKNLNMLINGKSIIGISRSTNNAAENAV
FT                   DMIMTGDVISSIKFGPNSVESTMFMPVRDVIILDASLKDSVGVINEGRGNSVGYIYTAA
FT                   TNATANYATLKNYMPIEIGSGAEAMTALGVRVAGTVENYADIINNSSPYTESGVVYGAK
FT                   GLVSDLNQAVMTNYGNIDMNGKNATAFYNGFLLNSASDHTVINNEKGIVIYSTASHRGS
FT                   SLGYVAGESNVSANKLEVNGSDGVVAFSHGGNITLSPLTAGGTLELTANGENTYAFYHQ
FT                   KGGGNIAGKIKINGTINANVKNGGIGLHYTGTGVTAAPVNLGTELATIIDSSGGTLNII
FT                   TDSDSYNLTLKNTTVNLSNLSNLNFDNVTFTPDAKTKMYDGGLFVDIDSNIDKNNNTGS
FT                   KAYRNTGMSASNVTVNSGITITGTENSLTAVGQDFSDIVRWGELANKGTISLSGDESTG
FT                   IYGKKSTIENTGSINLSGKDTTTIYSIDSSVKNTGEIKTGDKGVGIYSEIDPYSFAILT
FT                   VENDGKIEAGTGTGAVGIYSVLKNTNIPYYNHETILNTNSDIDMRKSQNSVGIYSIDRN
FT                   VSGTDSGKISIGKDSYGVYVNNGDVSLNNLTLNISGDNSVGIYTNGTGSFSGNGTVNVD
FT                   GKGIVILNIESTGTYNQNFVVNSTAGSSYIFQNLKNRTLVSNNTVNLGEGGTYINAVDS
FT                   NVTLDINSDLNSFNTATGNYDSRMIGAVSSGGTGSITNKGIISFGDESAGLYARDGGQI
FT                   INEGSISLGANSVGLYGEGTGANITNDILAEINVRDNSVGIVSNNGDSITSSGKINGTG
FT                   ERLTGIYSDSINNTVIQVNGDITLTGNKSVGAYLAGTGLQTFTNNAVITSGSSNSDLDP
FT                   AIGIYNNGSGNKIINNNTIKTGDNSVSIYNNSGEIIQNSGNITTGQNSVGIYTNSGKVS
FT                   LLAGSMNINGADSVGIYASENAEIENNLSMTFTDSSYGIVANSGSKLINNSGAVIMGES
FT                   SVFIYSKGGNEVLNKAGSDITLTGSNSSGIYTTDGTDIENHGHITADTGLGNIGISNKG
FT                   GSVLNTGNIKTGDSIIIDEENTFLNTYSVGVYGENTKGFKNTGNIEAGYRGIGLYIKDN
FT                   TGEALNSGDIKSDKEGVMGIYAENSTVKNTGNITLSGDESIGIAAAKKVTAVNSGVITM
FT                   NGNNSIGIYANISSKIINEKTGVININGNNSTGIQLSLGSTLENYGQINMASGIYGSKD
FT                   IAIGDQGYTPPSIVNAGVIMVDEKFEIDGINLTIKVDPDSLRLPTLEEITLGGYSPEDL
FT                   NAGFLISNSTSIKAPSFDLGGNTTKIDPNFTQGTNMRVYKFVNVFDPSTPEGGPNTGEV
FT                   AVESGSLTFDAIPVVNKDSGGIDIWMEKINYNKFTQGTWYNEFSENIESGYLNAAGDSL
FT                   KLYDRLDLISTQSALNNDFEQLAGNVYSNIMQREQNIGSMFNNTLDILQNSENNTKENV
FT                   KIGVVAGYGSREEKTSGVPDYDYKTYGVLGLREVERTYKHKFGYSLGYTQTNFEFDDSD
FT                   SKDRADTFQIGVHNKYSTNGWNFKNDLLGRMSIHNVDRNIKWSDGNKSELSSDYNVYGV
FT                   SSLNSAGREIDLGNNFTLEPYAGLELGYAVHSDFEEKDGIEKLKVRENDAYSVKPSAGI
FT                   RFGVKKDIKDSGWMVKGNLGAAYEYELGDMNRQEEASVINIENGYHKLAKVSEDKGMLK
FT                   VNASGGVEFKERYGIYVTGEYAAGNDDREDYKIGVTLKASF"
FT   sig_peptide     562547..562621
FT                   /locus_tag="Sterm_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 25"
FT   gene            complement(569508..569744)
FT                   /locus_tag="Sterm_0513"
FT   CDS_pept        complement(569508..569744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07388"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07388.1"
FT                   /translation="MKKLLLFIFVLFCVSTSLSYANACNSQICTCPNGSWVTFGQYCSA
FT                   VVNTTPTKQKARPVDWIIFAYSPSTGYYGLAHN"
FT   sig_peptide     complement(569673..569744)
FT                   /locus_tag="Sterm_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.832 at
FT                   residue 24"
FT   gene            569851..569937
FT                   /pseudo
FT                   /locus_tag="Sterm_0514"
FT   gene            complement(570065..570511)
FT                   /locus_tag="Sterm_0515"
FT   CDS_pept        complement(570065..570511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbp:Sbal223_2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07389"
FT                   /db_xref="InterPro:IPR027375"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07389.1"
FT                   /translation="MRKLFLITILFFFTTFNFIINARQVESFGYWVKGNTVYYTDLEII
FT                   DADPDSFENIPSSYLYGKDKNSVYFLSTKILGADLETFKVLELYYSLDKDSVFYKETKI
FT                   DGADPKTFNYIDDKNFFDKNFKYKILYSTQFGAYEYIIDKTPLN"
FT   sig_peptide     complement(570443..570511)
FT                   /locus_tag="Sterm_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.824 at
FT                   residue 23"
FT   gene            complement(570651..571181)
FT                   /locus_tag="Sterm_0516"
FT   CDS_pept        complement(570651..571181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07390"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07390.1"
FT                   /translation="MKKLFLFILILFEMINIKGLAAGCNAQVCMCPGGGYVTTGQYCPA
FT                   YNQPTYSPDYSLPKVWFSFSYDSTRKSYGIGKGKDKKTSESESLKNCGSSECKVIKSVK
FT                   EHDKTLLIALSSNNIMEFKSFNHYFYDKSTSYYEDLLKKCKDKGGIDCKVVFNSRILLH
FT                   NSKAYEEKFGRRN"
FT   gene            complement(571342..571842)
FT                   /locus_tag="Sterm_0517"
FT   CDS_pept        complement(571342..571842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO3320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07391"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07391.1"
FT                   /translation="MKKLLFTIMILFITLSLQSLSDPYGCGVTIPIEVCRNPSGTQNNT
FT                   GSNTNNNSYSPTYYGAIAINEKTGNWATAYNYTDKKSAKKSVEERCQGNCKVIQMSPSE
FT                   CGAFAYSKVDEISAYEATGFWWTGQATQQELLKKAEDRALTKCKNKNGKSCKIETSICS
FT                   YMK"
FT   sig_peptide     complement(571777..571842)
FT                   /locus_tag="Sterm_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.977 at
FT                   residue 22"
FT   gene            complement(571914..572423)
FT                   /locus_tag="Sterm_0518"
FT   CDS_pept        complement(571914..572423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07392"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07392.1"
FT                   /translation="MKKLLFFILILFGILSVQSLANGCSAQICTCPGGGYVTTGQYCPV
FT                   YNNNTPSQSVLTKWYAFSYDKNKNIYGVGTGYDKKTAQNEALKKCGTAECKIEKSQKVP
FT                   GGISLAAVSSNGVMVTYSSFGSSTWEQYEKRIDNLIKKCKAKGGSNCKLVFDSAYLYRK
FT                   DKNLGY"
FT   sig_peptide     complement(572358..572423)
FT                   /locus_tag="Sterm_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.810 at
FT                   residue 22"
FT   gene            572727..572918
FT                   /locus_tag="Sterm_0519"
FT   CDS_pept        572727..572918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_0945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07393"
FT                   /db_xref="GOA:D1AN17"
FT                   /db_xref="InterPro:IPR025356"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07393.1"
FT                   /translation="MVKFILKLESLCFFLLLIIGFIMKNNLIVSFGVIYGSHISFDRMI
FT                   GYGLKYNDSFKNTHLSNI"
FT   gene            complement(573476..573892)
FT                   /locus_tag="Sterm_0520"
FT   CDS_pept        complement(573476..573892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0520"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   sbp:Sbal223_1547 protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07394"
FT                   /db_xref="GOA:D1AN18"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN18"
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /protein_id="ACZ07394.1"
FT                   /translation="MIFSIFCALTAGTAKVLSRSVNSKLSGKTGLLKSTFFNFVSGLLF
FT                   SIILLIYFHKPQLAGSRHFELWMLLGGVISVSVVFLLSYSLKAVSSVNMTVLLFIGQMS
FT                   TGLILDFAVNNVFVLNTFIGIIVIGIGLIIQKFI"
FT   gene            complement(573907..574326)
FT                   /locus_tag="Sterm_0521"
FT   CDS_pept        complement(573907..574326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0521"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   plu:plu2183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07395"
FT                   /db_xref="GOA:D1AN19"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN19"
FT                   /inference="protein motif:PFAM:PF04657"
FT                   /protein_id="ACZ07395.1"
FT                   /translation="MYNITAVIIGMLIALMVFFNGMLSQAVGSYLATVIIHTVGVIICF
FT                   IFISIKKQKIFENHKLPVWMYLGGVIGVGTTLFNNMAFGHISISSILVLSFLGEITASL
FT                   IIDQFGFFSLEKRKINKKKILSLLIMLSGIFIIFY"
FT   sig_peptide     complement(574246..574326)
FT                   /locus_tag="Sterm_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.774 at
FT                   residue 27"
FT   gene            574415..575089
FT                   /locus_tag="Sterm_0522"
FT   CDS_pept        574415..575089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0522"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; KEGG: nis:NIS_1798 Crp/FNR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07396"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN20"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACZ07396.1"
FT                   /translation="MKSVKITSDHFLILEKMKLGEIDGKNLYIKTYKKGEYIFYQNEEI
FT                   KNILIIYSGKVGVTLDSSKGHRLLLAIYSPNSMLGDIEFFNKSCTVSNAQALSDTAVIC
FT                   ISYSDIEKLRNHNEFIYLLGQILAKKLTRNIKNNSINILNAADIKIAAYIAGICENNIF
FT                   DVNLSKLSELLGISYRHLLRRLKAFCENGYLLKIKDAYKITDLNSLKELAGDYYITDDW
FT                   QI"
FT   gene            complement(575377..575688)
FT                   /locus_tag="Sterm_0523"
FT   CDS_pept        complement(575377..575688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07397"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07397.1"
FT                   /translation="MKRNEKNPSYLYCTAIIRATEGTDYEIVKNELLELEEKTNQEAGC
FT                   IQFFISPLNPEEKKFALWEIWEDDVAFYEHHKKIYTQELFAKKITEIILFESSRKVDL"
FT   gene            complement(575851..576681)
FT                   /locus_tag="Sterm_0524"
FT   CDS_pept        complement(575851..576681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL4049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07398"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN22"
FT                   /inference="similar to AA sequence:KEGG:RL4049"
FT                   /protein_id="ACZ07398.1"
FT                   /translation="MDIDKKNRTELAGFLKLKRSKILPSQVNLPEGIRRRTPGLRREEV
FT                   AYLADIGLTWYTWLEQGRQIKVSIEILNKLSNALMLSQEEKRYLFALAHQSIPTDLLTV
FT                   QINIDKSIQNFIDSLKLSPAYILDQRWNILAWNKAACYLFGDFNQKIEGERNAVWLMFM
FT                   DDYYKNLFTDWEKHAEDLVARFRSVYSHYTMDNWILDFIKKMCKMSKKFDYWWSQHQIQ
FT                   SIDSVNKYFSHPEAGSLEFECIVLDVANNTNLKIFVHTSLTESTKQKMEILMNK"
FT   gene            576853..577287
FT                   /locus_tag="Sterm_0525"
FT   CDS_pept        576853..577287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0525"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: pat:Patl_4022
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07399"
FT                   /db_xref="GOA:D1AN23"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN23"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACZ07399.1"
FT                   /translation="MNEHKTEIELNLINDKVKFLGKSGENQDITIDYVPPFGDGEGYTA
FT                   LELFLISFASCLSTTLLALIKKELQKNVISMKVKGYGERRKEHPKNFSNICFKYHIVSN
FT                   DLTESELRKLVTLSETKYCPVWSMINENVKTNVEFIIEKG"
FT   gene            complement(577556..579073)
FT                   /locus_tag="Sterm_0526"
FT   CDS_pept        complement(577556..579073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGAP002877-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07400"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07400.1"
FT                   /translation="MNKNIILKKYLFRLLCCSFIISTMVNCQSLKSDTSEGKTADTRFF
FT                   ESDMFSLSKHPKAESPEALTRQNILAQTDGLKNRLTKNPDDNETRLSYARKLFQLGDFS
FT                   ESKKIISPMLKGNEIIPEAVYLSGQIEYITGNYKGAEDLFNKLRMRNFKDYYLKAETGL
FT                   LYTYYQTNQFNKAKNLTAALEEDGDKPLKEVMEAFKETKPYNINWNGKSEAVVPFIADE
FT                   YLPAVSMEVNGRKINAIIDTGGDIFYLDETVASSLNIKTISTVKGTYAGGISVETGYGK
FT                   LDSISLNGVTIKSVPVILAPIKQFSAIYNNEIEIDGIITTAVLKQFLATMDYPNSRLIL
FT                   RPRNQAGRTLLQQYTSKYKKTKDVPFTLATSHFMTAKGSINGKESLNFFMDSGLASEKT
FT                   GLILLEQTMSFTGIPMLKAQKKPDDLDNVGGLGGSDFEVSEFRINQFRLGDLPAEKNIW
FT                   AEHGALEAAFNFEESRGFIIDGLVSHNFLKKYSWTIDFDRMKMIFSQ"
FT   sig_peptide     complement(578978..579073)
FT                   /locus_tag="Sterm_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.467 at
FT                   residue 32"
FT   gene            complement(579150..580427)
FT                   /locus_tag="Sterm_0527"
FT   CDS_pept        complement(579150..580427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0527"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: sensory histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07401"
FT                   /db_xref="GOA:D1AN25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN25"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACZ07401.1"
FT                   /translation="MLIKLRNKFLFLMFGLTSTALITAFLAVYAISYFKTASEINDKLN
FT                   FHEELEVMAAGSVALGSEKTDAVIINRIFPDRGIYFNLLTNEEGKVLVIDSALKLPLED
FT                   YELAARRAWKEHKNKTVKISGRLWQYKITPASALLILDNESVSNGETYQIRFVDVTEAK
FT                   KSLIILRNTLLLMGSVLLAAFYIMSVYFSNRAIKPMKETWENQQRFIADASHELKTPLS
FT                   IISANLDVLYANKDETIASQLKWIDYASKGVKRMSGLVQSMLALSKAETENTLLNKSAV
FT                   NIGNILNNTVSLFQITADDKNITIERHIPAEVTAFTYPALIEQCIHILIDNAVRYTPRN
FT                   GTINILLDKTKSIVLLKIENSGRGISEYDLPKIFDRFFRSDTSRTDGGHGLGLSIAKTG
FT                   IEKLGGSIEVISIENKKTIFTVKIPV"
FT   sig_peptide     complement(580335..580427)
FT                   /locus_tag="Sterm_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.718 at
FT                   residue 31"
FT   gene            complement(580421..581113)
FT                   /locus_tag="Sterm_0528"
FT   CDS_pept        complement(580421..581113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0528"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gme:Gmet_3383 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07402"
FT                   /db_xref="GOA:D1AN26"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN26"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ07402.1"
FT                   /translation="MKILIVEDEIMIAEAVAQVLRKNNYSVDIAADGEDGLDCALSGIY
FT                   DAVILDIMLPKRDGLSVLKLLRESKIPVPVILLTAKSQTEDKVQGLDFGADDYLEKPFQ
FT                   MEELLARLRALTRRKGELIFDGIMKFGDISLNPHLLLLSCRDNKINLTLKESQALELLI
FT                   TNKNTAVSKETIIEKLWGYDSEAEDNHAEIHISLLRKKLKQAGSVLLIKAIRGIGYIIK
FT                   YPEEESAC"
FT   gene            581459..582688
FT                   /locus_tag="Sterm_0529"
FT   CDS_pept        581459..582688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07403"
FT                   /db_xref="GOA:D1AN27"
FT                   /db_xref="InterPro:IPR024291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07403.1"
FT                   /translation="MGIFDFFKRKTDIEEYYEKREKEKRRERYRNFNNYTEIPRKNTKL
FT                   YERNETDKISRSFKKKRLIAFLIITGIALFLLNTFRYESYYAEDYDFVLMEQGKTCKLN
FT                   DNIYMGKDRLTGRVYINADELWKIFKIEEFEYEAVRDKDFKWEYFDEEPVRITVSSNKK
FT                   KATLNYISKRKILYADQKIFSVWSCPDITDINNCRIQKRYGVSYNELKKEFYMTLDIKA
FT                   DKKKKIIYFIKNDNGSWKKANKEMEKMRKKKAAEEKKYNNYIRLYDRLEFYSEDFDYYF
FT                   SGAGREEKFTDKYKRIRFRLDQNYINKLENTVKEEPEIPEADIAAKNLVLVLNELLILF
FT                   DKTKSYYKNAEYLNDGYEGAQKLHTEILEGSERYKASVCDFRRILEKNGMQEVTESWYN
FT                   NVEEYKIDCY"
FT   gene            582744..583100
FT                   /locus_tag="Sterm_0530"
FT   CDS_pept        582744..583100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: low complexity orf"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07404"
FT                   /db_xref="GOA:D1AN28"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07404.1"
FT                   /translation="MKIPISLIIISVLIIITGVLRIFVGIFGMAYIENPGMYLTVAFYL
FT                   DNLLFGILAVVSGVLILLSKKQGMIIYTISVVLLFIFYLAVSGILRAINYTILPVILLI
FT                   ILIIIVRVTGYFKK"
FT   gene            complement(583186..584106)
FT                   /locus_tag="Sterm_0531"
FT   CDS_pept        complement(583186..584106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07405"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN29"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07405.1"
FT                   /translation="MSVMEKAREFIYRNARPLELAQWQYHFENGSKENVLAVLSFYQNK
FT                   DGGFGHALEADSWNPNSSPVQTWAATEILKKINFSDSNHKIIKGILDYLQSGRDFDGHF
FT                   WYNIVKSNNDFPHAQWWYAKDDNNITCTNYNPTVCLAGFIIRFADKNSRLFQLGCRIAK
FT                   EAAAQLLSDERKNDMHTISCYIRFLQYCTETKTNEIINLQALENKLTEQVNNLLTRDTT
FT                   EWKTSYICKPSQFFNSSNSIFYINNEDIAEYECEYIIKTQLEDGSWDIPWKWKDFPQEW
FT                   AVSKNWWKSGLIIANMLYLQGFGKL"
FT   gene            584369..584497
FT                   /locus_tag="Sterm_0532"
FT   CDS_pept        584369..584497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07406"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07406.1"
FT                   /translation="MKKLILVSALFALTTFSVMADAITYDTPEEIIGRIQMEMKHK"
FT   sig_peptide     584369..584431
FT                   /locus_tag="Sterm_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.953 at
FT                   residue 21"
FT   gene            complement(584707..585063)
FT                   /locus_tag="Sterm_0533"
FT   CDS_pept        complement(584707..585063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0533"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: wsu:WS0837
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07407"
FT                   /db_xref="GOA:D1AN31"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN31"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACZ07407.1"
FT                   /translation="MNNNDYYDIDIRIRIKIDNIVTYGSGISELLQKIDQLGSINKAAQ
FT                   NIGMNYKKALNIIKRAEAKLGKKLIEKSIGGTKGGGSELTQFGKFFVYQFNAVEEDVKK
FT                   YALELIKKSFKEFE"
FT   gene            585315..586301
FT                   /locus_tag="Sterm_0534"
FT   CDS_pept        585315..586301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0534"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cha:CHAB381_1233 methionine import ATP- binding
FT                   protein MetN"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07408"
FT                   /db_xref="GOA:D1AN32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN32"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ07408.1"
FT                   /translation="MTKIINVQNVTKSYNKQIILKQINMTVKPGEIYGLIGLSGSGKST
FT                   LLRCINGIEKFDSGEIHIENELISYDDSIKSRRIKKRIGMIFQNFALLERKTVFENIAL
FT                   PLKCWKEEKNKTENRVKELMEFVGISHIAGKRPSQISGGQKQRVAIARALSLSPKILLC
FT                   DEATSALDPNTTKSILELLKEINRKLNITVIIVTHEMEVIRSVCDKMSIIENGEIKISG
FT                   DTQEIFLMNPEPLQNVTGKKRIQLSEDKTVLKISFTSQEDTAVLSYMPQDLKTGFSILS
FT                   ADIDNYNEKTTGNVFISFKAENKALIMNYLLEKKIMFSEIFDKEGDE"
FT   gene            586301..586969
FT                   /locus_tag="Sterm_0535"
FT   CDS_pept        586301..586969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0535"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cff:CFF8240_0968
FT                   D-methionine transport system permease protein MetI"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07409"
FT                   /db_xref="GOA:D1AN33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN33"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ07409.1"
FT                   /translation="MNFSSTRLFEYIPKIIVPALFATLRMLLFSMLISVIFGTIIGIIL
FT                   TVTGSGDLKENKKIYNTVGFFVNTIRAFPVIILIVAITPLTKFIVGTSIGEQAAIVPLS
FT                   IAATPVIARLIQNSFDEVDRDLIIAAKSFGASTIQIIFKVLFVEALPSIISGLTTTTIL
FT                   FLGSITLAGAVGAGGLGAVALTYGYQRFDDAVMYTIVFILCILVFLIQGTGSLLYKKLK
FT                   "
FT   gene            586981..587802
FT                   /locus_tag="Sterm_0536"
FT   CDS_pept        586981..587802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0536"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: hhe:HH0714
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07410"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN34"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ACZ07410.1"
FT                   /translation="MKRNFYLSKVIVITILVLGLLGCGSKKEEPSSEEKKEVSIAVTEI
FT                   SEVSLKAAESEFQNKGFKEKLILVDSNVALLKSINDGSVDAGMAVHKAFMEKFNRENNG
FT                   DLVMVQPYTYYTGIGLYSEKYKSLDEIPQKARISIMNDAMNMDKGLRMLEDAGLITLDK
FT                   SKNDQYTLLDIKENPRNIEIIEMDQAQTVKSLEELDGAVVFFTHMRNAGKDYTTYLFRD
FT                   QDAKDYPIALVVKKGNENAPWAVALAESLRSEEAAKVIKEYFGGVFTTYED"
FT   sig_peptide     586981..587064
FT                   /locus_tag="Sterm_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.507 at
FT                   residue 28"
FT   gene            587792..588610
FT                   /locus_tag="Sterm_0537"
FT   CDS_pept        587792..588610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0537"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   dps:DP1175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07411"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN35"
FT                   /inference="protein motif:PFAM:PF02596"
FT                   /protein_id="ACZ07411.1"
FT                   /translation="MRTRIKAGESDEWLEILLELKRKAVGVRFLFDRNDYEKSSSAGRN
FT                   GTVPYCTAVRNASEGKSIKLHLGNFACLAAARGLGLMENDEISRSGKRHSDMGVYENVL
FT                   VSRNIAKDMVYCGHFVYGVEIRPLEDYKEHNPDIIIIITNPYNAMRIVQAHAYTKGQLK
FT                   NIKMAGMQAVCQECTSYVYERNEINLSMLCSGTRCVAQWSKEEMGVGIPFQQINDIIYG
FT                   LVQTVNPMENNHDKKLIQEKLKSAGKDLEFEIEYNKNYYTGVFVSSNSKK"
FT   gene            588705..589778
FT                   /locus_tag="Sterm_0538"
FT   CDS_pept        588705..589778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07412"
FT                   /db_xref="GOA:D1AN36"
FT                   /db_xref="InterPro:IPR026366"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN36"
FT                   /inference="similar to AA sequence:KEGG:CCV52592_0403"
FT                   /protein_id="ACZ07412.1"
FT                   /translation="MKQLTKKSMIYTITGIIFALIIFYLTFTGNPKNMGVCVGCFIRDT
FT                   SGAVNLHNAKAFQYIRPEIIGMIFGSFIVSLLIREKFSVHLYPVIYFFGGVFTMIGVLI
FT                   FLGCTVRVFVRLGGGDLNAVFGLLGMITGIGTGTFFIKKGFSLPEKEKTFNSKSYTYIM
FT                   PVISAILFLLLILKPGFVSFSEKGIGSQHSPIILALIGGLIIGILTNYFDLGFNSGFRN
FT                   LLSGKMENPQILFPVSIIVFLLILNFVSKNLNIGFADQPAAHSFQLWNFLGLFIVGWIG
FT                   SLLQGCPLQQLVKSAKGNLNSIFFITGMFLGAGFLHRIDGVSTPKAVPFNGKISLIAGL
FT                   IFMLVISVYYSRKKNNA"
FT   gene            complement(589853..590188)
FT                   /locus_tag="Sterm_0539"
FT   CDS_pept        complement(589853..590188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0539"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: gbm:Gbem_2844 transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07413"
FT                   /db_xref="GOA:D1AN37"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN37"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACZ07413.1"
FT                   /translation="MKNEKQGKEVLIDSELLRKLIVGIGEVSEITGVPTRKLRYWEEKG
FT                   IIKSEKGSDGETRKYNYLNIKKILSIKELVEEGYTLDAAAAKVEKNIETFFKTFSELMS
FT                   DDNNYKK"
FT   gene            590379..590507
FT                   /locus_tag="Sterm_0540"
FT   CDS_pept        590379..590507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07414"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07414.1"
FT                   /translation="MKKTLLILTLTLAASYTALAEAVTYDSSKEIIERIQFEMRHK"
FT   sig_peptide     590379..590441
FT                   /locus_tag="Sterm_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.789 at
FT                   residue 21"
FT   gene            590560..590688
FT                   /locus_tag="Sterm_0541"
FT   CDS_pept        590560..590688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07415"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07415.1"
FT                   /translation="MKKTLLILTLTLAASYTALAEAVTYDSSKEIIERTQFEMRHK"
FT   sig_peptide     590560..590622
FT                   /locus_tag="Sterm_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.789 at
FT                   residue 21"
FT   gene            590864..591151
FT                   /locus_tag="Sterm_0542"
FT   CDS_pept        590864..591151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07416"
FT                   /db_xref="InterPro:IPR018757"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN40"
FT                   /inference="protein motif:COG:COG4367"
FT                   /protein_id="ACZ07416.1"
FT                   /translation="MSLNIEQKKQTSIELHENYKISGLTPEDIQSDLGLDPNQLENILN
FT                   IKSISDPTAVWRLRDYMEEKITEQGKTPYPYSVLIENIYFPYKKEKKWEE"
FT   gene            591148..591939
FT                   /locus_tag="Sterm_0543"
FT   CDS_pept        591148..591939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0543"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07417"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN41"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACZ07417.1"
FT                   /translation="MKIKTAGVMILLVTVACGKIEEGKNFISYSSNETVIQGNDKMSGE
FT                   VTLLSGKASIQGEVRSFQNKGRFSSTVHVLSSEKGNILIDPGHYSEELSRYAESIGGLD
FT                   AILITHGHWDNIYSLDEAAAANPNAKIYIHELDYNFLRDPVLNCSDINGFSLMLDTKPL
FT                   TFTEGTYTIGGYTFEIIHTPGHTCGSSIFYFEEENVLFGGDTIMSELVGSAKHPTGNEK
FT                   ERENTIKKFKQLKFSDDMKVFGGHRKNTVYKELMKINKDLQ"
FT   sig_peptide     591148..591204
FT                   /locus_tag="Sterm_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.681) with cleavage site probability 0.557 at
FT                   residue 19"
FT   gene            complement(592120..592866)
FT                   /locus_tag="Sterm_0544"
FT   CDS_pept        complement(592120..592866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0544"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   sse:Ssed_2504 uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07418"
FT                   /db_xref="GOA:D1AN42"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D1AN42"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ACZ07418.1"
FT                   /translation="MLKRDGVFYHIHCKEGDVGRYVLLPGDPFRTDKIAEYLDNPVLIA
FT                   HNREHKTWTGFLNGEKVSVTSTGMGCPSAAIALEELIACGADTFIRVGTSGRVSEKSQN
FT                   PDLTGVIITAAVRDEGTTRQYIPIEYPAVADRHIVGALADAAKKLNLNFDEGITHSKDS
FT                   FYSQVFTDTVPSKNRIHDRIEAWKAGNVMCSEMESAALFVISSIRNVRAGGIMAFSDIE
FT                   DQASAVDKAIRTACEGIKLLIERDKS"
FT   gene            complement(592966..594219)
FT                   /locus_tag="Sterm_0545"
FT   CDS_pept        complement(592966..594219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0545"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: rpi:Rpic_3981
FT                   chloride channel core"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07419"
FT                   /db_xref="GOA:D1ANU5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANU5"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ACZ07419.1"
FT                   /translation="MKKELDLVIYLIKWFTFSLIIGILSGSASAVFLLMLEWATKTREY
FT                   NPFLIYFLPAGGFIVSLIYYFYGKEVSKGNNLILDEINSPKKVIKLRMAPMILFGTVIT
FT                   HLFGGSAGREGSGIQIGSSIADQLSLIFKFNKSDRRIILISGMAAGFGSVFGTPLAGAV
FT                   FGLEAAVLGRLKYEALIPAFLSAVIADVVSKNWWGIVHPIYKINFFPEINIKNIIFACL
FT                   AGVIFGLTGKIFSLGLNFIKSLFSKYIKFSPYSAVIGGIIIVFLTKLLGTYDYNGLGLE
FT                   IISKSFTSQIFAEVFIFKILFTLITLGSGYKGGEVTCLFFIGSALGNTLSRIIRLPMDL
FT                   MAGMGLVSVFSAAANTPLACIVMAMELFGDKIGIYAAVSCVVAYLFSGHTGIYDSQKVG
FT                   WYKHFKLVSDRGKKLEDL"
FT   sig_peptide     complement(594127..594219)
FT                   /locus_tag="Sterm_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.898 at
FT                   residue 31"
FT   gene            594538..594702
FT                   /pseudo
FT                   /locus_tag="Sterm_0546"
FT   gene            594769..595326
FT                   /locus_tag="Sterm_0547"
FT   CDS_pept        594769..595326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0547"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ppd:Ppro_2354
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07420"
FT                   /db_xref="GOA:D1ANU6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANU6"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ07420.1"
FT                   /translation="MDTIECINSKRSIRAYEETQIPYETVMELLTLGTKASTGSNHQPW
FT                   GFVVIQDAREIEDLSKNIKAYLLENLEKYPYLSQYETWLQSEKYSIFNNASTLIVVYGN
FT                   TDSHWYIYDCTLAAGNIMLAAYSKGIGTCWIGFAEYYFNTPEFKKKYKIPENYELVAPL
FT                   SCGYIKGTVKPPERKPPVVFNR"
FT   gene            595588..596967
FT                   /locus_tag="Sterm_0548"
FT   CDS_pept        595588..596967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0548"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: vsp:VS_II1369
FT                   Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07421"
FT                   /db_xref="GOA:D1ANU7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANU7"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACZ07421.1"
FT                   /translation="MTVTKIKNGSMSKEFIKFVIPAIISMVVTSMYSIIDGIFVGRGVG
FT                   ENALAAVNIAYPLIMLHIALAMLVAIGGANAFSINKGRGDIKNANRIFLQSMILIVGIS
FT                   VILNVLILVFPTQVSRLLGADDMLLPYVRDYIKWVALFAVIYMPGLALSIFIRNDDAPK
FT                   REMTGTLIGAVTNIVLDYLFIMVFDMGVSGAAIATGIGQLVSTFIFMTHFTKKNRLLKI
FT                   EKVKFYIDDIKYIFINGSPSFLMEFSQAAVAFSFNIVLLSRIGALGVSAYSIVMYICSI
FT                   FNMILIGLVQGIQPIMSFNYGKGNRENIQKVYKMAVRTSLCLTVIVYIAVFIFGKALSD
FT                   IFIRNNTQVTNMALNMMRYYFLAFFPIGISLINILYFQIIRHEKWAVFLSFIRCIGFVQ
FT                   LSLLIMPELFGITGIFLSFLCGELANCFISVILYKYAEKSQSNTVKISDKKVLFRNIET
FT                   D"
FT   gene            597197..598198
FT                   /locus_tag="Sterm_0549"
FT   CDS_pept        597197..598198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0549"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: yen:YE2511
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07422"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANU8"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ07422.1"
FT                   /translation="MNDAGNNYLKERNLKILKRILFEKKTATKTELSNISTLSTVTVNS
FT                   LVKVLVETGEFIEGELIQQKMGRPAVIYSFNYNFQKYLLLSIQEEKNKLYINTVITNMA
FT                   GEITDRKLYSFENIEMQAIIEIIDEAVKGNNSIAAIGISIPGQTKDEKIFVSWNEKLNG
FT                   WNLKKEISSKYDIPVKVENDANLVTVGYCIKNNIYSRESVVGIYFPKDSLPGASIFWDG
FT                   KIFTGKDGLAGEIKYLPDFINYRKITSVDSVIEKLINTIVLFNSITAPGLFIIYAENIN
FT                   EDEFQKRVYDNEIIKRQPNVPVIKVADTFGEDIITGLQWLVASDIDVQESVD"
FT   gene            598257..599099
FT                   /locus_tag="Sterm_0550"
FT   CDS_pept        598257..599099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0550"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: vcm:VCM66_1319 putative
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07423"
FT                   /db_xref="GOA:D1ANU9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANU9"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ07423.1"
FT                   /translation="MGIKAIVMDVDGTLTNDKKEITPKTREVLLKAQEQGILLILASGR
FT                   PTTGLVEMGKVLEMDKNNGLFISYNGSKVINFQTGEELFNEPLKLEDAKAVLEHMKKFE
FT                   IKPMIDKGDYMYVNDVYNCMIRFRGEPFNVIKYESRGGNYKLCEIDDLAAFVDYPLNKI
FT                   LTAGEPEYLQEHYIEMMEPFKDKLNCMFTGPFYFEFTAKDIDKAKALDTVLKPLDITAD
FT                   EVIAFGDGHNDISIIKYAGTGVAMENAVADLKEAADEITLSNEQDGIAESLLKHISNL"
FT   gene            complement(599250..599519)
FT                   /locus_tag="Sterm_0551"
FT   CDS_pept        complement(599250..599519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07424"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07424.1"
FT                   /translation="MKKFLVFLFFIINLTGFARFIEACTVTSVSPEIPFMLCRSKQSGK
FT                   EFGFYITAKEARALKKGSTYKIWFEEIIGYDTSGMYLRKYKYLY"
FT   sig_peptide     complement(599448..599519)
FT                   /locus_tag="Sterm_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.890 at
FT                   residue 24"
FT   gene            complement(599555..599923)
FT                   /locus_tag="Sterm_0552"
FT   CDS_pept        complement(599555..599923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07425"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07425.1"
FT                   /translation="MKKYFLLFLTALFFIGCGTNSDYIETTKSIILPNKLLNSNSVEDL
FT                   TKEILTAVSGEDVNKEKIKWEVQGNTKNGKVITAAFKNHVVHIPVENDGDYIEVTPVNI
FT                   YVITDGKEKISLSDILEY"
FT   sig_peptide     complement(599861..599923)
FT                   /locus_tag="Sterm_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.452 at
FT                   residue 21"
FT   gene            complement(599949..600221)
FT                   /locus_tag="Sterm_0553"
FT   CDS_pept        complement(599949..600221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07426"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07426.1"
FT                   /translation="MLKKFLVLFLLLSSFSFSRFVNECRVLSRNLNNYNFRCRSLESGK
FT                   IFTFHMPSGVNGYAWTEYHKIGRVYKIFFHEEYGSYILENSTFLY"
FT   sig_peptide     complement(600156..600221)
FT                   /locus_tag="Sterm_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.635 at
FT                   residue 22"
FT   gene            complement(600274..601155)
FT                   /locus_tag="Sterm_0554"
FT   CDS_pept        complement(600274..601155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0554"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   vpa:VP1847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07427"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV3"
FT                   /inference="protein motif:PFAM:PF07007"
FT                   /protein_id="ACZ07427.1"
FT                   /translation="MSKSKKIFLFLLFFSLISCKNNIFNKILDKKTKQTDSIEKNKADS
FT                   VNQKIEKIVRKWNSATSNKDITALESILADKIEYYQQTVTKAEYISDKKKFFEKNNIYG
FT                   QEIKGDIEYKILSERQVKVDFLKEVTTKNGTNDYPSYLIFENINGDWKLVLESDLISDE
FT                   NIKKKKSVSKNTNYEKNLIAKMKPVDQELDDMLSYSQSTADMTAAINYASGAWDTELNI
FT                   IYKLLMEKLSKEEQISLRDKQRNWIKMRDSKINEAAAEFEGGSMGRVTGRSVFLEETKK
FT                   RTLELSRIYDSL"
FT   sig_peptide     complement(601093..601155)
FT                   /locus_tag="Sterm_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.505 at
FT                   residue 21"
FT   gene            601989..603014
FT                   /locus_tag="Sterm_0555"
FT   CDS_pept        601989..603014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0555"
FT                   /product="sulfite reductase, subunit A"
FT                   /note="TIGRFAM: sulfite reductase, subunit A; KEGG:
FT                   aha:AHA_2575 anaerobic sulfite reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07428"
FT                   /db_xref="GOA:D1ANV4"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014259"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV4"
FT                   /inference="protein motif:TFAM:TIGR02910"
FT                   /protein_id="ACZ07428.1"
FT                   /translation="MKISLTKEDFNIALEKLKKDYRIFAPKLLPFKGTFSDTPVIRYEE
FT                   INSFEEICFDQKSDFSPKEVLLPITQRMFYFTENDYKEPDVDNKKILLFLRSCDLHSVK
FT                   RVDEIYLRNKFSDKYYETLRNKVKFAVMGCAESFENCFCVDMGTNKTDEYDMGVKTDGE
FT                   KIFLDIRTEEFLTEFSGNEEEFGMDFVKKNKVHVSIPENINLEDVIDLDLWREYDSRCI
FT                   ACGKCNFVCPTCTCTTTQDIFYKENSSNGERRRVWASCHVDGFSDMAGGHSFRQKHGDR
FT                   MRFKVMHKISDFRKRFGYQMCTGCGRCDDGCPEYISFSNCINKLNKVLKEKSAGLEGKD
FT                   E"
FT   gene            603007..603807
FT                   /locus_tag="Sterm_0556"
FT   CDS_pept        603007..603807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0556"
FT                   /product="sulfite reductase, subunit B"
FT                   /note="TIGRFAM: sulfite reductase, subunit B; PFAM:
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; KEGG:
FT                   aha:AHA_2576 anaerobic sulfite reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07429"
FT                   /db_xref="GOA:D1ANV5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR014260"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV5"
FT                   /inference="protein motif:TFAM:TIGR02911"
FT                   /protein_id="ACZ07429.1"
FT                   /translation="MNNIYLPEASEILSVEKVTPIEWLFRVKFDKKVKSGQFIQISIPK
FT                   VGEAPISIANFNEREGWIDFLIRKVGKVTDEIFNKQAGEKLFLRGPYGNGFSIENFENK
FT                   HLVIVAGGSGVAPVRPIIEHFYENREKLKSFRMIAGFKDLESVIFKDDFTRWRKKIDVL
FT                   VTLDKACSLEGICDGLVTKYIPETILPADLIDVEYIIVGPPVMMKFSCQEVLRRGLSKE
FT                   QIWVSFERKMSCAVGKCGHCKIDETYICLEGPVFRYDFAEKLLD"
FT   gene            603817..604785
FT                   /locus_tag="Sterm_0557"
FT   CDS_pept        603817..604785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0557"
FT                   /product="sulfite reductase, subunit C"
FT                   /note="TIGRFAM: sulfite reductase, subunit C; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; nitrite/sulfite
FT                   reductase hemoprotein beta-component ferrodoxin domain
FT                   protein; KEGG: ecy:ECSE_P3-0003 anaerobic sulfite reductase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07430"
FT                   /db_xref="GOA:D1ANV6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR014261"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV6"
FT                   /inference="protein motif:TFAM:TIGR02912"
FT                   /protein_id="ACZ07430.1"
FT                   /translation="MDINRKKVTKNAFRVTKIRDKTALRVRVPGGEISGDLMSVVVNIA
FT                   NTYGNGQIHMTTRQGFEILGINWEDMDKVNKMLQPLLDGLEINYDKKGDGYPAAGTRNI
FT                   AACVGNKVCPKGQYNTTEFARKIEKAVFPNDFHFKVALTGCPNDCQKVRMHDFGIIGMT
FT                   KPVLDDTKCVSCGMCVRKCQKLSTGAIKAENYRPVRDHDRCIGCGECVLNCPTGAWTRD
FT                   EKKYFRLAVMGRTGKKNPRLAEDFVLWCNEESIIKIILNTYEYVDKYIDRSLPKEHIGY
FT                   IVDRTGFMEFKKWVLKDVVFPDIAVVKQMINWSGIKYPGIE"
FT   gene            605261..605467
FT                   /locus_tag="Sterm_0558"
FT   CDS_pept        605261..605467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07431"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07431.1"
FT                   /translation="MKKIIILMSIIGCFSLAAKKNEKTPEIPDMNAQMEKADKIESYRA
FT                   KKDVAWHKTEYNKVLKYLNKSRK"
FT   sig_peptide     605261..605323
FT                   /locus_tag="Sterm_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.654 at
FT                   residue 21"
FT   gene            605476..605754
FT                   /locus_tag="Sterm_0559"
FT   CDS_pept        605476..605754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07432"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07432.1"
FT                   /translation="MKRIILIFSLLTLSLMAFGEEVKVDRSVEESITKDYDQDGVYSSY
FT                   EKALRRAQESVYVKLPEKRGYWYTILDRVKAEEEELMPEEINRMRRR"
FT   sig_peptide     605476..605535
FT                   /locus_tag="Sterm_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            605771..606037
FT                   /locus_tag="Sterm_0560"
FT   CDS_pept        605771..606037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07433"
FT                   /db_xref="UniProtKB/TrEMBL:D1ALT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07433.1"
FT                   /translation="MKKTIILIFLTVMGTMLYSAPTYEYKRELREGARGKWTNLRKHLN
FT                   SGQRLEKELIKVDKQIDKKVNEIQEIEDLLFRIEQYKAANNIR"
FT   sig_peptide     605771..605830
FT                   /locus_tag="Sterm_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.968 at
FT                   residue 20"
FT   gene            606050..612892
FT                   /locus_tag="Sterm_0561"
FT   CDS_pept        606050..612892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0561"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: bch:Bcen2424_6767 outer membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07434"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW0"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ07434.1"
FT                   /translation="MKRNKKLLVSFLALNAILTSYAQAETVQSARYERMYNSIVKNMEK
FT                   GSPNEQTYQTIQRILNQKNKELKDLYLQGDYIVKPEYLEWQVFFTGFYEEYNEGVDNSK
FT                   ENAKYHSKVTGYYDASGNYVTTSGSISGLSGKPYQPLQQPKDINLGVSIPLKGLTREPI
FT                   NLNLTGVSGPSFNPIYSIPNDPTKTITANVDVDTFSINIPVITIPPVPTIPSFSVTVPS
FT                   TGNGDDSFNSLGNASTSDPGGITSFVGNYNFSDGELSGVWNTNGNISSYSYDNLTGTSN
FT                   WRSGSDSMSSATSSGTINVIGNVPALYEITGADNVTFGNNFKIKITSNVATGYTGTLPH
FT                   LIQYDPHGTRSTYKPFPTDYYGNAPTTSTIWDSYGELVNKGTIEGEGNSLLMISLQMHG
FT                   GNFSPTVKNENIIRGLYVGGGYGGNGGERHVAFSFTTARNGTATDDRRLEFYNRSTGKI
FT                   EMQARESIALNYANQSKGHLSVYNEGDIVLYGNSSVGIKTAQATANTLTTSKIVLKTPI
FT                   RINGDSSVGVELAQVMDDGYDTSANPSYIANTYDKQPAEIRVTIGDEANQYAGNISGIN
FT                   PSTSLPYDSNFVEGAVGLFVNHASLDYRLKEYELKFGDYAKNSVLAYINNGKLTLDNIK
FT                   YPTINIENGADNVGLVVTGTSSELNLYPDIKVGTASSAVDGTVALIAKAGSKVNLLGAN
FT                   TIETNGEKSHGLVILDTGTTLSTGTVTGGSYNFKTAGESSATLYVKDGTLNLGSASNIN
FT                   ISAVGNKSIGVYNNGGTVTLGAAASTGTYEVGTNGVLLYNSGGGTLSTAGSSFSVGSGS
FT                   IFSIASGAGTTTNFTSPSTLNLLSGSTGFIVDGALGIPTYFSTYYTGLNTNMDVVLTSG
FT                   ATLIALQNANSTLSSLSFGSIGSNFKSVTLNGGNMASLLEGTLTIDQNVNLDNAADAYN
FT                   TIEKSLIGLTVNAPVTITGTQANQVGLADNFSSVTAVTYNNMINNGTVSLSGNGSVGIY
FT                   TNNGNATNNNVISAVGANSFGIYGENGTTTLNSGTGNITVGDQGIGIYGVSYQNPAAPG
FT                   LHGGGTINISNAGTITGNGGSGTIGIYSHVNKAGGLKTDASVTLTGGTINLGSVTGAIG
FT                   VYVNKGQVTDAGSIITVGNNGIGIYAKDADLNLNGTTINLHGNNALGMYLEGDTNLFTG
FT                   NGTIDINGQNVVLFYMDTAAGNTINNNFVVTSTAGSTYTLGNIKGGAFEYTGNSVLASN
FT                   GTLVSGQNSAVYLNVSTITAPGTTNVAAVSLNGQYSGGLPAGMTLGMDGENNGSIALED
FT                   SSVGIYGKNGSRISNRGTITTGNSSAGLVTSGLNSEVKNSGLITMGAASHGVYLQDGLI
FT                   VQNQASGNILSAGAGSIGMFADNNAATVMQVINDGNIDLTGDDSLGIYATGTNSQLIDN
FT                   NLGASIKVGNSTNASDPGIGIYSGAAGSTVKNDGTITSGVNSIGIYNNQGTTTINGTAV
FT                   HNIDNSGVGIYATGGIVNLNSGSAFNMGTNGAVAVYGINSGVTNSTNLNIGNSNYGYIL
FT                   KGGSLTNAAGTSASMGSDSVYMYSTEGTTVTNDGTLIMSGADNVGFYMAQDPTSGAGGA
FT                   IMINNAGGNISGTVGNNNVGIYNYGGTVDNYGNVAVGDSDIEFITGTTDVDVKASKYSV
FT                   GIYGENATIINRAGANISAGYGGYGIVAKGGAASNFGTVTTTGDYSTGMYTENGVITNE
FT                   SGGIINVSGNNTIGMAGKGAGSHIINNGVINITGNDAIGMYGNLGTVITNTGTINITGL
FT                   NSQIFVSSDPSDAAHTVGAGTATINGGTAANVISSIGNVHALPALINAGIIKSSGVLAL
FT                   DGVQVMIKPDPTTKQPSSDPNYDFELSGTSIIADEILTSKPIVILPGFADGTNANVYKL
FT                   EGLIKASSGQYDFISGSLLWEATPKATGTGSDVYMSRKAFTDFTDGLWFEDFGTALENN
FT                   YLTATGDGVTIYNKTGYITNETDFRHIMGSLAGNVYANINQREDDIAKTFENSLHLLQD
FT                   STNNTKENVKISVIAGKGKNKEETDGVTGYDYTTTGVLALREVERTYKHTFGYSLGYVH
FT                   TGFEFKDGNESEEWVDTIQLGVHNKYRSNGWKVVNDLTGRASIHNVDRNIDWPSPLERS
FT                   EMNGTYETYSITSDNILGKEFGLGKKASIMPYGAFRAMYVTRPTFNESGLEALEVEGND
FT                   AWSAKPRAGVELKGAIPLGAKTAWQLKGTLDLAYEYELADLNEREKARLIAIEDGYHKL
FT                   SKPEDEKGTFRTKAAIGVEVEDRYGIFLTGEYSTGNDKENDYRAGVTLKAVF"
FT   sig_peptide     606050..606124
FT                   /locus_tag="Sterm_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 25"
FT   gene            612982..613575
FT                   /locus_tag="Sterm_0562"
FT   CDS_pept        612982..613575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0562"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   vha:VIBHAR_00128 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07435"
FT                   /db_xref="GOA:D1ANW1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ07435.1"
FT                   /translation="MDKKDVIKITLELIKEKKLEKTSIGEIVKKLDSSPGNLYYHFKSK
FT                   NEIYKETADYSYTEIIKSLNNVKSENNRQSYLFRLTKTLIKFFEEREDILYFLMSIRGS
FT                   YFFDKESGQQNFLAKFQKILSEEKPNTEQEKQISLKLNMFLGSVYEVLYVNKLVNKRNL
FT                   NEEEIKEMCMSFWGNIEMENYKTCEQNSLKVGLS"
FT   gene            complement(613794..614090)
FT                   /locus_tag="Sterm_0563"
FT   CDS_pept        complement(613794..614090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07436"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW2"
FT                   /inference="similar to AA sequence:KEGG:Pcar_2642"
FT                   /protein_id="ACZ07436.1"
FT                   /translation="MQTQVKAFLEITMNIKEENRAAAAKVYTAFKQPFLSEINGALSKD
FT                   LLIRTEDIQVLHGFSSVEAAGEYLKSEMFQNDVFVGLKDLWTTDPDVRIYEAV"
FT   gene            complement(614261..614635)
FT                   /locus_tag="Sterm_0564"
FT   CDS_pept        complement(614261..614635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0564"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   dvm:DvMF_2974 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07437"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW3"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACZ07437.1"
FT                   /translation="MYEHKLEKEIWCPIEYGLDVFGGKWKSRIICVIAANGIIRYNALR
FT                   RELTNVTDAVLAAMLKEMISDGLINRKQYNEMPPKVEYSLTEKGDSVLPILQYICQWSK
FT                   NYTEVDKEKILSSCKTCSQF"
FT   gene            615079..616347
FT                   /locus_tag="Sterm_0565"
FT   CDS_pept        615079..616347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0565"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: ppd:Ppro_0486 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07438"
FT                   /db_xref="GOA:D1ANW4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW4"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACZ07438.1"
FT                   /translation="MKKIVFLMLILVSFLSFSNTADLVQTNLNWTWTLIGGILVFFMQA
FT                   GFAMVETGFTRAKNSGNIIMKNTMDFCIGILTYWAIGFAFMFGTGGGFLGWGNFFGGGL
FT                   DGWNWTFFIFQGMFSATAATIVSGAIAERAKFTTYLIITFFISAFIYPVYGHWAWAGLY
FT                   GQSTGWLENLGFIDFAGSAVVHSIGGWVSLAGAMILGPRIGRYTNKTVNAIPGHSLTLG
FT                   ALGVFILWFAWYGFNCGSTTTGTYEIGLIAVNTALAPAAAALSALAFSYKLYKTFDIGL
FT                   VLNGILAGLVGVTAGCASIEPWAAVVIGLTSGIIVIASIRLLDRFEIDDPVGAISVHGV
FT                   CGAWGTICAGIFYAESLFDPKIIGIQVLGAAAAFQFAFLMGCFIFTVLKHTLGIRVSIQ
FT                   EEIRGLDLSEHEARSYPEFQERI"
FT   sig_peptide     615079..615144
FT                   /locus_tag="Sterm_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.379 at
FT                   residue 22"
FT   gene            616359..616694
FT                   /locus_tag="Sterm_0566"
FT   CDS_pept        616359..616694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0566"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   wsu:WS0409 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07439"
FT                   /db_xref="GOA:D1ANW5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW5"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACZ07439.1"
FT                   /translation="MKMIIAIVKPEKFSEVKNALTDSGIEGMTVTEVKGFGKQGGHKEI
FT                   FRGTEYKIDLLNKVKIEICVEDSEAENVINTVLNSAKTGKAGEIGDGKIFVIDVEKSVT
FT                   IRTGETN"
FT   gene            complement(616849..618018)
FT                   /locus_tag="Sterm_0567"
FT   CDS_pept        complement(616849..618018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0567"
FT                   /product="initiator RepB protein"
FT                   /note="PFAM: initiator RepB protein; KEGG: conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07440"
FT                   /db_xref="GOA:D1ANW6"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW6"
FT                   /inference="protein motif:PFAM:PF01051"
FT                   /protein_id="ACZ07440.1"
FT                   /translation="MIDIFNFTPTKKSKNFIVNIKLNKNFSKSEKEFFELLIFNFDLAS
FT                   PYISLDSKDLIKVLNLDTDSKLQDFLHKITDKKVLYSITEEDAVIYSGAFSPVSSYFQK
FT                   KEKIYIFTAEELKLFLTEENIFSHFNFKKFIFMEKNLSLILYNHLNNILPANTLSVTVT
FT                   ELKELFGLEDSYNRIYDFEKYILKKIVKNINKYTDLEVKYEKPAHSGSVINFTFKSTYR
FT                   ENIFEKTKEIIDTVKSKIINYENVYNLILNYLEKRGLSYVNNNVSYINSLKNIQNFDAH
FT                   LRKALLYDLYSSNLKNIKPESKFISFFEKYHVYKNSVTLQNDLYKYINSILYITSSLEE
FT                   LYSFEVINEIKNLEDGSFFTYKNEDFEIFVEFLQNKSSSIQIFIREDLI"
FT   gene            618451..620190
FT                   /locus_tag="Sterm_0568"
FT   CDS_pept        618451..620190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0568"
FT                   /product="PTS system, glucose-specific IIBC subunit"
FT                   /note="TIGRFAM: PTS system, glucose-specific IIBC subunit;
FT                   PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system EIIC; phosphotransferase system
FT                   PTS EIIB protein; KEGG: esa:ESA_02758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07441"
FT                   /db_xref="GOA:D1ANW7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW7"
FT                   /inference="protein motif:TFAM:TIGR02002"
FT                   /protein_id="ACZ07441.1"
FT                   /translation="MEKKKNALFGKMFAILQKIGRSLMIPVAILPAAGLLLGIGAGLQQ
FT                   SELIARLPFLGNHFIQYGALLMTQAGDIVFGNLPLLFAIGVAIGFANNGDGVGALAAVL
FT                   GFLIMNVIAGIVSNAGAVLSGVDTIRTALQLNTIPNMDFSSMDSIYKAGEYILQNSSQF
FT                   SDTLVGAATSIKGLTVGQLYGYTRVMGIPTLQTGVFGGIIAGLLGAAIFNKYYKIELPQ
FT                   FLGFFAGKRFVPIMTSVFAILLGLVLPFVWQPIQYLLTLCSDLANNGNTNVSTFIFGII
FT                   ERALIPFGLHHVFYSPFWYQFGEYTSNAGQIVNGDQRIWFAMYADGVKNFSSASYSGAG
FT                   KFMTGKFVFMMFGLPAAALAMYHEAKDNKKKLVAGVLFSAALTSFLTGITEPIEFLFLF
FT                   IAPVLYGLHVLLAGLSFMIMNMLQVRIGMTFSGGFIDYTLFGIFPGITGGFQTRWYLVP
FT                   VVGVFYAVIYYFLFRFFIRKFNLKTPGREDDTEVSPVGTISKSKSEQAKAVLEALGGKE
FT                   NIKSLDACITRLRVTVADTKKVNDDELKKLGAKGVLKVGEEGVQAIFGTHSEILKDEIK
FT                   TLL"
FT   sig_peptide     618451..618591
FT                   /locus_tag="Sterm_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.188 at
FT                   residue 47"
FT   gene            complement(620250..621065)
FT                   /locus_tag="Sterm_0569"
FT   CDS_pept        complement(620250..621065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0569"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: vpa:VP1640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07442"
FT                   /db_xref="GOA:D1ANW8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW8"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACZ07442.1"
FT                   /translation="MIKIVAADMDGTSLGTDENISEANIKTIKKVIDTGAEFIFASGRP
FT                   VYGINLKIGDAGLTDKIRYFIAYNGGIVYDTENKKNIYTKIMDFEIIKKIYNLILQNIS
FT                   DLCFCLHEDEFIYVTQDNEITTLEAESNHQTKVLINDIEDLSGKKFMKILLVGEHKKLE
FT                   YAAEILKQSEIGDTIKTMFSLDMLLEVLPAASDKSVALKWLSEYLNVPLTSVLAVGDAE
FT                   NDIEMLKTAGYSVAMQNAYKHVKKYADYITEKNNDENGLTEALEKFLDL"
FT   gene            621251..622288
FT                   /locus_tag="Sterm_0570"
FT   CDS_pept        621251..622288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0570"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: yen:YE2511
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07443"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANW9"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ07443.1"
FT                   /translation="MDKTTKITGKPKFMKELNISEIKRAILKNPMITRSNIASLTNISL
FT                   TTVGNILTELIRNEDIFTGGYEESSGGRKAERYYFNKEKYHSLSFCIDNKSIKYIISNI
FT                   LNEETEHGELEVNDRAVREVITEFTEYTLKQKDIKAIALGVPGIVKDSSYLIKGPDGEW
FT                   IKNDIGEFLRNKFGIPVILENDLNSTVLGFSINFAGKNKDKELKNLSSVYIDFSDDCTG
FT                   AGIITNGEIVRGKYNFAGEFGFIPMDGGKTLDDIINDECGNEEYVETLVKLILIINYTI
FT                   NPGIIIMRGERFREELHNLVVEECKKHMPEGSFPEIIFKEHSFDDYFRGISSLGAELMH
FT                   KNIGL"
FT   gene            622310..623206
FT                   /locus_tag="Sterm_0571"
FT   CDS_pept        622310..623206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0571"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: tau:Tola_1783 PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07444"
FT                   /db_xref="GOA:D1ANX0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX0"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ACZ07444.1"
FT                   /translation="MIKNIIDLHMHSGYSDDGEFKPSVLVQMCKDAGLKYIAVADHNSV
FT                   KGVEEAVNKGEELGVKVITAIEIDCTYEGVNLHVLGYYIDYNLKEFGELEENILEQEKK
FT                   ASPERLRLVEETGIYVNRDKLSKIAKNGIIIGEDIAEASVYEPENKENPLIKPYLEGGS
FT                   RSDNPYVNFYWDICAQGKPAYVPVHFISLKEAVDLINKAGGIPILAHPGNNIHEDKKLL
FT                   DGILDSGVKGMEVYSSYHSSEQIEFYRNEAESRNCLMTCGSDFHGKIKPAIELGGCRCD
FT                   GNTEKKIIENFILNIKK"
FT   gene            complement(623599..624594)
FT                   /locus_tag="Sterm_0572"
FT   CDS_pept        complement(623599..624594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0572"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: esa:ESA_00850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07445"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX1"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ07445.1"
FT                   /translation="MLYLADEKRYASMKYNRCGRSGLKLPAISLGLWHNFGTMDKYENM
FT                   REMIRTAFDLGITHFDLANNYGPIPGSAEENFGKMLADDLKPYRDELIISSKAGYTMWP
FT                   GPYGDWGSKKYLISSLDQSLKRMGLDYVDIFYSHRFDPDTPLEETMEALAQIVRQGKAL
FT                   YVGISNYTAEQTREADRILKELGIKCLIHQPRYSMFERWIEDGLQDVLTEKGIGSIAFC
FT                   PLAQGLLTNKYINGVPEDSRAGKAWEISLNSDSITADKIEKVKKLDKIAKQRNQSLAQM
FT                   SLAWTLRGGKVTSALIGASKSSQIIENVHALDNLEFTVEELEAIEKILKG"
FT   gene            complement(624774..626105)
FT                   /locus_tag="Sterm_0573"
FT   CDS_pept        complement(624774..626105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0573"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: dps:DP1286 sodium/alanine
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07446"
FT                   /db_xref="GOA:D1ANX2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX2"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ACZ07446.1"
FT                   /translation="MENFIQLLNKINDFVWGLPLIILLLGTGIYYTFLLKGLQFRKLGH
FT                   SLYLAFIKRKEEGNSGEGDISHFQALMTALAGTVGTGNIAGVAGAISVGGPGALFWMWM
FT                   TGFFGMATKYSEAVLAVKYRKVDEYGNMIGGPMYYLQEGLNSKFLGVAFAIFAVIASFG
FT                   IGNTVQVSEVASAMKTSFNVDPRITGIVLLVLTGSVILGGIQRIGRFTSAIVPTMIIFY
FT                   VVSSLVIIFMHYDKIIPAFVLIFKSAFIPQAAIGGTFGALLSKTIQKGVSRGIFSNESG
FT                   LGSSPIAAAAAKTNDPVSQALVSMTQTFIDTIIVCTMTGLIIVMSGATEGTGAVLTEKA
FT                   FSILLPGDIGGIIVTISLIFFAYSTILGWAYYGEKALEYLAGEKSIMIYRIIFTLAIYL
FT                   GIVFSKGVWVFSDIANGLMALPNLIGLLFLAKVVKSETNRFLNK"
FT   gene            626288..627067
FT                   /locus_tag="Sterm_0574"
FT   CDS_pept        626288..627067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0574"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: apa:APP7_0823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07447"
FT                   /db_xref="GOA:D1ANX3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACZ07447.1"
FT                   /translation="MDKRTEEVLAKSLTAETTELLEYIPYLLQDLWEIGSSPEDMEELI
FT                   KRNIKHCEKFKVLDLACGKGAVSVKLAESMGFHVKGIDIIREFIEFAQEKSEEYNVSDL
FT                   CEFLTGDINEAVAAEKNYDIVIFGAAGNVLGNPEETMRKLSRTVKNGGFLLIDEAYLIN
FT                   SAEDIKYRNYEYLTYDEWLEIFKKSGLALVDEITADMEQISHDNTDVDLIEKRAEELIR
FT                   KFPEKESIFKGYVRSQKNECEDLEENIKGITWLLQKL"
FT   gene            complement(627180..628709)
FT                   /locus_tag="Sterm_0575"
FT   CDS_pept        complement(627180..628709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0575"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: hypothetical protein ; K00964 galactose-
FT                   1-phosphate uridylyltransferase; TIGRFAM:
FT                   galactose-1-phosphate uridylyltransferase; PFAM:
FT                   galactose-1-phosphate uridyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07448"
FT                   /db_xref="GOA:D1ANX4"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX4"
FT                   /inference="protein motif:TFAM:TIGR01239"
FT                   /protein_id="ACZ07448.1"
FT                   /translation="MNIFYEIEKLVYYGLKHSLIEDEDRILIRNEILEVLEMDDFQELS
FT                   ETELYSLKEELESTEYPSEILNNIINWCIQNNKMENTGVTFQDLLNSKIMGRIIPRSSI
FT                   ITDKFYELYKKDSTKATEYFYALSQQSNYIRTDRIKKDKRWKYENKYGKLDITINFSKP
FT                   EKDPKEIAMAKNTPSGSYPKCLLCKENEGYAGRINHPGRQNHRIIPLELKNEKWFLQYS
FT                   PYIYYNEHCIVLSAVHRPMKIDKDCFERLLEFVELFPHYFIGSNADLPIVGGSILSHDH
FT                   FQGGNYIFPMAVAEIKEEIFFKEFPEVEAGIVKWPLSVIRLRGTKEDLLNLADIILEKW
FT                   RNYSDEANGILSHTGEERHNTLTPIARFRDNSFELDLVLRNNRTTKEHPLGIFHPHSEY
FT                   HNIKKENIGLIEVMGLAVLPGRLSEEMSIIKKYLFCENAPELIANNPETAKHTEWCKKF
FT                   IMSQNITSENIDKIINNAIGETFSLVLEDCGVFKDTAAGNKGFHKFLDLCK"
FT   gene            complement(628719..629696)
FT                   /locus_tag="Sterm_0576"
FT   CDS_pept        complement(628719..629696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0576"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; dTDP-4-
FT                   dehydrorhamnose reductase; KEGG: afr:AFE_1342 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07449"
FT                   /db_xref="GOA:D1ANX5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX5"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACZ07449.1"
FT                   /translation="MNILVVGGAGYIGSHTVNLLKKEGYTPIIYDNLSKGHKEAGEILG
FT                   VKLINGDLGDKERLKKVFSDEKIDIVMHFAAFIEVGESVTAPAKYYNNNVSKVLELLDA
FT                   MVESNVKYFVFSSTAATFGEPETEKISETHPQKPINPYGKSKLMVEEILKDYDNAYGLK
FT                   STVLRYFNASGSDENGLIGESHDPESHLIPLILQAASGRRKSIKIFGTDYDTKDGTCVR
FT                   DFVHVYDLAKAHILGMEKMKNENMSLNYNLGSGEGFTVKEIIEKTKAITGVDFTVEEEG
FT                   PRAGDPAVLVADSEKAGKELGWKPEYNLDSIISSAWKWELNRKY"
FT   gene            complement(629835..630827)
FT                   /locus_tag="Sterm_0577"
FT   CDS_pept        complement(629835..630827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0577"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: cja:CJA_0807 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07450"
FT                   /db_xref="GOA:D1ANX6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX6"
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /protein_id="ACZ07450.1"
FT                   /translation="MELRIFELKSPKLKIEILNLGGIIRKIETPDKNGIFENVVLGYEN
FT                   IEEYYKNPDYLGSLIGRTSGRIQNGEFILNDRKYTLAKNDGNNNLHGGSKGFNKVFWEV
FT                   LSYTESGILLSYTSGDGEEGYPGTAEIEVEYRIENEDELVVEYKAVSDKDTLLDLTQHS
FT                   YFNLSGNYKRTSLEHDLKIPSDSFVEIDESGMITDVIKNVKGSPFDFNTIKNIGKNIDP
FT                   EDKQIQNASGAYDHAFILNNSQNIELYDKISGRKMTVNTDAPAVIFYNSTKMGENMLLT
FT                   GGINSRRFLGACLETQHIPNAVNFSGFKVPVLKKNDTYRSKTVFKFSIM"
FT   gene            complement(630859..632025)
FT                   /locus_tag="Sterm_0578"
FT   CDS_pept        complement(630859..632025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0578"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: pin:Ping_2017 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07451"
FT                   /db_xref="GOA:D1ANX7"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX7"
FT                   /inference="protein motif:TFAM:TIGR00131"
FT                   /protein_id="ACZ07451.1"
FT                   /translation="MNLDELKAKFTEIFNNKNEKVFFAPGRVNLIGEHTDYNGGHVFPC
FT                   AITQGTYALTRKISEPKLRLFSLNFENTGIIEIDLSNLDFNPEDNWANYPKGVFHHLKQ
FT                   SGAAFDTGLEILFYGNIPNGAGLSSSASIELVSCILAKNIYNLNFDMIELIKLSQKVEN
FT                   EYIGVNSGIMDQFIIGMGKQDTAVILDCNTLKYRYVPLILDGYSIIISNTNKKRTLADS
FT                   KYNERRSQCEAALHDLQKVLNIKSLGDLTEKEFEKYKHLITDKTNEKRARHAVYENLRT
FT                   LEAVEYLTNNDLENFGKLMIASHDSLRDDYDVAGAELDALVQAALKQKGVIGSRMTGAG
FT                   FGGCTVSIVKNENIDDFIKNTGKEYQEKTGLTADFYIAHSGDGAHEIL"
FT   gene            complement(632433..633599)
FT                   /locus_tag="Sterm_0579"
FT   CDS_pept        complement(632433..633599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0579"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: vha:VIBHAR_02870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07452"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX8"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ07452.1"
FT                   /translation="MKKLNITDYKALEEIRTNNKISRIKLSGSLELTPAAVTKIIKKLS
FT                   GLKLIENNNILKSTGGRPEKSLKINHRYKMILGINFGPEFIETALSYLDGELLCMKRRN
FT                   FYIRSQEKILRILFEEIDNVLEEYSKDDILGIGLALHGTVNREKGISIFSPHFGWKNLN
FT                   IQELIEKKYSLPVIIDNDVRAMAIAEHEFGRAQNTDNFLVIHISNGIGGAIFLNGKTYE
FT                   GSDFSAGEIGHITAVENSSRRCSCGKYGCLEAESSDEAIKNKVLTELEKIQEKVDISLK
FT                   TEDIYKMAAEKKEPYFSVVRNSSYEIGKAVGNLLNILNIKLVIVAGRIVNTDSLFFVNL
FT                   NKGIKKNILDGLEKDLHTVPAKLYDSIGIYGAFSLVTTNLFKGRKLIK"
FT   gene            634013..634720
FT                   /locus_tag="Sterm_0580"
FT   CDS_pept        634013..634720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0580"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   cja:CJA_1779 MotA/TolQ/ExbB proton channel family domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07453"
FT                   /db_xref="GOA:D1ANX9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANX9"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACZ07453.1"
FT                   /translation="MKVVNYLIVGGIFMWPILMALVCGMAVLLEKTWYFLKNEKDMTDK
FT                   FKKNLIKLIQNGNKKEIIDFCSTKKNSVAKTIKNTLETFEEDEGGDFDPRYLEEIAKET
FT                   TLEQITRLEKGMWLLNIVATVSPQLGLLGTVTGMIMAFKGLSGAGGADSTIIAAGISEA
FT                   LYTTAFGLIVGIPALIAYNFFDRRIDSVLIEVERMTVYLTNSMQNKNNGIKNSYRVFNQ
FT                   GEVYEKYETQKKN"
FT   gene            634689..635111
FT                   /locus_tag="Sterm_0581"
FT   CDS_pept        634689..635111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0581"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   slo:Shew_2475 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07454"
FT                   /db_xref="GOA:D1ANY0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY0"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACZ07454.1"
FT                   /translation="MRNMRRRRRTRGPEISMLNLIDIIFTMLIFFMVATTFNVYSNLGI
FT                   NVPDSEMKKTETKEQKVEILLNKNKEYFLKTDSAVRKIDVNNLEAEVSFLKNTKEKNIT
FT                   LTADKELEYGMIIELMGKLKNAGIKDINLNIQATGV"
FT   sig_peptide     634689..634814
FT                   /locus_tag="Sterm_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.851 at
FT                   residue 42"
FT   gene            635135..637129
FT                   /locus_tag="Sterm_0582"
FT   CDS_pept        635135..637129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0582"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor plug; TonB-dependent
FT                   receptor; KEGG: cff:CFF8240_1760 TonB-dependent heme
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07455"
FT                   /db_xref="GOA:D1ANY1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY1"
FT                   /inference="protein motif:PFAM:PF07715"
FT                   /protein_id="ACZ07455.1"
FT                   /translation="MFKKIAILCLLAIALLANANEEVTVTGEIRMDENITTTTGFESTV
FT                   KEQVKNVTVISRDDIEKKGYKNLQEVLRDAPGITFVDAGGGASIDMRGQGDKAVSKVKV
FT                   LVDGVMMNLLDTSHGVTPINTIGVSNIERIEIIPGGGAVLYGNGTVGGVVNIITKKPTE
FT                   TGGRIGAEYGSHYDKNANAYLGFKINEQLYLNFDYSGRDAHTYRDKEEFRNDYWAAGIR
FT                   YDISDRQSLAFKGSRFTEDGTSVGALTQAQMDQNREQAGSSLTNYDETRTEFVLDYGIN
FT                   VLDNLRFDITGYWQEDETKTKQDAKMGSISYTSNGLFDDEKFGINLKGKYNYSKGELIF
FT                   GYNYLDNDMKRQSHSILASGATMSKTTVDLGKVTNSLYILEKHNILDNLQIIGGFREEW
FT                   AKYTIDRTDGTYALNKDDNDSNSAWELALNYLYRDTGNVYMRYEHGFLSPTPTQLTNKD
FT                   PLTGYYLNDLKSETYDTYEIGMKDVVLGSYVSLTGFYTKTKDEISQVFTTGHGMGWEFY
FT                   NLDETERYGIEAFAEQYFGPVTINESIAYIDAEITSGSKKGQNIPYVSDIKATIGVKYE
FT                   IIKNLNAGLNFNYYGDAEDAAGKKVDAYSTTDFVVSYDFENGIGIIAGVNNLFNEKYNT
FT                   YQSTSTSTGVTEYKPADEINYYVGVRYAF"
FT   sig_peptide     635135..635194
FT                   /locus_tag="Sterm_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 20"
FT   gene            637119..638114
FT                   /locus_tag="Sterm_0583"
FT   CDS_pept        637119..638114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0583"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: ccv:CCV52592_0650 hemin transport system
FT                   permease protein HmuU"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07456"
FT                   /db_xref="GOA:D1ANY2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY2"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACZ07456.1"
FT                   /translation="MHSSTRRIYIILIVLLFMISIFSLSTGSVQIPKTGIIKYFLGMGG
FT                   DLSDSMKTILISVRLPRILMAVLIGMLLSSSGTVVQTVFQNPLADPYIIGIAASATFGA
FT                   VLAFVFNLPDIMYGVLAFVTSVIVSIIIFKLSKSGNKSDITTLLIIGIAISSFLGAFTS
FT                   FAMYLIGENSFKIVTWMMGYLGSATWEKIVILLFPLIVSVFYFFAKRHELDLLLSGDEE
FT                   AHALGVNVEKLKKRMLVVASLIVGFSVAFTGMIGFVGLIVPHTMRLLTKSSSNTRLIPL
FT                   ASIGGGVFLLFCDTIGRTIIAPVEIPIGVVTSFFGAPFFLYLAMRSKKGG"
FT   sig_peptide     637119..637205
FT                   /locus_tag="Sterm_0583"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.520 at
FT                   residue 29"
FT   gene            638117..638896
FT                   /locus_tag="Sterm_0584"
FT   CDS_pept        638117..638896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0584"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cff:CFF8240_1762 ferrichrome transport ATP- binding
FT                   protein FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07457"
FT                   /db_xref="GOA:D1ANY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ07457.1"
FT                   /translation="MKHNVKVNKLSFSYNNNNILNEVNIDIKKGEFTGILGPNGCGKST
FT                   LLKNILRYLQPENGVIEIKDKNIKDYKQKDLAKTLGFVPQKSSLSMPLTVEDVVYMGRV
FT                   AHMKNSWAGFSENDNKIVDDVIRILKLEKFRKRPAFSLSGGEFQRVLLARALVQEPEIL
FT                   LLDEPTSALDINYALEIMRLTSHFVKEGRLTGIMVLHDLNLAAMYCDNIIFLKDGKVKY
FT                   TGSPTELFTSEVLEEIYGFKCEIVNNGDYPYVLPHKL"
FT   gene            638956..639828
FT                   /locus_tag="Sterm_0585"
FT   CDS_pept        638956..639828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0585"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   ccv:CCV52592_0648 hemin-binding periplasmic protein HmuT"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07458"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY4"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACZ07458.1"
FT                   /translation="MYKKRIIMFLMIVLGALGLISCGKEPEAKEEAVKETTVYKKIVVL
FT                   DPAVVEMLYLLNAEDRIAAVAHSQTTGIWPEDKTKDLPDVGTLAKPSLEKIISFSPDLV
FT                   VLSIHSTGLAKDLEAHGIKTVSFPANSFDDIFNNFLEVGKLIGKENEAQKITAEKKEKL
FT                   EEIKKSEPLNKKGAFIYSASPMMAFGENSLPGEVLKIYGVENLTDKVKGERPILTPEYV
FT                   IEENPDFLLVGLGVSSEDEIVTANPQLKDTNAVKNKNIIKVNSQALLRGSPRIVDETMN
FT                   LYEEIKNLK"
FT   sig_peptide     638956..639027
FT                   /locus_tag="Sterm_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.946 at
FT                   residue 24"
FT   gene            639838..640629
FT                   /locus_tag="Sterm_0586"
FT   CDS_pept        639838..640629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK23239 gene product from transcript GK23239-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07459"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07459.1"
FT                   /translation="MKFYVISIILTVTALFVPVIQPAIAGAGEDTIAVSLESLESMDGD
FT                   DAGGGNGMELPEGGGGSGGIPQTEQKQVTQKHEEVTKNIQTEKSVNNNKTASTSENSSN
FT                   VTKSAGSESTGQDNTGNSGVNGGRAGSPGGDGTGGTPGGKGKEGGTGSKGSGNNPIGKN
FT                   PDPAPKTTTNYGCVNGKGYKMVTKPKIKLNRAQTLTIPSGTRVTVNGAFSANGSLNVSG
FT                   VSGGNAEAQRLARNAASGIKVNVIDKTITKCNVTITYTLAE"
FT   sig_peptide     639838..639915
FT                   /locus_tag="Sterm_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.588 at
FT                   residue 26"
FT   gene            640645..641403
FT                   /locus_tag="Sterm_0587"
FT   CDS_pept        640645..641403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0587"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: cju:C8J_1514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07460"
FT                   /db_xref="GOA:D1ANY6"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR026324"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY6"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACZ07460.1"
FT                   /translation="MKDTIINHMNHDHMDALMVLVRYHNGKEDVNNAKMLDVDNRGMKI
FT                   LVNEAEEVFVPFGKDTELSEVKDELIDMLKTARTALGIEKKPGGHMNEAVKYISEFGSV
FT                   VLGTVNAESEPNVTYAPYLRYEDKNYIYISKIGVHYDNLKNNGKLELLFLEDETKAKAV
FT                   TVRQRVRFKAQAVFLERDEKFGKIMDAFEEKAGNTMKIMRDMTDFHLVELIFLEGSFVK
FT                   GFGQAYTISESGEMEPLTSDKLGRTHESKE"
FT   gene            641434..642681
FT                   /locus_tag="Sterm_0588"
FT   CDS_pept        641434..642681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0588"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: ccv:CCV52592_0647 quinone-reactive Ni/Fe
FT                   hydrogenase, large subunit; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07461"
FT                   /db_xref="GOA:D1ANY7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY7"
FT                   /inference="protein motif:PRIAM:1.3.99.22"
FT                   /protein_id="ACZ07461.1"
FT                   /translation="MFEKRFKSHHDVKSIIGAKFKSSKRMGTPEEIKVLFDSEPKDETG
FT                   ILYIHTPFCDKICSFCNLNRKQLDNDLEEYTDFLISEFEKYGATNYMRHKRLEVVYFGG
FT                   GTPTIFKAGQLERILESINKNFILKDNCEFTFETTLHNLTDEKLEVMERLGVNRLSIGI
FT                   QTFSDRGRKILNRTYDKETAVKRLGEIKAKFKGLVCVDIIYNYPDQTPEEVKEDAEIVH
FT                   SLNIDSSSFYSLMIHEGSKMSKDIKDDVFHLDYKLETDKELHNTFMNTLLDTGEYEILE
FT                   ITKINKKGRDKYKYITLSNKGTDILPVGLGAGGKLGNYEMFRMNYERQFFSYSSDEEQR
FT                   IKNLSGLFQYPEVYFEDIKKFVPDNTFNKIYKLLEGMKEKELMDINKDHIELKGDGLFW
FT                   GNTIGREVISISLEEE"
FT   gene            642683..643183
FT                   /locus_tag="Sterm_0589"
FT   CDS_pept        642683..643183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0589"
FT                   /product="flavodoxin family protein"
FT                   /note="KEGG: cff:CFF8240_1764 flavodoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07462"
FT                   /db_xref="GOA:D1ANY8"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY8"
FT                   /inference="similar to AA sequence:KEGG:CFF8240_1764"
FT                   /protein_id="ACZ07462.1"
FT                   /translation="MKTLVTYSTLTGNTKKVAEAVFEAVSGEKEIMDIKSIKETDGYDR
FT                   ILVGYWVDKGDANEEAKKFMETLKNKKVGTFGTLGAYPDSEHAQKCVEKISEALKANGN
FT                   TVVAEFICQGAIDPKIIETMRKMGSNGPHAPTPEREARWAEAAKHPNEADFSAAKDVFG
FT                   KLD"
FT   gene            643332..643550
FT                   /locus_tag="Sterm_0590"
FT   CDS_pept        643332..643550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07463"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07463.1"
FT                   /translation="MKILCKKRYMKMNRKISKPETDNLTFIKVFCRNIKTGIKIPVSIN
FT                   FIKFSRVSTEIGTLSGNTLKVRIFSWT"
FT   gene            complement(643547..644830)
FT                   /locus_tag="Sterm_0591"
FT   CDS_pept        complement(643547..644830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0591"
FT                   /product="Guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="PFAM: amidohydrolase; KEGG: dat:HRM2_28460 GuaD"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07464"
FT                   /db_xref="GOA:D1ANZ0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ0"
FT                   /inference="protein motif:PRIAM:3.5.4.3"
FT                   /protein_id="ACZ07464.1"
FT                   /translation="MIKEIKIYKGDIIFCESPDKFTTLENGYIITENNKIKETVQELPA
FT                   EYSDIEILDFSENLIIPGFVDIHLHAPQFENLGLGYDNELLPWLENYTFPEEAKFSDTK
FT                   YAEEIYKKFIKALYMHGTARSVVFSSLHLESTEILADLFLESGLGAYIGKVNMDRNSPS
FT                   YLTENYKKSLEETEYFIKKYNKPDSMIKPIITPRFIPTCTPELMDGLSKLSEKYNVPVQ
FT                   SHLSENLSEIEWVKELHKEIETYAGVYNHYKMFGDRPTIMAHCIHNTDDEIKLMKEKGV
FT                   FVAHCPTSNFNLSSGIAPIRKFLDNNVKVGIGTDIAGGHTISIPETIISAIHASKMYSV
FT                   YADRTFHSLSISEAFFMATKGGGEFFGKVGSFEKDYEFDALIINDNELSGGSNKTIQER
FT                   LEKYIYFGAKEDIIKMFVSGKEINRERF"
FT   gene            complement(645098..647107)
FT                   /locus_tag="Sterm_0592"
FT   CDS_pept        complement(645098..647107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0592"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: gur:Gura_1305 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM: NAD-dependent DNA
FT                   ligase adenylation; BRCT domain protein; zinc-finger
FT                   NAD-dependent DNA ligase C4- type; NAD-dependent DNA ligase
FT                   OB-fold; SMART: NAD-dependent DNA ligase ; BRCT domain
FT                   protein; Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07465"
FT                   /db_xref="GOA:D1ANZ1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ1"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ACZ07465.1"
FT                   /translation="MEQTGIKKRYEELKDLIRKYNEHYYEKNESLVTDYEYDMLLKEME
FT                   SIEKEYPELKDTVSVTEKVGGRASGKFSKVVHKVPMLSLSNTYNIGEIEDFDKRIKKVI
FT                   GEDQKIEYVLELKLDGLSISIQYENGRLVRGITRGDGEIGEDVTENIMQIDSIPQILKE
FT                   PVTLEVRGEIVLPISNFNKVNKMREEAGEDVFANPRNAASGTIRQLESSIVKDRGLDCY
FT                   LYFLVNAQNYNLQKHSDSIKYLEKLGFKTTKVFEIYKDFSLLEKAIEKWHVERERLDFE
FT                   TDGLVIKLDEFAYYSALGSTTKSPRWAIAYKFPAEKAKTKLLDITFQVGRTGVITPVAE
FT                   LEPVELSGSVVRRASLHNFDEIKRKDIKIGDFVYIEKAAEIIPQVIEPVISERTGSEKE
FT                   IEMPESCPSCGHKLIKIEDQVAIKCINPACPEIIKRKIEYFVSRDAMNITGLGEKIIEK
FT                   FIELGKIKDIVDIYSLHEYREELEKLEKMGKKSVDNLLNSIEESKKREYSKVLYSLGIP
FT                   FVGKFTANLLAKEFLNIDNLKSKETEDLLEVKGIGDKVAKSVNMFLNDENNWNLISKLK
FT                   ETGLQFEEEEVFIEDNPIKGKTFLATGKLEKYTRDEIKDIIEAKGGKYLSGVSKNLNYL
FT                   IAGEKAGSKLKKANDLGVIVLNEEQFEKEFLEEE"
FT   gene            647313..647630
FT                   /locus_tag="Sterm_0593"
FT   CDS_pept        647313..647630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07466"
FT                   /db_xref="GOA:D1ANZ2"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07466.1"
FT                   /translation="MDKKINGKKILFFIIIIAVCIITQKFVLGIILIIFLINSLKGKSR
FT                   NNGNARTGKQGRKNYYNQPSALSKQGGQRNFPVNSVKTEEQKQREKWAKRRDKDPWEWD
FT                   E"
FT   gene            647769..648212
FT                   /locus_tag="Sterm_0594"
FT   CDS_pept        647769..648212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0594"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: dps:DP0120
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07467"
FT                   /db_xref="GOA:D1ANZ3"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ3"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACZ07467.1"
FT                   /translation="MRIVVQKVKKAEVVIDEKTYSSIGHGIAAFVGISRTDTITDIKYS
FT                   LEKLINLRIFEDMEGKLNLSLLDVKGELLVVSNFTVYGDTKKGRRPSYIESASPEDAEK
FT                   LYDLFLEELSKYSIPYETGKFREHMNVILENDGPVTLIINSKD"
FT   gene            648230..648835
FT                   /locus_tag="Sterm_0595"
FT   CDS_pept        648230..648835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0595"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: eca:ECA2735 putative
FT                   outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07468"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ4"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACZ07468.1"
FT                   /translation="MRKFFIFSATLFIFCFFIGTSAKTTSSSTKKSTAAGDPGVYDSEY
FT                   VHDEKVITKKVTQLKDDQQVILMSGTFDQLNDIIVENELLKSFENWRGTRYSWGGDSKS
FT                   GIDCSALTRRVYREVFEFELPRVSVDQAQRGVHISKSELRPGDILFFRPENRVNHTAVY
FT                   VGNSLFINASSSQGVVLSSLENKYWGKYFKYGVRIAEK"
FT   sig_peptide     648230..648298
FT                   /locus_tag="Sterm_0595"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.756 at
FT                   residue 23"
FT   gene            648958..649557
FT                   /locus_tag="Sterm_0596"
FT   CDS_pept        648958..649557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07469"
FT                   /db_xref="GOA:D1ANZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07469.1"
FT                   /translation="MTDRQRNTLVVGCIIFGILALGSVGTGIIVTALGQTGNTARTRTV
FT                   RSNRTEKAASQQQSSNEIQTKVFEEKERIEKKIQEYENIHLPNWYKLVEALETSDITDS
FT                   YKYAETAKRQTKEILDDIPDVEWGNTGDKEFDIQCEQLRNKMLEVYTAKYESIVKLIIF
FT                   IENPDSPEKMTEAIVAVEESADIWEDFIDEVSEVIY"
FT   sig_peptide     648958..649062
FT                   /locus_tag="Sterm_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.772 at
FT                   residue 35"
FT   gene            complement(649663..649791)
FT                   /locus_tag="Sterm_0597"
FT   CDS_pept        complement(649663..649791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07470"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ07470.1"
FT                   /translation="MKKTIMLITLITGILFVTSCTSVSFNPDEDRTEEMMRRYSAE"
FT   sig_peptide     complement(649717..649791)
FT                   /locus_tag="Sterm_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.643 at
FT                   residue 25"
FT   gene            complement(649908..650399)
FT                   /locus_tag="Sterm_0598"
FT   CDS_pept        complement(649908..650399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0598"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: avi:Avi_3612 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07471"
FT                   /db_xref="GOA:D1ANZ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACZ07471.1"
FT                   /translation="MENDTALDCCFIRDKNWFRYRAAAIIIENNCILLAGNEKSDYYYS
FT                   VGGGVHLGETAEEAVIREVYEETGIKYEVDRLVFIHENFFTGNGIFEGLRCHETAFYFL
FT                   MKPMGTQKLNSNSCCLEGREFMYWIPIDGLEKLKVFPVFFKEKLTKIPDRIEHIITKEK
FT                   "
FT   gene            complement(650561..651061)
FT                   /locus_tag="Sterm_0599"
FT   CDS_pept        complement(650561..651061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0599"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dps:DP0082 NADH
FT                   dehydrogenase/NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07472"
FT                   /db_xref="GOA:D1ANZ8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ8"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ07472.1"
FT                   /translation="MNSIFVRRSIREFLDKPVENEKIEQILRAGMQAPSARNQQAWEFI
FT                   VVTSQEDKEKVSQMSPFSKLAAKAAVLIVLLGNKDKMTVPDKWQQDMGACTQNMLLQIV
FT                   KEGLGGVWLGVHPTQERIDSLKDIFGLPDNIMPFAVVCFGYSNKKNTFTDRYKEAAVHW
FT                   DKY"
FT   gene            complement(651073..651876)
FT                   /locus_tag="Sterm_0600"
FT   CDS_pept        complement(651073..651876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0600"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: prostaglandin f
FT                   synthase; K00120"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07473"
FT                   /db_xref="GOA:D1ANZ9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANZ9"
FT                   /inference="protein motif:PRIAM:1.1.1.274"
FT                   /protein_id="ACZ07473.1"
FT                   /translation="MISLKMANGVEIPQIGFGTFKIPDDIAAQSVKYALAAGYRHIDTA
FT                   AVYRNEDGVGLGIKESGIPRNEIFLTSKLWNDDQGYDSTLKAFDVSLKKLGTDYLDLYL
FT                   IHWPKNKNKESWKAMEKLYKDGRVKAIGVSNFKEHHLDDLLTDAEITPMINQVELHPQF
FT                   PQEALRNYCTKKGILTEAWGSLMQGQIFDKELIKEIAQKHNKTVSQIGIRWAVQNGVVT
FT                   IPKSTHEQRIKDNLNVFDFELDNEDMKKIAELNTGIRIGRDPDNI"
FT   gene            complement(651971..652660)
FT                   /locus_tag="Sterm_0601"
FT   CDS_pept        complement(651971..652660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0601"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.4"
FT                   /note="KEGG: nmn:NMCC_1509 phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07474"
FT                   /db_xref="GOA:D1AP00"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP00"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ACZ07474.1"
FT                   /translation="MYLVFIRHGQSEWNKKNLFTGWTDVDLSDEGINEAIKAGQLLKKH
FT                   NFTFDVAYTSVLKRAIRTLYFVLNETDQLWIPVYKSWRLNERHYGALQGLNKAQTAEKY
FT                   GDEQVHIWRRSYDVLPPLLDENDERQSKFDRRYEGLDSRILPSGENLKVTLERVMPYWE
FT                   DEIAPALKSGKKVVIAAHGNSLRALAKYLENISDDEIMDLEIPTGVPLIYELDDNFKVL
FT                   KKYYLED"
FT   gene            653041..653448
FT                   /locus_tag="Sterm_0602"
FT   CDS_pept        653041..653448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07475"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP01"
FT                   /inference="similar to AA sequence:KEGG:BRAFLDRAFT_93138"
FT                   /protein_id="ACZ07475.1"
FT                   /translation="MKKMLLVLLTLGVIFSCGKKEEPKADDAATETQTETTAEPAKEDA
FT                   AATEGATFKDAEVQKYVDDYKAYIKEVSEAVAANDATKIADLGTKAQEWATKSQEITTK
FT                   LANDPEEAKKFGEELTRLSQEYADEMAKMAK"
FT   sig_peptide     653041..653100
FT                   /locus_tag="Sterm_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.676 at
FT                   residue 20"
FT   gene            653606..653863
FT                   /locus_tag="Sterm_0603"
FT   CDS_pept        653606..653863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07476"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP02"
FT                   /inference="similar to AA sequence:KEGG:PSEEN4595"
FT                   /protein_id="ACZ07476.1"
FT                   /translation="MDFNETVRSNEGLNETKLENVCALLENLKIEIQERKSVPLNIADV
FT                   FIDLYSSIEASAYRHEEEMKNKILLAADKLADTARSVVCE"
FT   gene            654326..655039
FT                   /locus_tag="Sterm_0604"
FT   CDS_pept        654326..655039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0604"
FT                   /product="protein of unknown function DUF328"
FT                   /note="PFAM: protein of unknown function DUF328; KEGG:
FT                   ftw:FTW_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07477"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP03"
FT                   /inference="protein motif:PFAM:PF03883"
FT                   /protein_id="ACZ07477.1"
FT                   /translation="MKIILSPSKTQKIKKINGFDLKDIMYGEHTAGLVNILKGLSGKKL
FT                   KRIMKTSDKLTEEILDTYCNFYENERGHAAASYTGVAFRALDTENLSDKDIEYLEKSVV
FT                   ILSALYGVLTPLTGIQPYRLDMTMSVLDKKSLYEYWKECIDKYFEKEDLIINLASKEFS
FT                   KMIKKPLTDIEFYEMKNGSPVQVSTNSKKARGEMARHIITQKISSKEKIKEISFGGYKF
FT                   DKNASGENKLVFIKS"
FT   gene            655217..655840
FT                   /locus_tag="Sterm_0605"
FT   CDS_pept        655217..655840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07478"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP04"
FT                   /inference="similar to AA sequence:KEGG:Swoo_2851"
FT                   /protein_id="ACZ07478.1"
FT                   /translation="MKYEWKKQEKEIYLPKGKPEQIFIKKFRYLTLEGSGNPNESLFSE
FT                   LTGALFSLSYTLKMLPKKGITPDGYFDYAVYPLEGIWDLDIDSDFDETKLDKNKLVYKI
FT                   MIRQPDFINKEIIETAAEILKKKKTVMYIDKIKFEEIEDGLAVQMMHTGSYDSETESFE
FT                   KMKNFCLENKLNIRSKAHKEIYISNPERTAPEKLKTVLRYFVKK"
FT   gene            complement(655915..657126)
FT                   /locus_tag="Sterm_0606"
FT   CDS_pept        complement(655915..657126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0606"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: pau:PA14_61480
FT                   uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07479"
FT                   /db_xref="GOA:D1AP05"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP05"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACZ07479.1"
FT                   /translation="MNAKKLILGIQHVLAMFGATVLVPFLTGLNPSLALLAAGLGTLIF
FT                   HLVSKRIVPVFLGSSFAFIGALTLVLKQDGIGAVKGGVICAGFVYVFMSIIIKVFGVEK
FT                   VKSFFPPIITGPIIMVIGLRMSPVALSMSGYSDGKFEVKSLIIALSVLVTMIVVSILGK
FT                   SFFKLVPILISVIVGYLVSMCFGIIDFTPIHAANWIGFSKEALSDLTAVPVFRLSSVIA
FT                   IAPIAFVVFIEHIGDITTNGAVVGKDFFKNPGIHRTMLGDGLATIAAGLIGGPANTTYG
FT                   ENTGVLAVTKVYDPSILRIAACYSIFLSIMGKFGAVLQTVPQPVMGGVSIILFGMIASI
FT                   GVRTLIDANLDFSHSRNLILSSLILVLGISIDNIVIWNTVSVSGLAVSALFGVILNKLL
FT                   PSDI"
FT   sig_peptide     complement(657013..657126)
FT                   /locus_tag="Sterm_0606"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.709 at
FT                   residue 38"
FT   gene            657299..660883
FT                   /locus_tag="Sterm_0607"
FT   CDS_pept        657299..660883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_0607"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: glo:Glov_1235
FT                   organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ07480"
FT                   /db_xref="UniProtKB/TrEMBL:D1AP06"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ACZ07480.1"
FT                   /translation="MKLRYKILAFFLLAVSLFSEEIVIQVETEKSIINIENESMVASGG
FT                   IILKYGDMTIRADNMKKLENQNLIVAYGNVMFTQGPSQILAKEIVFDLDSKNARIIDSK
FT                   SVTEEGIVFGGEETISEGSEKFTIKNSWFTTSPYNNPSYKLNAKKLVIFPNKKLEAHGL
FT                   SLNVKGKDIVSIPYYVTSLKPETQRATLFPYIGGDSDRGLFVIQGFDYDRGKLLQGFVD
FT                   FELSTKEILALRFSNDYELSPNNKGNLFVKRFVLPVSGNEDEWNVNWSHNFISIPKNPN
FT                   AEDRKFYELGYGIWDLNYRNLTTNQMYTINGKSLDDNYMSFKEQYKYIGTYDFKIDQEI
FT                   GKSGEFNLDYYWTQNMDALKALTAINDDIAENDSIDPRKTDVDLFKRMTYKQEDNGLGL
FT                   YLHKERFIDLNPGYIGDTHSYKNADEYSINLKSPKIKLTYSKTDQDEYQPIFGLRQRAY
FT                   GDPNTIDTYTDRILPTTAYDYNKTYDVTLGNYYPLKENDFFGYKRKDAFNNLTDNLFVG
FT                   GEVYRSEIKKKTYEYDYTTDNPNYRNYIVQPGVDDYSRIYKLYDDGSKIRRVRDIIYEK
FT                   YQGATIRLGNDKIDLPIANSYFSFGYEMDNRIYDSTPVPVFDEDRRKVEDTDSKTGYKV
FT                   LTDSTGAAITQKPTVQVNKFNFGLFTTLYDNTRFSDNKYDLKITNNIPLFFQLTDAHNS
FT                   MYGGNDIINTPANIFRFNDDFNVYLGNINLNYNFTKQMDKHWKDNWTKQDYTRNYIKAG
FT                   IGDRRYLSFDFSKSNYYPYEDFKYEETTNRDITYGFKTVKDNNVQYKYREYLYKNYSND
FT                   TWAGWDPNSVKELNRERVFGVNYNEWGFEYSNIKDNIHDVFGNQMDLKLESNRHRVGFV
FT                   YDTARM