(data stored in ACNUC7421 zone)

EMBL: CP001740

ID   CP001740; SV 1; circular; genomic DNA; STD; PRO; 54160 BP.
XX
AC   CP001740; ABUO01000000-ABUO01000028;
XX
PR   Project:PRJNA29539;
XX
DT   20-NOV-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Sebaldella termitidis ATCC 33386 plasmid pSTERM01, complete sequence.
XX
KW   .
XX
OS   Sebaldella termitidis ATCC 33386
OC   Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
OG   Plasmid pSTERM01
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-54160
RX   PUBMED; 21304705.
RA   Harmon-Smith M., Celia L., Chertkov O., Lapidus A., Copeland A.,
RA   Glavina Del Rio T., Nolan M., Lucas S., Tice H., Cheng J.F., Han C.,
RA   Detter J.C., Bruce D., Goodwin L., Pitluck S., Pati A., Liolios K.,
RA   Ivanova N., Mavromatis K., Mikhailova N., Chen A., Palaniappan K., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Brettin T., Goker M., Beck B.,
RA   Bristow J., Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C.,
RA   Klenk H.P., Chen F.;
RT   "Complete genome sequence of Sebaldella termitidis type strain (NCTC
RT   11300)";
RL   Stand Genomic Sci 2(2):220-227(2010).
XX
RN   [2]
RP   1-54160
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Sims D., Meincke L., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Eisen J.A.;
RT   "The complete plasmid1 of Sebaldella termitidis ATCC 33386";
RL   Unpublished.
XX
RN   [3]
RP   1-54160
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Sims D., Meincke L., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Eisen J.A.;
RT   ;
RL   Submitted (08-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; d0babe5d6b6369d1f7b4bf3afbabb5f2.
DR   BioSample; SAMN02598468.
DR   StrainInfo; 120712; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084069
CC   Source DNA and organism available from ATCC: ATCC 33386
CC   (www.atcc.org)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Sebaldella termitidis ATCC 33386
CC   Culture Collection ID :: ATCC 33386, NCTC 11300
CC   GOLD Stamp ID         :: Gi02490
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: termite intestine
CC   Host Name             :: Termite
CC   Body Sample Site      :: Gastrointestinal tract
CC   Body Sample SubSite   :: Gut
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Gut, Host
CC   Phenotypes            :: Uricolytic
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..54160
FT                   /organism="Sebaldella termitidis ATCC 33386"
FT                   /plasmid="pSTERM01"
FT                   /strain="ATCC 33386"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:526218"
FT                   /culture_collection="ATCC:33386"
FT   gene            complement(462..1115)
FT                   /locus_tag="Sterm_4140"
FT   CDS_pept        complement(462..1115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4140"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; KEGG: vha:VIBHAR_p08245
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10972"
FT                   /db_xref="GOA:D1ARY5"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARY5"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACZ10972.1"
FT                   /translation="MKYYYARVSTAKQNLARQIELFKELGGNKRTIFEEKRSGANFEDR
FT                   EAWDELIECVRSNDVIVVKNLDRLGRNAKEVRECLVKLADKKVIVESIDQEYLNEFLKT
FT                   KLVDKTADSLAEAMLNAMLDTMLEVDLLRAEWERRELRKRQQEGIERAKARGQHLGRNK
FT                   EEKYREKFKEIYRLTRDKDNPDYISITKACKEIGCSRPMFYKMEKEVELEKNIL"
FT   gene            1381..2127
FT                   /locus_tag="Sterm_4141"
FT   CDS_pept        1381..2127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:HCM1.203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4141"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10973"
FT                   /db_xref="InterPro:IPR025359"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10973.1"
FT                   /translation="MTEKEILIEKFYQLLNSSSTSENDIQTFLETNSSLIPLPFILNHA
FT                   LNGNSVISKLNLGNTYVTDFAYLTKSTVKWQLVLIELEESKKKFFTKENLFSAEFNRAL
FT                   AQIDDWKIYCDKYKDRIMKQTNALRNPLNGNPVEIFYVLIYGRNEEYQNDEYRSAKIAE
FT                   LEKNSNLRVMSYDSLVSEFRYKTAHYEDKNKIILSPRGDEKFSLKYHSNVYGSFLFDRI
FT                   DPNYLEIPKNFHSELLNLGYDIKKWL"
FT   gene            complement(2457..2774)
FT                   /locus_tag="Sterm_4142"
FT   CDS_pept        complement(2457..2774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10974"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10974.1"
FT                   /translation="MNQEKANEIRIEVLKSSIGGYKPDSVIPLLVQNKTIHKKHADEIQ
FT                   KLIDLATEVISFRDASLEKANNIKCEEDILSTNDDFKKLSNKYIEYLEQFDKVNELIMK
FT                   K"
FT   gene            3190..3471
FT                   /locus_tag="Sterm_4143"
FT   CDS_pept        3190..3471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4143"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10975"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10975.1"
FT                   /translation="MNYNYYYFFKGIRKIEKINEWFEYVFSKNPRILLVHTAPVTFNID
FT                   NTTYTIRYKEKWDLIYCIKLHGVTSYIEHSHYLLKIENFLNKLKDTKY"
FT   gene            complement(3500..3748)
FT                   /locus_tag="Sterm_4144"
FT   CDS_pept        complement(3500..3748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10976"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10976.1"
FT                   /translation="MYVVYLNNEVIGKLSKNQTLKEFLREEFLRQDKEIEMGYQNLHPC
FT                   WAEHYESILLDFEEIPSYYIELNIDWYVDKRDFTIRE"
FT   gene            complement(3739..4356)
FT                   /locus_tag="Sterm_4145"
FT   CDS_pept        complement(3739..4356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10977"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10977.1"
FT                   /translation="MIVLYLGNLLIGQIKNIEELNDFLKEEIERINELRNKGYYVRFPK
FT                   WAKLKKDYKILPENSITLNSDRFAERKEFLIMSKKNKYGYEPIISNFVGYQKIAKLNFE
FT                   NDDQVEISLNSFEIYENPDGKGIHGRSYVTLLKNKEYISKDKKITEMYNHDVVYAEDIS
FT                   NFQIVADIITERFIQLDIKIKNVEYFNSDIKFVKVWEGNLCM"
FT   gene            complement(4388..5272)
FT                   /locus_tag="Sterm_4146"
FT   CDS_pept        complement(4388..5272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10978"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10978.1"
FT                   /translation="MEIRKDEIMGRVLTEGEKEKQAITIGVSTELMKNLLGNDKINTYD
FT                   FGRKYMYLKYYDYEQTKEIQGNLSNEELEKFPSMGLDMGVFKNNQNEYISVYDIADIKI
FT                   KSTEMTKDGLNETIQDLEKGNCEVENSDNRIDSLKVYFKWSERFLQENLIFKGKEAIEF
FT                   LNKLIEADNIYHEEREINDQDSEEYYLPYYKTKLAIEYSGLKYDIERIDLGDGIYKNLK
FT                   SFTIEREESFKDLSNEIEKLRGIIQDKVIDDFQKNYKRLFDVMKEYKPEKQNFQTSEEA
FT                   FRKLEKVLAEKKI"
FT   gene            complement(5692..6522)
FT                   /locus_tag="Sterm_4147"
FT   CDS_pept        complement(5692..6522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_03582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4147"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10979"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ2"
FT                   /inference="similar to AA sequence:KEGG:HCH_03582"
FT                   /protein_id="ACZ10979.1"
FT                   /translation="MKKILLKDLLNFSSEQIEKVKVKFNQHNGDTNPMEEYIKNPEAIN
FT                   TGWLFWRKEKRYFNEGEIAICFFKLGKDTWVLSTIKLVTKELNKKNGINYEGEELEKYS
FT                   AYYGRVIVKHHKKYQNQVRKFKMIIEDLEVSQILPTIYDGEEFPGYDNVSLSYNQLKII
FT                   ITKHKRDWINALKNQKAVYLITDKESGKHYIGSATESEGMLLTRWTTYIKNGHGGNELL
FT                   KDIINEKGFNYIKENFQYSILENYNARIDDKIIITREGWWKRVLNSRTHGLNLN"
FT   gene            complement(6596..7225)
FT                   /locus_tag="Sterm_4148"
FT   CDS_pept        complement(6596..7225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10980"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10980.1"
FT                   /translation="MSVFDMREEKKEKVISLEEEKEQTYFNFQDYNIEKETAEKIIRKE
FT                   GSIRNNLRQLDRNTRELSKSLYEIQQLLVNNKKGGFRAYLEYINISKDTAYRFIDKWNL
FT                   FLETKQAKVFELPHSTVKNLKKEVQELKKEDENEKIIEIVEILESENVEEKLKEYKETK
FT                   EDGNVIVIESLEEIEKRLKKIDKEIVKLTEKITKLEVEKNSLEQKL"
FT   gene            complement(7228..8022)
FT                   /locus_tag="Sterm_4149"
FT   CDS_pept        complement(7228..8022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4149"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   nam:NAMH_0315 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10981"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ4"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACZ10981.1"
FT                   /translation="MKILSFVNPKGGAAKTVSAITFAYALVKRGKKVLLIDSDPRSSIQ
FT                   VHLKINNEHNLVKLILKQYNDVIVTDFDNYITKKNGLDIIISSEELINLNSYFVLEKKD
FT                   NQAIYSCIENLLYLFEDYDYVIFDTEGTVNDFNSAILNCTDYIFTPSRASNVDLKGVID
FT                   LLDTYDIAKKKNKKLEIRKIFLVCVKERTKAYKEAKEDFENYFSNKSQYNYTESNIRDD
FT                   QNIVNAMNNGLDIINYKNSSNAAIDYRNLADEFLEEEAEREW"
FT   gene            complement(8037..8228)
FT                   /locus_tag="Sterm_4150"
FT   CDS_pept        complement(8037..8228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10982"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10982.1"
FT                   /translation="MEKKIIVKKRKLQYRQPNSKRGGQYSLSFPLDIIEDMEISGENRN
FT                   IEIIYNPILKEIKIKKDK"
FT   gene            complement(8558..9448)
FT                   /locus_tag="Sterm_4151"
FT   CDS_pept        complement(8558..9448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4151"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   eba:p2B15 plasmid-specific DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4151"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10983"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ6"
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /protein_id="ACZ10983.1"
FT                   /translation="MGKARERVFEERKELVDTIIKDLENGEKTFWQKGWLTAKPINPTN
FT                   GVSYRGINLIKLYMAAERMGFKDNRWLTYKQAESKKWKIKKGAKSIRLEFWKWDITKKV
FT                   KDENGKEKEITEELNSPIASYFNVFNAEQIENIPENTSINEIFRNNELAEKLINNSEAK
FT                   INYAFTHNAYYSRYEDKIVMPNREYFKTEDDFYAVIFHEMAHSTGHESRLNREMPKRQF
FT                   DKKYAKEELIAEISSMFLQLELGIEISNNKNHFENHKAYIKHYIELLKETPSILFNVIR
FT                   EAEKASDYILKFAKK"
FT   gene            complement(9908..10183)
FT                   /locus_tag="Sterm_4152"
FT   CDS_pept        complement(9908..10183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4152"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   tdn:Suden_1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4152"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10984"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ7"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACZ10984.1"
FT                   /translation="MSKLLKVIYSKKSKKFIEKNKKDGLKFFKAFDEISQDLENIKYYD
FT                   IKNLKTKENIFRLRIGKFRALFSKRDDQLIILVINIGSRGEIYKDL"
FT   gene            complement(10155..10436)
FT                   /locus_tag="Sterm_4153"
FT   CDS_pept        complement(10155..10436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4153"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4153"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10985"
FT                   /db_xref="GOA:D1ARZ8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ8"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACZ10985.1"
FT                   /translation="MIRKSITIDEAEYEKLNNIAHREKISFSEVIRKAMNIYINQYEDI
FT                   SLVEYIKKNCGYVSDEEEKELLSWIDEPDLDPNEGSELTIEQIIKGNL"
FT   gene            complement(10770..11063)
FT                   /locus_tag="Sterm_4154"
FT   CDS_pept        complement(10770..11063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10986"
FT                   /db_xref="UniProtKB/TrEMBL:D1ARZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10986.1"
FT                   /translation="MNILVLFDPLKEDFRIDWRLKGDSYTCYKELTGTCSLFLNSPIDN
FT                   LDLNSTVRGSFGYYKGIDKNIQELGITKFSKVYFIIEPILGFYNRMFYITLE"
FT   gene            complement(11453..11692)
FT                   /locus_tag="Sterm_4155"
FT   CDS_pept        complement(11453..11692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4155"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10987"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10987.1"
FT                   /translation="MGIIGDIIDEYYEHKHRESVSNIENDTEKIIENHDLLKRILVESM
FT                   LESHNKNQEFEKQFEYLHFKIDKIEKLLLEILNK"
FT   gene            complement(11912..12685)
FT                   /locus_tag="Sterm_4156"
FT   CDS_pept        complement(11912..12685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10988"
FT                   /db_xref="GOA:D1AS01"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10988.1"
FT                   /translation="MNIFLILLKIIFFIIIFITILFIISLILKKQIHKYKQINNIVDRL
FT                   FEICVKCLSFLYISLIITGMMKSCVGRNTTKKTTYTYKKNKIEDQVIDKLKKSQAEKIE
FT                   NSRKVDITLTTVKNNLETFLKRYKINDSTITTSRLYKKSGTGREEFCVAKKTCYYITYE
FT                   LKTEKVLLLQMTFKYPETKKQIDDFRNHICLFLGMTKPNVNFNDVDNLVTGLNIMFKMT
FT                   TNIITRNYIYENYKYYLYYNEDDDLLIITVKGVAP"
FT   gene            complement(12720..13211)
FT                   /locus_tag="Sterm_4157"
FT   CDS_pept        complement(12720..13211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10989"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10989.1"
FT                   /translation="MKKTIFLLFIIMNIIILAGPYMPKYDDINKFKAFNFYSGKNIDDS
FT                   SSIIIIPGEENKLIFYINIDEIRTNYDMYYRTSVVTDIMVQNILNKKQGIEKSLQELII
FT                   ESESKAEYKLFLFKNHKINEVKLKYTFIKGIESMAAKNQNLFLDNPKEKVLFINFTNND
FT                   "
FT   gene            complement(13260..14153)
FT                   /locus_tag="Sterm_4158"
FT   CDS_pept        complement(13260..14153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aby:p3ABAYE0112 putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4158"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10990"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10990.1"
FT                   /translation="MAKKSIFSNRNPLDNINSGKAKDLMKKLDNDDLIKQEIMKLEGAK
FT                   LTKIDKEILSKIDFSDREFINREILFDDLLKDEKLHELSKSIGTIGLINPIYLIEKVEG
FT                   YKILSGFRRSTAIFWGFENIEDYNIVGGNNLVIIPRNAPYELLDTISLHENTLREDLTT
FT                   LELSLKIWKESRHKNKKIEDIAEDYGISKRSVNRYLRVEKYPEELLEVMDKINIRKADT
FT                   IYSLLKKKNFSNSSKIINEVLPLEVGEIEKIIKTPAGRSEKISIKTKKKSTIIEIANLL
FT                   SDEDIEKIKEFINKFI"
FT   gene            complement(14146..14922)
FT                   /locus_tag="Sterm_4159"
FT   CDS_pept        complement(14146..14922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4159"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   pin:Ping_3739 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10991"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS04"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACZ10991.1"
FT                   /translation="MRKIAIANNKGGVAKTTTVYNLASYYAKNGFKVLVVDMDPQGNLT
FT                   DSLGINPVTLDNTIYDVLVNRKSKDFLIKLPQYDHFYLLPSNLESEAANLNLASQVSRE
FT                   TLLKKSLKDVEDDFDICLIDTSPSLSVLTFNALAAADSIYIPLRAGYFELRGAGMLIDT
FT                   IEQLKDELNSSLKINGIILTQYDIRSNLSSDTQNELENYFGSSLMKSKIRQNVDLGKAP
FT                   ALAQDIFTFAPHSNGAKDYEFLALEILEREGLNTNG"
FT   gene            complement(14932..16104)
FT                   /locus_tag="Sterm_4160"
FT   CDS_pept        complement(14932..16104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4160"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10992"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10992.1"
FT                   /translation="MKTELIKPISEIRIEEENYETEKLLDMEETKNIIRIEMNTIEYPL
FT                   FTKNKKIDINTGIKYIFNDKKNQFIEVIPALNSKIPHEFDERIFHGLMSLLRDQKYNRK
FT                   VYFYYKLLMEKSGIKYNGRTLKAVKESLNRLATTSYTFNNCFYYNPNANILNREIKTKM
FT                   LSIDTVTFEEAIKVSNNLSEYFYHHKIKELIEVTFDEKIFDNIISKGFLYFNAADLQLI
FT                   EYDIARSLYTMITKWRNKALYIKRYSSFLASRIPLSWKKENINKSVKSIIKAFDELKEK
FT                   KLISGYHFEKNKKYENSYFEIFFEKGHNKNLFLTHKTGQEQLQISGTENLSKSKLKYTA
FT                   EITSDKQKITLEEFNNLVIEQMKKTNNMNIKVKPTKEQTENYLLQEYEII"
FT   gene            complement(16625..16891)
FT                   /locus_tag="Sterm_4161"
FT   CDS_pept        complement(16625..16891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4161"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   tdn:Suden_1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4161"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10993"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS06"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACZ10993.1"
FT                   /translation="MNYEVYYQKKAEKWILANKKSAERFLSAFEEISKDIKGSFQIYDI
FT                   VKLKGNSDFFRLRIGKYRAIFTIQNDELIILVINIDSRGGIYK"
FT   gene            complement(16857..17162)
FT                   /locus_tag="Sterm_4162"
FT   CDS_pept        complement(16857..17162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10994"
FT                   /db_xref="GOA:D1AS07"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10994.1"
FT                   /translation="MKNQGVSITKNITIPEKDFEMIERYTKKVGKTFSEFLRYAAKEYI
FT                   KMQENLELKEFLLENCDFATLEEENDILEIIKDFDPGDRGRKISTDELRGILPKKG"
FT   gene            17345..17644
FT                   /locus_tag="Sterm_4163"
FT   CDS_pept        17345..17644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4163"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10995"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10995.1"
FT                   /translation="MASLRKLISIKEDEYNKINNYAQKERITFSEFVRKAANFYIDKQE
FT                   EIELGQYLKENCDSVSKEEQADIENWIKELKNHTDYDFNEGSEITLEKIIQGNL"
FT   gene            17616..17870
FT                   /locus_tag="Sterm_4164"
FT   CDS_pept        17616..17870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10996"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS09"
FT                   /inference="similar to AA sequence:KEGG:PFHG_04832"
FT                   /protein_id="ACZ10996.1"
FT                   /translation="MKKSYKVIYSKQVKGIFSEEKFLALNFFKAFDEITKDFTNISYHN
FT                   IKYIRDNYYVLKINNYNALFQVLKNKNLVFVIGLKESKN"
FT   gene            18091..18714
FT                   /locus_tag="Sterm_4165"
FT   CDS_pept        18091..18714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpp:HPP12_p10 RepA"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4165"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10997"
FT                   /db_xref="GOA:D1AS10"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10997.1"
FT                   /translation="MALVPLNNDDLKEYAVLHNDIVDKYSFKDLTEREENILIVLLSKL
FT                   QKQEAFSKISLKEIKNMIDKSMTYKTLSEEILKLGNKRLFLIAEKEIKDNKGNVISKKN
FT                   DLWRPVIFSTVIIHDDEKNVSVRFNPDIEYLFWQMKEEFEKVNPHHYLKIKSQNWKAFY
FT                   RLCKRWENYPSRVEITVENLKRILMYGEEMEYKTLKRRLNAVKN"
FT   gene            18909..19151
FT                   /locus_tag="Sterm_4166"
FT   CDS_pept        18909..19151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4166"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10998"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10998.1"
FT                   /translation="MSLFEDLFFDDAYLAQKFSRKVLKHSDELKNDNEIIKKILIENML
FT                   DSLKNAEEIKNEIKILNDKISGMEKLLLEILESKK"
FT   gene            complement(20379..20735)
FT                   /locus_tag="Sterm_4167"
FT   CDS_pept        complement(20379..20735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein ; K06675 structural
FT                   maintenance of chromosome 4"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4167"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ10999"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ10999.1"
FT                   /translation="MKNESIKTLLRREKELVSEIEDIKGKKKEIDKNLEIKRKKLEGVK
FT                   AKIANAQESVIISEHAVIRYIERVLGIDIKEIEKKIVDEETEKIIMELRPSKICRGEFS
FT                   ILIKDNTVTTITTD"
FT   gene            complement(20989..21291)
FT                   /locus_tag="Sterm_4168"
FT   CDS_pept        complement(20989..21291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11000"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11000.1"
FT                   /translation="MGNKKIGENMKVKFIKSPQFTGELSDFKERKSDIYTAIKIILEID
FT                   INNYGTSYDCSMIAEICIKKNKEVFYVVYTVKKTAKNLILNLERFGNKAEYKKSK"
FT   gene            complement(21273..23567)
FT                   /locus_tag="Sterm_4169"
FT   CDS_pept        complement(21273..23567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4169"
FT                   /product="DNA topoisomerase type IA central domain protein"
FT                   /note="PFAM: DNA topoisomerase type IA central domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase type IA
FT                   zn finger domain protein; SMART: DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein; DNA topoisomerase I
FT                   ATP-binding; KEGG: cjj:CJJ81176_pTet0045 DNA topoisomerase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11001"
FT                   /db_xref="GOA:D1AS14"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS14"
FT                   /inference="protein motif:PFAM:PF01131"
FT                   /protein_id="ACZ11001.1"
FT                   /translation="MKLIIAEKRNVATAIATAIDGAQETKDGYVKKGDYYITWASGHLL
FT                   SLKEPEDYDPKFQKWNIPDLPFNFPNWELKPINAGSKKQLNIIKDLLKECSGVIHACDP
FT                   DDEGQLIGDEILLYHDYKKPVERMLINDNNTEYIRKLFTKLEDNRKYESLGISAAARRI
FT                   ADAIIGINLSRFYSCKSSKTLHVGRVKAPTLGLVVNRDYAIENHIKQLHYILRIIANNN
FT                   DKDNNITFTFQKNANTPVNEDKLIIDLDYIEKVQAEIADIKDYKVNVTSKILTKNPPLV
FT                   FNIDKLQAYCNNKFSYTAQEVLEITQVLQATHQIITYNRSDSQYLNEEHFQEAPQLIEI
FT                   IKENLNLSLDNIDTNRKSKVFDSSKVTAHHGIIPTHTRFDLSKLTEKERNVYQVIAEFY
FT                   LVQFMPPEKLKETTGIFKVKDYDFKTTDRTVQDLGYKKFLNSINEEKEEEEKSNISKFE
FT                   DRLYDFVNFATPIDTRETKPPKPYTEATLISDMTSIAKYIKNPEIKEILLRKDKDKEGA
FT                   KGSIGTPATRASTVEELINDGYLERKGKQIRATEKGKNFYNNVLPDEIKTADLTALWWV
FT                   IQEDIIAGTKTITDLTDSVFKSVIQAMETNKDIKIRHKDDVICPKCNDGFLKNIKTSKY
FT                   NFWACSEEKCGSTFNDNKGKPDFTEKRPAEKSEIPCPKDGGILYKIKGKYGDFWKCKTC
FT                   QQNYKDSNGKPDLSPKKEMKKSAQKCDCGEFLTEIPTKKDPNKIMLCCEKCNSKYFEQA
FT                   DESIKKWVIKK"
FT   gene            complement(23861..24139)
FT                   /locus_tag="Sterm_4170"
FT   CDS_pept        complement(23861..24139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11002"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11002.1"
FT                   /translation="MLDKKDDNLEYEIADFNSHYKGADSVETFIINYKTHMNNATFTII
FT                   LYLKEIIKSYPDIKSEEKTIISEIIRKEEKQLEREDNFLNKILCKYC"
FT   gene            24221..24928
FT                   /locus_tag="Sterm_4171"
FT   CDS_pept        24221..24928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4171"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11003"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11003.1"
FT                   /translation="MAYYAYSDFERKKIVLASSCTIIDKHKEFYCENPECNAKLKLKAL
FT                   NSNIVNKYFSTLKNFPHIENCYFKKITTNNFNEIDYNEDLFQFNEIIEEYLNNNIRNVN
FT                   RRLSTLSQIYYMCKSRDIFMKYNDFQVGKILCDTRSNHIYIKGIFGYRLIECKFYSYRD
FT                   QDKTLYFKYPLNDSLINTFLLKIVFQTEELYLNIKNTFCNFKGYPIVIAGQWYKNEKYF
FT                   STNVTNRNQFYAP"
FT   gene            complement(24936..25916)
FT                   /locus_tag="Sterm_4172"
FT   CDS_pept        complement(24936..25916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4172"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11004"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11004.1"
FT                   /translation="MNLKIEDIISYKKILETDNQFRCEFVNQIKDKYMFFKDKIYDVFY
FT                   FCNPDIEKKMRDLKQINADFTIKGEEFEIFSMSNCYGEIGKIGFLRTEILKDKDVYIKY
FT                   SHAINNEFHIKNNEIHLQIELPDIPYPEEIFFKNFILMRENTTDEEYQVCLELLKLVHK
FT                   DWNFLLDCISEKSLMPFYLEDSIENLSKYKTKQDVLEYILGKAFPYDLNSLKFDIGYEL
FT                   IQAVILFLEERYISKVYDFSKSIYNNYDIKEPRVFQFKGMFLLIEFLKNNIKIIDEELP
FT                   EDYLSMLYCLNKKMDFNIKTEKEMYDVTRKYEKIWSENNDKKNKL"
FT   gene            complement(26150..27589)
FT                   /locus_tag="Sterm_4173"
FT   CDS_pept        complement(26150..27589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11005"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="InterPro:IPR041486"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS18"
FT                   /inference="similar to AA sequence:KEGG:mma_2731"
FT                   /protein_id="ACZ11005.1"
FT                   /translation="MDRKILKFIDKYVKEINESNAAIFLGAGFSVDSGCINWKELLEDI
FT                   AEDLGLDIEKESDLISLAQYHKNTLGNRSQINQLILNSYGGKDISENHRILARLPISTF
FT                   WTTNYDSLIEDSLKEIKKIPDVKYTNAHLSQTEPKRDSIIYKMHGDRNHSNDTIILKED
FT                   YEEYHVKYAPFITALNGDLITKTFLFIGFSFSDPNLNYILSRMKVDYGNDTQKTHYALM
FT                   KKVAKEQNEDEGDFIYRETKQKLLIDDLRRYNIQVLEIDSYKTITNILRNIEKKINRNN
FT                   VFISGSAVDYGDFKEEKSVNFIENLSKQLIRKGYNIVSGFGLGVGSYVIKGALEEIYLK
FT                   SKTINDNRLLLRPFPQGIENEKSRVELWKKYRKDMISRVGISIFIFGNKIGENTEIIEA
FT                   SGVLEEFKIAHDNNNIIIPIGCTGGASKTIWNIINNDFESYFKNSSNKLKQLFQKFNHN
FT                   YEKEDELINDIINFIDITVKK"
FT   gene            complement(27610..28218)
FT                   /locus_tag="Sterm_4174"
FT   CDS_pept        complement(27610..28218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4174"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   apl:APL_1185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11006"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS19"
FT                   /inference="protein motif:PFAM:PF08937"
FT                   /protein_id="ACZ11006.1"
FT                   /translation="MARKTFISYKYSEACDLRDKILDSLGEDAKYYNGETSDSPDLTDK
FT                   KTETIKEILKDMIYGTSVLIVILSPKIKESEWIDWELEYSLKEIKREDRTSKSNGIVAV
FT                   VMKYNKSYDWFITNSENCHGTSTLKYDDSKLYSIISENHFNSIPPKYHCSECKTYEADL
FT                   GSYISYIKEDDFLLDPNKYIEKAYEKSNRLSDFKLKKQK"
FT   gene            complement(28488..28598)
FT                   /locus_tag="Sterm_4175"
FT   CDS_pept        complement(28488..28598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4175"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11007"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11007.1"
FT                   /translation="MTDRDYIELALRRVQKYKKGTIFSFENIFSNDEWKE"
FT   gene            complement(28620..29504)
FT                   /locus_tag="Sterm_4176"
FT   CDS_pept        complement(28620..29504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11008"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="InterPro:IPR038434"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11008.1"
FT                   /translation="MKKFFLLIFFLLILSCNKNSSYIETLKKVKFDKPIMLTDVSKTGW
FT                   FLKKDIYLEDIIYDTIAFATFEDFAHGNDKKYVDFEGNYNSEYYISDYLKILESIKNES
FT                   KWKIDKMTNDKWMATISYGDYIARIIFYTEGNFVSVDLNDLSVESLKSFYTYNYYEDFS
FT                   VEYKKLDRPSYIVGWYVIDEAKYKEKVKEKTKSETSKNEDASSDEETEINLEEIYNTKD
FT                   TSKLSKLNEIELKILQNYPFAKDGYVFETPELKEYFENQSWYEPSTTLSNNEISIKNKD
FT                   DEWFIYMKKYNNF"
FT   sig_peptide     complement(29439..29504)
FT                   /locus_tag="Sterm_4176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.454 at
FT                   residue 22"
FT   gene            complement(29848..30171)
FT                   /locus_tag="Sterm_4177"
FT   CDS_pept        complement(29848..30171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4177"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: gur:Gura_3378
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4177"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11009"
FT                   /db_xref="GOA:D1AS22"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS22"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ACZ11009.1"
FT                   /translation="MSYKKYDIILVNYDPSVGTEITKTRPSIVISSNIYNKLSNQVIVA
FT                   PITSVIRKWGTRIDIDTKNTKGQIALDQMRSISSTRIVKKLENLKDEDTKKRIEETVEI
FT                   IFE"
FT   gene            complement(30161..30403)
FT                   /locus_tag="Sterm_4178"
FT   CDS_pept        complement(30161..30403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4178"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: cak:Caul_0353
FT                   transcriptional regulator/antitoxin, MazE"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11010"
FT                   /db_xref="GOA:D1AS23"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS23"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ACZ11010.1"
FT                   /translation="MSNIIKIGNSYGTLISKKILDSLNIKLGDEIDFEIKDNGILIKKH
FT                   DKAAFREEFIKSFQDNGIINDEKDWEEWQGFDDEL"
FT   gene            complement(30905..31381)
FT                   /locus_tag="Sterm_4179"
FT   CDS_pept        complement(30905..31381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wbr:WGLp018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4179"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11011"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11011.1"
FT                   /translation="MEFKRNYGIEELPIILLCLFFSLKLEYYLLIILIILFLIVEFTYF
FT                   EIKESIRLENENIIIVKTFLFKKERYYFNYKDFEIKNIEFSKTSIDRFLGFDYYFSIKS
FT                   DNQEIKIFRLFLGNDEIFFNKNKQMFFLKNLEDKKKLGVIKDTSIIKTDINSTI"
FT   gene            complement(31949..32173)
FT                   /pseudo
FT                   /locus_tag="Sterm_4180"
FT   gene            complement(32174..39817)
FT                   /locus_tag="Sterm_4181"
FT   CDS_pept        complement(32174..39817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4181"
FT                   /product="adhesin HecA family"
FT                   /note="TIGRFAM: adhesin HecA family; PFAM: filamentous
FT                   haemagglutinin domain protein; Haemagluttinin
FT                   repeat-containing protein; KEGG: nme:NMB0493
FT                   hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11012"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS25"
FT                   /inference="protein motif:TFAM:TIGR01731"
FT                   /protein_id="ACZ11012.1"
FT                   /translation="MKKGKRYNIVKRNIALSILLGMFLNSMSFANSLIKTRDGSTARVI
FT                   TAPNGTPMIELANPGNSGVSVNDFDRLSVDEKNLILNNISSKEGIGYRSELGGIIAPNE
FT                   NYTGNPARAILLRVHKDPSVINGFIEAASTGKVDMFLSNPNGIYLNGGLVGRFGNVTFT
FT                   TGHVSDDLMTVMVRDGRIEIGAGFNGNAAENLSLLARSIQVNGQLNGNDLTLIGGQYDY
FT                   NTGTKETVKQGDNPGEVLVSASVVGSIYGRNIYLKAVGGDLAVKGSLVSEKVLKLNADG
FT                   TVVTERSQGLEEVEVKAKEFIQEGSTYTEGKLTIEANNTILKGTGTQAQEIEISGNLNN
FT                   ESNLYSKSNVTVGGDTKNKGQLISEGSLEIKGNLESDSLVYGKNSVKVGKDLTNKSDLQ
FT                   SENGIAVEGNVINTGKVISDKDLTIKGNVNNAGTLYGKDRVTIDKNLTNAGSVQTTGDL
FT                   TAKDTVNTGKLTAEGNVNVEDLDNNGEIITNKKLVTKNLENKSTGKITTGEGIDTAGNA
FT                   VNHGQINTNGNFVISSNLENYNIINVGGLVNTKDLANTGVLKVSDKIVSKGFSFSNTGE
FT                   IVTVNLDVDSTNIINTNKITVVETSKLKGSSNINNQGTIASKNIEITTPVLTNSGQILA
FT                   EEVITANNTSLTNTGKLASNGSINLNNTSIVNRSSIESTTINLQNIFSYDNNTGIIRGN
FT                   NITLTSSGNLLLEGKIQGINNLLISGFDITNNGNTISSGLLRLSGRDITNNLTISAGNV
FT                   ELLATGNILNNSMMEGESGKLSGNNITNKDLIIFLDKLDIEGTKLVNKDASVYSDNELN
FT                   IVAGDVDNTGGEIVGQSTLNITGFNLLDNTKGIIDSRGNILLSGNKLLNSGEVSGQYRL
FT                   YWITWDGQYIYDDVWRELDDAYAQTGNSSLITGLDDWKIGIAKSNINGGINREKEFTKI
FT                   KDSTDYDLYYGYMSGNLTASNATYETQVLKGYVDTSRLVTEGGRILSGGNLTLDVKEIE
FT                   NRNSKISSGGTLRITNKVEKIENVTDVATIKVYDGTERLSLWQTMWTNGSGNTVYGDAI
FT                   GVRRDLESTSRDYNIADSASVIEGNNVIIEGTPTINNGYDYSKIGTGIVIDPSTITSKD
FT                   VDVDLYYDPVTVHVDRTAVIDIITTGTIPFNPGVFTSSQSKLFAESKDPTSKYLMETRS
FT                   QYIDLSRFFGSDYFLSKIGYNESKDWNMARRLGDAYYETKYMNNLLLETLGTRFINGKA
FT                   DTELMKEMLDNAVATSGDLQLTIGVALTGDQIAALKSDIIWYVEQEVNGEKVLVPQVYL
FT                   SQATLENIKSPTTTISAQETLAINSSSLVNQGRLSGNTVYVNTDNLINKSVGALTAEIT
FT                   GTNIQIDAKNDILNIGAVISAKEDLMLTAGGTISNITTGVETVVNDRLRGEERNYTADS
FT                   VQNAGVISSGNITYISGENYVSRGAVTESGGTTYIEAKKDISINTINLRESEREGIKNG
FT                   YQYTEVNQKLGSEVTGLDNVIMNAGNDINIKGSTVASDGTVQLTAENNINISNDKNTMY
FT                   HEEKEEKKGTFSSYYRYETDYSESAVGSTLIGNNVILDAGKDVNIKASNVIAVKNDNIQ
FT                   NSGGNIIVTAGNDINITTDDMNNEYSLTEKRSGFSSSFSTGGGGISAGVSYSRSSLEVN
FT                   NTSTTVAVSSIMSEGNTVLEAGNRVRTEAMQADIGENLVIRGTNGVELLDAKEVYEEKV
FT                   KQKSTTIGVNVNVGFTPAQLASTISDVADNVKDYGFGNSSQSINTIGNGIQDLRNVTQL
FT                   GGNLYEGIRYGSQYLNGHMNMGVMENAKQNALSNLVSASVSASYNQSSYESNKNGTNSV
FT                   AGVINVGNNFIIQSEGDVKLVNQKVTVGDNFIVDAKNFVALAGENTYSNNTKSSSSGIN
FT                   AGYDIVNNHVIGGANISGGKSNTDSKYYDNTTINVGGTFQLTTKEDATFAGANVTADKI
FT                   NFDIGKDLNIISLQDEYKSNGSSYGVGVDVSGKMPGSNKEEGYAIPSLNGSYSQDSADS
FT                   KWVNNQTSIIAENGGSIKVGETLTNVGSIIGSLNPNEKLSIDANKVVVENLKDHDNGEN
FT                   SGIQLSGISKDTLIPQTGIQYGSHDKQQDSNATFVNTEVTEAGKKLDLDELGINTDINK
FT                   AQVITKDEVVEQIDTVLHTDLGNQKVRDQFVEDILKTVSLVPEIVQGIQEGTKNEGETI
FT                   LGQISNNMGERSDDIKAFVEGRDKKLQEQLDKYKNEDGKIVMDADAQKLIEDSLRQTLE
FT                   EFGKGDYKIEFFEGDPDQIMGVDDKNGIVYINVNGHGAGNAEEMRKNMQHDGSHGTYVN
FT                   KDVDEDSAKKVGQINGDRTESNLIADESIKDKIKEGTDAYNKAVENGDIRNLLDKVVDV
FT                   KNSKYFDAAQSTLDKVCSGRAECLGELYGFKEEDANKKNNENNLLIFTADLAETALIGG
FT                   LTAFIPGSFVIAGKTITVSKVISSGGSVAKIIYDAKDIIMDDNTRKELYKLTVAKIELE
FT                   RSRVAADIYSKEYHEFYELFSSNGTLYFSERQMKAYNAGRKIFGKSVLSEKEIKDRIWR
FT                   LNNYMSSGNPDYYLEPRSLERKVK"
FT   sig_peptide     complement(39725..39817)
FT                   /locus_tag="Sterm_4181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 31"
FT   gene            complement(39845..41623)
FT                   /locus_tag="Sterm_4182"
FT   CDS_pept        complement(39845..41623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4182"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; Hemolysin activator HlyB domain protein;
FT                   KEGG: ara:Arad_4755 hemolysin activator protein hec"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11013"
FT                   /db_xref="GOA:D1AS26"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS26"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ACZ11013.1"
FT                   /translation="MNKSIILAFFLLGSIVFSAGVGDIIERNNAAIENERRQQELERRQ
FT                   RELERENFGKEPQIIDGTDEVDTSVRFFIRKIEVQDEYNLLNKAEIKAVTKKYLNRKLS
FT                   SKDINKLMTDLNNKYIEKGYITTRVRLDETQNLSEGTIRLITLPGTVEGASLNENTFSD
FT                   RMKVFMSVPKNKKRILRLQDTEQATDQFNRVSSNNVEIKIAPGQEAGGSILQIENQQSR
FT                   TFSANISYNNYGDESTGRDRAKIDITKDNLLGINDSFYASYQRGRNKRPLRNDYTGSSS
FT                   IPPGTIIKDKDDLLPADTEAEPEKFNEDWSLNYSFPFRYWTFSTGYSHSYYISSSEGYN
FT                   GLYDTSGRSTQFNLNADRVVYRNKMSKISINGGLKLKTNQNYFEDVQLVDRRLTIGSLG
FT                   INYSRGFFGGILGFDVSYDRGLPWFRSADDHEKEIDDPKGRFDKYGVNINWYKPMTIGK
FT                   QRFTYRLVGVGQYTQDVLYGSEKISMGDEYTIRGYKGDSISGDKGYYVKNELSYNLNIS
FT                   KIGSISPYIGYDFGESWNNEVHDIYRYGYMRGFAVGVKYYGEIFNFDIAYTKPDKASGY
FT                   VSKPEDEVYVTFGIKF"
FT   sig_peptide     complement(41567..41623)
FT                   /locus_tag="Sterm_4182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.550 at
FT                   residue 19"
FT   gene            complement(41921..42592)
FT                   /locus_tag="Sterm_4183"
FT   CDS_pept        complement(41921..42592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmu:PM1543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11014"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11014.1"
FT                   /translation="MKKILLIIGLIGSLSFAGQNVIEIRGGYDLSSTTSFDKDIYSEYD
FT                   LDKFVENGFHFGVEYRREILTNFQIGAGLEYRKSDMDQPGNRRVYSENIDYSYDSDSLN
FT                   SIPVYITARYNFRNFTSITPYVKANLGYSINSGDTNVKLNNMYSGKLVEEYNSKMKDKI
FT                   YYGIGVGIEYKNFLVDLTYDITQSEAEEKIYNYEDKEGFNNDYDFDIKKLTLSFGYQFN
FT                   F"
FT   sig_peptide     complement(42539..42592)
FT                   /locus_tag="Sterm_4183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.926 at
FT                   residue 18"
FT   gene            complement(42908..43264)
FT                   /locus_tag="Sterm_4184"
FT   CDS_pept        complement(42908..43264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4184"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11015"
FT                   /db_xref="InterPro:IPR018689"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11015.1"
FT                   /translation="MEIKNENYGGFIVSKNIIYGKSIRYSFREKSSIPQLNGWNFYAID
FT                   EDEEYISNSDNFIILSAKSMYDINPIILALFHAPYGTDLCWLYENDIHVGFYDLKLERE
FT                   FSISEILNRINKKR"
FT   gene            complement(43248..43400)
FT                   /pseudo
FT                   /locus_tag="Sterm_4185"
FT   gene            complement(43426..43731)
FT                   /locus_tag="Sterm_4186"
FT   CDS_pept        complement(43426..43731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11016"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS29"
FT                   /inference="similar to AA sequence:KEGG:PFDG_01435"
FT                   /protein_id="ACZ11016.1"
FT                   /translation="MANSRDKYSDKDILNQLKDHCKRNGKITKKREKKYTIAELIGKYR
FT                   RLRKKEKYKNSEITMEDFCRETFINSKLIIDIFETWEDFCEMSTIIHWQKITIYNT"
FT   gene            44000..44248
FT                   /pseudo
FT                   /locus_tag="Sterm_4187"
FT   gene            complement(44488..45039)
FT                   /locus_tag="Sterm_4188"
FT   CDS_pept        complement(44488..45039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4188"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11017"
FT                   /db_xref="GOA:D1AS30"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11017.1"
FT                   /translation="MEDKQTLRRKGYVSVEKQKTTGRFWYKTKTFTLRLIGIILLFFIP
FT                   IGTIIGIILILITLKKDKTKLKYKIISVCPVCNGELYLSSDQNHGIVDQQCDECRTELK
FT                   INIDNGTISEKYKGKINLHQKEKMNYEVNKDVDLKDLRTLTDDYHDDEEKRKKLEQLER
FT                   EEILFQRKKEMAEIKSKTPK"
FT   gene            complement(45227..45331)
FT                   /pseudo
FT                   /locus_tag="Sterm_4189"
FT   gene            complement(45392..45964)
FT                   /locus_tag="Sterm_4190"
FT   CDS_pept        complement(45392..45964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4190"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: abu:Abu_0812
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4190"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11018"
FT                   /db_xref="GOA:D1AS31"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS31"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACZ11018.1"
FT                   /translation="MDKKDVIKITLELIKEKKLEKASIGEIVKRLELSPGNLYYHFKNK
FT                   SDIYKEAADYSAEEIIKNLNKVRKKENKRDYLYNLTKSLIKFLEEREEILCFLLSMKGT
FT                   CFLDKELESQDILIKFKKLLLEEKDSLEEENKILLKLSMFMGSIYEVLYINKLVKKKNL
FT                   NEEEIQEISESFWGNNMDRTQILGQRL"
FT   gene            complement(46054..52986)
FT                   /locus_tag="Sterm_4191"
FT   CDS_pept        complement(46054..52986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4191"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: cha:CHAB381_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4191"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11019"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS32"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACZ11019.1"
FT                   /translation="MKRNKKLLVSFLALNAILTSYAQAETVQSARYERMYNSIVKNMEK
FT                   GSSNEQTYQTIQRILNQKNKELKDLYLQGDYIVKPEYLEWQVFFTGFYEEYNEGVDNTK
FT                   ENAKYHSNPLYAQSGYYDANGDYIVTSYLKNGISGKPLTPDQVPKEVELGIRIPLKGTN
FT                   RQPLNLNIGTPQVPNIVTPTGVNITAPFVSIPTISVPVFTPVTVNVQPVTTNTITTKTF
FT                   VFGPSGNGDAQWITNNGSNGPLSQINLDGSQGMGTRGSMDVISRSTTNTNWNFDLHLAD
FT                   TDAKGVDKQAHVVTNYGIQNINFTNQTQRSAMKLVGGHDITISDMDINFVGSNSAAGNM
FT                   MLFHTDAHNNYNDNSSLYRSSSWILTSSTNVRMKGQNGLMFGVQYHGNVTDSGMVNNGH
FT                   IWADTDTSYIYNATTYTIDPRDRTIFYTIDDGRTPNRYLYFENNGIIDLDGPIDILGIY
FT                   DVNGAVNGGSYFLNSSTGNININGLGALGIVVNDIRTMGGSYINFVKPIELTGDNTVGA
FT                   VINNSSFSPSLSSININIGNTANKSATIGNALGNNVNLVEGAVGIFTDRATLTVTADNN
FT                   KASKNIGEHDVFFGNFANQSSLFRADGGTMTIMGIAEVDAGTSNLGMVATGTGTVTLAS
FT                   TGTLLISGGTDTIGNIITNSNNSGAYAQNNGNIINNGTIKSIGIGTNAIISGTSGIVTN
FT                   NGIIEKSNNGGAVILSGGSFTNTANGVIITKNGSAGVYSDITAAPVINGGVLLSSLSGV
FT                   PYSAYHADYGTKNTGIIADNGGIAYYSGVNTGVSTGNITVSGTNTTIMNGGLMFYNQYK
FT                   TGAALGTYGKFNIASGAGITVEDGGTVFNFDGTPSGAYFTYSATDFSDYITNTFTNISN
FT                   LNINMPTTAGEYGNLFVLNKTIFNLTTANTAIGSIAGLGLSINPGGNYRFGLVANGKLN
FT                   IDNDSSIGSVSNPYNLDNPLDSTNKVSVVSSEIEVTSGTYVKGTLAGQILAKMANPDNT
FT                   AAGQAKIAIVNNGNIDMSGTNSISFYSRYGIVTNNNIINSSNGAIGIYGTNNTQINNVG
FT                   TINLGNNSIGLAAKTQEGTLSIAGNNLINMTNSGNIISNGATAPIGMYAQNNSSLNRAD
FT                   ANITNSNTVDLRNSLNSIGAYISGGTFTNTGSMSVGTNGIAVLADMTDVNMSGGTINLT
FT                   GNKAVGFHLENGSNITGATGTVNVDGTDIVIFNIKGSSAPIPNGLTINPTAGSTYILAN
FT                   IDEGLFTTGAGTLTAGANSVLISGTKSGVMIGAGTVVTSTGTNSVALSADQVSTPPLIL
FT                   PYSVEAENQGTIALGDNSAAIYVSNGASGLNSANITVGDNSVGIFGKNGMGTIKNNGVI
FT                   TVGQSSQGLYAEGIAQVENTNMINGTMANSVGMYASGVTPMLNSGTIDLSGVDSIGMFS
FT                   VASPGSTAVIWNTGTGKIKIGNSTNPSNPAVGIYSENEDEVIINDGEIEVGSGSLGIYK
FT                   FGHPTLSGTIQQNGKITVGSGGVGIYSNGDLVTLSPTSQIMLQGNNEAVGVYGTNNSVI
FT                   TNTSSNLSIGSNNYGVVLETGAGFVNNAAINMGTNEVLVYSTGGGTITNNFPITMTGDE
FT                   NVAVYATNGEYVSNTSVIDATGKIGNIGIYNKNGYILSTGAGKIYVGNSNVPVPSNPSD
FT                   PSNKYAVGLYGEGAKIENHSDIEVGAGGIGIYIKDNNTATIAENYGHIILNGAGAIGLY
FT                   AENGIIINEGTIDVNGNDGIGMAGVTSTLINGNSGIINLNADNGIGIYGNTGGSIENKG
FT                   TINIGSGNNNIGIGKGSGTDIVSAGGLFGEGTVLGNTTINGNKVISSMGNSYPTPSIVN
FT                   SGVINVSEYFSNEGVVVAIKVDPSTIRPAAAGSADDGAKFVADSVQINAPYFSVSEENP
FT                   VQILASFTQGTNANVYKLKDVFNPTTPGGGPNSGTVHVISKSLTWRATPEVNSLGNIDI
FT                   WMEKIPYDDFTNGLWYEDFGLALDSKYGTDGISDKAIEIFNKIDMIETDQEPEFRRVMA
FT                   SLAGNVYANINQREDDIAKTFENSLHLLQDSTNNTKENVKISVIAGKGKNKEETDGATG
FT                   YDYTTTGVLALREVERTYKHTFGYSLGYVHTGFEFKDGNESEEWVDTIQLGVHNKYRSN
FT                   GWKIVNDLTGRASIHNVDRNIDWPSPNSRSEMNGTYETYSITSDNILGKEFGLGKKASI
FT                   MPYGAFRAMYVTRPTFNESGLEALEVEGNDAWSAKPRAGVELKGAIPLGAKTAWQLKGT
FT                   LDLAYEYELADLNEREKARLVAIEDGYHKLSKPEDEKGTFRTKAAIGVEVEDRYGIFLT
FT                   GEYSTGNDKENDYRAGVTLKAVF"
FT   sig_peptide     complement(52912..52986)
FT                   /locus_tag="Sterm_4191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 25"
FT   gene            complement(52999..53265)
FT                   /locus_tag="Sterm_4192"
FT   CDS_pept        complement(52999..53265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4192"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11020"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11020.1"
FT                   /translation="MKKTIILIFLTVMGTMLYSAPTYEYKRELREGARGKWTNLRKHLN
FT                   SGQRLEKELIKVDKQIDKKVSEIQEIEDLLFRIEQYKAANNIR"
FT   sig_peptide     complement(53206..53265)
FT                   /locus_tag="Sterm_4192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.968 at
FT                   residue 20"
FT   gene            complement(53282..53560)
FT                   /locus_tag="Sterm_4193"
FT   CDS_pept        complement(53282..53560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11021"
FT                   /db_xref="UniProtKB/TrEMBL:D1ANV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11021.1"
FT                   /translation="MKRIILIFSLLTLSLMAFGEEVKVDRSVEESITKDYDQDGVYSSY
FT                   EKALRRAQESVYVKLPEKRGYWYTILDRVKAEEEELMPEEINRMRRR"
FT   sig_peptide     complement(53501..53560)
FT                   /locus_tag="Sterm_4193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(53569..53778)
FT                   /locus_tag="Sterm_4194"
FT   CDS_pept        complement(53569..53778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sterm_4194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sterm_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ11022"
FT                   /db_xref="UniProtKB/TrEMBL:D1AS35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ11022.1"
FT                   /translation="MKKVIVILLVSMSIFTIAAKKNKQEIEVPNMEAQMEKADKIENYR
FT                   AKKDVAWHKTEYNKVLKYLNKSRK"
FT   sig_peptide     complement(53722..53778)
FT                   /locus_tag="Sterm_4194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.556 at
FT                   residue 19"
XX
SQ   Sequence 54160 BP; 16419 A; 9448 C; 5819 G; 22474 T; 0 other;
     tttttcagtt ttttattgta tatttatttg tatatgcaca tttttatgta agacaattat        60
     ttttttgttg tttactcaag atatttctct ttaaacactg atatcgcttt taattttaca       120
     gctattttct tatctttatg taatattagc atatttttat gatttctaat gatacatttt       180
     tcaatcagat ttttttactt tatatgataa tttttagctg aataaataaa tttataaaaa       240
     aaactactct tttttcaaaa gtagtttata taaaaatcta tatcttcaac caattcctat       300
     aaatagttaa ttcttcacca ttttcttttc tggatatttt atagtattta ttttttccaa       360
     tcctttttaa ataataagta atttcatcag aaaatatcaa ttcaaatttt tcagaattaa       420
     gattgaattc tatgtgattt aatctttctc tacataatag attataaaat attcttttca       480
     agttccacct ctttttccat tttataaaac attggtcttg aacatcctat ttctttacat       540
     gcttttgtta tactaatata atccggatta tccttatctc ttgtcaacct ataaatctct       600
     ttaaactttt cccggtattt ttcttcttta tttcttccta ggtgttgtcc tctggcttta       660
     gccctttcaa ttccttcttg ttgtcttttt ctaagttctc ttctctccca ttctgctctt       720
     aaaagatcta cttccaacat tgtatcaagc atggcattta acattgcttc tgctaatgag       780
     tctgctgttt tgtctactaa tttagtcttc aagaactcgt ttaaatattc ctgatctatt       840
     gattctacta tcactttttt atctgctagc tttaccagac attctctcac ttctttggca       900
     tttctaccta acctgtctaa gttttttact actattacat catttgatct tacacattca       960
     attaattcat cccaagcttc tctatcttca aaatttgctc ctgatctctt ttcttcaaag      1020
     atagttcttt tatttccacc aagttcctta aataattcta tttgtcttgc taaattctgt      1080
     tttgcagttg acactctggc ataataatat ttcataatat cctccattat tactttataa      1140
     aattattata ccttaagtaa tcaaaaatgt aaatatttat tctaaactat tttttacata      1200
     tttatataaa taagaaataa aggatttttt tacataaaaa tatacctctt ttacactgta      1260
     aaaaaaggta gactattatt tacattgcta tgttttttaa atctattatt aaaaaaactt      1320
     tctttttcta caagattatg ctatctttta agaatatcaa tttaaaagaa gggatttttt      1380
     atgactgaaa aagaaatttt aatagaaaaa ttttatcaat tacttaattc atcttcaact      1440
     tctgaaaatg atattcaaac atttttagaa acgaattctt cattaattcc attacctttt      1500
     atacttaacc atgctttaaa cggtaactct gtcatttcta aattaaatct tggtaatact      1560
     tatgtaacag attttgcata cctaactaaa agtactgtaa aatggcaatt agtgcttatt      1620
     gaattagaag aatcaaagaa aaaatttttt actaaagaaa atttattttc tgctgaattt      1680
     aacagagctt tggcacaaat tgatgattgg aaaatttatt gcgataaata caaagataga      1740
     attatgaagc aaactaatgc tcttaggaat ccattaaacg gtaatcctgt tgaaattttt      1800
     tatgttttga tatatggacg taatgaagaa taccaaaatg acgaatatcg aagtgcaaaa      1860
     attgctgaac ttgaaaaaaa tagtaattta agagtaatgt cttatgattc tcttgtttca      1920
     gaatttagat ataagacagc tcattatgaa gataaaaata aaataatttt atcgcctcgt      1980
     ggagatgaaa aattttcttt aaaatatcac tctaatgtct atggcagttt tttatttgat      2040
     cgtattgatc ctaactattt agaaatccct aaaaatttcc attctgaatt attaaatctt      2100
     gggtatgata taaagaaatg gctttgatta taaaaaaata ttaatttagt tttctctttt      2160
     caagctttgt ctgtattctt atgattcttt atatatgatt aaataaatca aggaataaaa      2220
     atggacattc tccttaaaca aggacatatt ttttaatgaa atcctaactg atattaacgt      2280
     ccgataatgt tgcttatgaa taaacaagaa aaaaattgac ctatttttta atcataatga      2340
     ctaaaattta ataggtcaat tttcgtgatt taagttaaac attacattaa atttcttgtt      2400
     ttgtatggaa tttttttcta tatttcattg taccatataa tttttttttg taaagattat      2460
     tttttcataa ttagttcatt gactttatca aattgttcta aatattcaat atatttatta      2520
     cttaacttct taaaatcatc gttagtactt aatatatctt cttcacattt aatgttatta      2580
     gctttttcta gtgaagcatc tcgaaaactt ataacctctg ttgctagatc aattaacttt      2640
     tgtatctcat ctgcatgctt tttatgtata gttttgtttt gaactagcaa cggtattaca      2700
     ctatccggtt tgtatcctcc tattgatgat tttaatacct ctattctaat ttcatttgct      2760
     ttttcttggt tcataatttc ctcctaattt gttttttttc gtaacttccg taattcattt      2820
     ttagccttgt ttaatatatt tccttccgcg gtgaaatata ttaaacacaa tatatgaaat      2880
     acttttaaaa ttactttatt atattaaacc ttaatctaaa aataagataa tttaatattc      2940
     aatgaaaaca tgaaaaataa ctaaatgctt tagtattttc tgatgtcttt attattatat      3000
     gaaaatatta tatcatatac tttaaaaaat gtcaagttaa attttatcaa taattaactt      3060
     gacatttcta attttatgtt ttttcatttc tttttggaaa tataaatata ctttaatttt      3120
     tttatattga ttttttgcaa taaaaaaggt atgatttgtc taacaacaat taacaagggg      3180
     taaagaaata tgaactataa ttattattat ttttttaaag gaattagaaa aattgagaag      3240
     atcaatgaat ggtttgaata cgtatttagt aaaaacccac gtatactttt agtacacaca      3300
     gcccctgtta cctttaatat tgacaacaca acttatacaa tcagatacaa ggaaaagtgg      3360
     gatttaattt attgtataaa acttcatggt gtaacttcat atatcgaaca ttcacattat      3420
     ttactaaaaa ttgaaaattt tttaaataaa ttaaaggaca caaaatatta agccccgtaa      3480
     ggggcttttt aagtttattt cattctctga tagtaaaatc tcttttgtct acgtaccaat      3540
     caatattaag ctctatataa tatgagggaa tttcttcaaa atctaatagt atactttcgt      3600
     agtgttccgc ccaacaaggg tgtaaatttt gatatcccat ttctatttct ttatcctgtc      3660
     tcaaaaattc ttctcttaaa aattctttta aagtctgatt tttggataac tttccaatta      3720
     cttcattatt taaataaact acatacataa attgccctcc cagactttta caaattttat      3780
     atcactatta aaatattcaa cattctttat ttttatatca agttgtataa atctttccgt      3840
     tattatatca gctactattt gaaaattact tatatcttct gcataaacaa catcatgatt      3900
     atacatttct gttatttttt tatctttaga aatgtattct ttatttttaa gtaatgttac      3960
     ataacttctg ccatgaatcc ctttgccgtc aggattttca taaatttcaa aagagttaag      4020
     agatatttct acctgatcgt cattttcaaa atttaatttg gcaatttttt gatatccgac      4080
     aaaattgctt attattggct catacccata tttatttttt tttgacataa tcaaaaattc      4140
     ttttctttct gcaaatctat cagaatttaa tgttatagaa ttttcaggta aaattttata      4200
     atcttttttt agtttcgccc attttggaaa tcgtacataa tagcctttat ttctcaattc      4260
     atttattctt tctatctctt ctttcaaaaa atcatttaat tcttcaatat tttttatttg      4320
     cccgattaat agattaccca aatataaaac tatcattttt ttatcactcc ttataatctc      4380
     ttaattttta tattttcttt tctgccaaca ccttttcaag ttttctaaat gcttcttctg      4440
     aagtctgaaa attctgtttt tctggcttat attctttcat tacatcaaac agtcttttat      4500
     aattcttctg aaaatcatct attactttat cctgaataat ccctcttaat ttttctattt      4560
     catttgataa atctttaaag ctttcttctc tctctatagt aaatgacttt aaatttttgt      4620
     aaattccgtc acctagatca attctttcaa tatcatattt tagcccgctg tactctattg      4680
     ctagtttcgt tttgtaatat ggcagatagt attcttcgga atcctgatcg tttatttccc      4740
     tttcttcgtg ataaatatta tcggcttcta ttaatttatt aagaaactca atcgcttctt      4800
     ttcccttaaa tataagattt tcctgtaaaa atctttcgct ccatttaaaa tacactttta      4860
     aagaatctat tctattatca gaattttcaa cttcacagtt tcctttttct aaatcctgaa      4920
     tagtttcatt taaaccatct ttagtcattt cagtggattt tatttttata tctgctatat      4980
     cgtatacaga tatatattca ttttgattgt ttttaaaaac tcccatatca agacccattg      5040
     acggaaactt ttctaattct tcatttgaaa gattcccctg aatttccttt gtctgctcat      5100
     aatcataata tttcaaatac atatattttc tcccaaaatc atatgtattt atcttgtcat      5160
     ttccgagtaa gtttttcatt aattctgtac taactcctat agtaatagcc tgtttttctt      5220
     tttccccctc tgttaacact ctacccatta tctcgtcttt tcttatttcc attttcatca      5280
     ctcccatata atatttttaa aaacaaaact aaatttctaa ggacactcac gaaccacaca      5340
     cattagcccg cattaccagt agaagccatt gagtacatgc aattgtccag agttcctcca      5400
     acaatttttt ttgttttttt tcataaacga atttttgcat acaagatttt caaggttttg      5460
     cgtagcaaac acggagtgct tgaccttgaa aacttgaatc ccgctgggat ttcgcagtat      5520
     gctataattt gagttgaaaa aaaagaaaaa agattaataa aaaaagaaaa gctgtttagc      5580
     ttctcttatc attcccggaa taataaaatt gttttttttc tacttgcatt gtcctaattt      5640
     gtgacagtgc aataaatttt tgtaaaaaat tttgtaataa aaaatttcat attaatttaa      5700
     gtttagtcca tgtgttctac tatttaaaac acgtttccac caaccttctc tcgttataat      5760
     tattttatca tcaattcggg cattatagtt ttctaaaata ctatattgaa aattttcttt      5820
     tatatagtta aatccttttt catttataat atcttttaaa agttcattcc ctccatgtcc      5880
     atttttaatg taagttgtcc atcttgttaa taacattccc tcgctttcag ttgctgaacc      5940
     aatataatgt tttccactct ctttatcagt aattagataa actgcttttt gatttttaag      6000
     agcatttatc caatctcttt tgtgctttgt tataattatt tttaactgat tatatgataa      6060
     actaacatta tcatagcctg gaaattcttc tccgtcatat atagtaggca atatttgaga      6120
     aacttctaaa tcttctatta tcattttaaa ttttctaact tgattttgat actttttgtg      6180
     atgttttact atgactcttc cataataagc actatacttt tctaattctt caccttcata      6240
     atttatacca ttttttttat tcaattcttt tgttacaagt ttgattgtag aaagaaccca      6300
     tgtatcttta cctaacttaa aaaaacaaat tgctatttca ccctcattaa aatacctttt      6360
     ttcttttctc caaaataacc atcccgtatt tatagcttca ggatttttta tatattcttc      6420
     cataggatta gtatcaccat tatgttgatt aaattttact tttacttttt ctatctgttc      6480
     actcgaaaag tttaacaaat cttttaacaa tatttttttc aaattatacc acccatatca      6540
     tatttccttt cttatataaa aataagttta agtgtcgcaa gttgcgacac caaaattata      6600
     atttttgttc aagactattt ttttctactt ctagctttgt tattttttct gttaacttta      6660
     ctatttcttt atcaattttt tttaatcttt tttctatttc ttccaggctt tcaattacta      6720
     tcacattacc gtcttctttt gtttccttat actcttttag cttttcttct acattttcag      6780
     attctaatat ttcaacaatc tcaattattt tctcgttctc atcctctttt tttaattcct      6840
     gaacttcttt ttttaaattt ttgacagtac tatgtggtaa ttcaaatacc tttgcctgct      6900
     ttgtttccaa aaaaagattc catttatcta taaatctata tgcggtatct tttgatatat      6960
     ttatatattc taaataagct ctaaatccac cttttttatt attaactaaa agttgttgaa      7020
     tttcatataa acttttagat aattctctag tattccgatc taattgtctc aaattatttc      7080
     ttatagagcc ttcttttctg ataatcttct cagcagtttc tttttctata ttataatcct      7140
     gaaaattaaa ataagtctgc tctttttctt cttctaatga tattactttt tctttttttt      7200
     cttctcgcat atcaaataca ctcattttta ccactctctt tctgcttctt cttccaaaaa      7260
     ttcatcagct aagtttctat aatctatcgc agcatttgac gaatttttgt aatttattat      7320
     atctaatcca ttattcatag catttactat attttgatca tctcttatat ttgattctgt      7380
     ataattatac tgtgatttat tagaaaaata attttcaaaa tcttctttcg cttccttata      7440
     ggcttttgtt ctttctttta cacatactaa gaaaattttt ctaatctcta attttttatt      7500
     tttctttttt gctatatcgt atgtgtctaa aagatcaata acacctttta aatcgacatt      7560
     tgaagctctg gaaggtgtaa aaatatagtc cgtacaattt aatatagctg aattaaaatc      7620
     attaacagtt ccctctgtat caaaaatcac ataatcgtaa tcctcgaata aatataataa      7680
     attttctata caactatata tcgcttggtt atcctttttt tctaacacaa aataactatt      7740
     taagtttata agttcttcag atgaaataat aatatccaat ccattttttt tagttatata      7800
     attatcaaaa tcagttacta tgacatcatt atattgcttt agtatgagtt taactaaatt      7860
     atgttcatta tttattttta aatgaacttg aattgaactt ctagggtcac tgtctattaa      7920
     taaaactttc ttccctcttt ttactaaagc atatgcaaaa gtaattgctg aaactgtctt      7980
     agcagctccc ccttttggat taacaaaact caaaattttc ataacatcac tccttgttat      8040
     ttgtcttttt ttatttttat ttctttcaat ataggattat atataatttc aatatttctg      8100
     ttttctccgc ttatttccat gtcttcgatt atatctaatg gaaatgacaa agaatattgc      8160
     cccccacgtt ttgagttagg ctgcctatat tgtaattttc ttttttttac tattattttt      8220
     ttttccattt atcctcctgt attaagtaag gaaaataaga tttgctttta ttctccttaa      8280
     agcgtataat aacaatagct gtagtgtttc atacacttca agaaagtatt acttgttaat      8340
     gctttctttt tttaccacct catttttctt ctatattata gtaacatttt atcatagtac      8400
     acgtacaaag tcaacgattt ctattaattt tattgtcttt acttcaagaa aaaactttta      8460
     ttttcttggt gtcgcaagct gcgacaccaa aactaaattt tgtattcagt ttctgaaaag      8520
     gtgcataaga ctgctgtcta cacacccttt ttatatatta tttctttgca aatttaagta      8580
     tataatcgct tgctttttca gcttctctta taacattaaa taatatactc ggtgtttctt      8640
     ttaataactc tatataatgt tttatatatg ccttatgatt ttcaaaatga ttcttattat      8700
     tacttatttc aattcctaat tccaattgta aaaacattga agaaatttca gcgattaatt      8760
     cctctttggc atactttttg tcaaattgcc ttttaggcat ttctctgttt aatctgctct      8820
     catgccctgt actatgtgcc atttcatgaa atattacagc ataaaaatcg tcttcagttt      8880
     taaagtattc ccggtttggc ataacaattt tatcttcata tctcgaataa taagcattat      8940
     gagtaaaagc ataatttatt ttcgcttctg aattatttat aagtttttcg gctaactcat      9000
     tatttctaaa aatttcatta attgatgtgt tttcaggtat attttcaatc tgttcagcat      9060
     taaatacatt aaaatatgat gctataggac tatttaattc ttctgttatt tctttttctt      9120
     ttccgttttc atctttgact ttttttgtta tatcccattt ccaaaattcc aaccttatgg      9180
     atttagcacc tttttttatt ttccactttt tagattcagc ctgcttgtat gttaaccaac      9240
     gattatcttt aaagcccatt ctttcagctg ccatatatag ctttattaaa ttaattcctc      9300
     tataagatac accattagtc ggatttatcg gcttggcagt taaccaccct ttctgccaaa      9360
     aagttttttc tccattttct aaatctttaa taattgtatc aactaactct tttctttctt      9420
     caaaaactct ttctctagct tttcccattt tgaccactcc cataaaatag tttttaaaac      9480
     aaaactaaat ctataaggac acataagaga caattacaca ttaactcgca ttaccagtag      9540
     aagccatttc atgcatacaa ttgttcagag ttcctacaca attttttttg ttttttttca      9600
     taaacgaatt tttgcataca agattttcaa ggttttgcgt agcaaacacg gagtgcttga      9660
     ccttgaaaac ttgaatcccg ctgggatttc gcagtatgct ataatttgag ttgaaaaaaa      9720
     agaaaaaaga tttataaaaa aaagagaagc ggtttagctt ctcttatcat tcccggaata      9780
     ataaaattgt ttttatctgc ttgcattgcc ctatttgttg cagtgcaata aatttacagc      9840
     ataaattttg tgataaaaat tcttaaacga tttaaaataa acttattata ttcaagattg      9900
     tatataatta taaatcttta taaatttcac cccgactccc aatattaata actaaaatta      9960
     ttaattggtc atctctctta gaaaataaag ccctaaattt cccaattcta agtctaaaaa     10020
     tattttcttt tgttttcaaa ttttttatat cataatattt aatattttcc aaatcttgag     10080
     aaatttcatc aaaagcttta aaaaatttca atccatcttt tttatttttc tcaataaatt     10140
     tttttgactt tttactataa attaccttta ataatttgct caatagtaag ttcgctcccc     10200
     tcattagggt ctaaatcagg ttcatcaatc caacttaata gttctttttc ttcttcatca     10260
     gaaacatatc cacaattttt tttaatgtat tccacaagac taatatcttc atattgatta     10320
     atatatatat tcattgcttt tcttataacc tctgaaaaag aaattttttc tctatgagct     10380
     atattattca atttttcata ttccgcttcg tctattgtta ttgattttct aatcacataa     10440
     atcaactcct ttttatatta tagtaatata gtattattat agcataataa tacctaaata     10500
     tcaaatacta gaaacataat tcttgtcagg aatgtgaaaa taactagttt tctttctttt     10560
     aagatgcttt atattagtgg cctaatactt ggttgtcact agtaaaaaaa ctctcttaat     10620
     cgtaaatttg aacctcgaaa gattgtataa attattcatt ataaaataaa aaattctcct     10680
     gatagattac cggagaaaat taaaaaaaaa ttacttattc aaaatttcta atatatcttt     10740
     cttatcaata taaattaaat cagattcttt tattccaaag ttatataaaa cattctatta     10800
     taaaatccta gaataggttc aataataaaa taaacctttg aaaatttagt tattcccaat     10860
     tcttgaatat tcttatcaat acctttataa taaccaaaag aacctctaac tgttgaattt     10920
     aaatctaaat tatcaattgg agagttaaga aataaactac aagtacctgt taactcttta     10980
     taacaagtgt aagaatctcc ttttaatctc caatcaattc taaaatcctc ttttaaagga     11040
     tcaaataata caagtatatt cataacacac ctttcttcat atcaaaaact gctaatttta     11100
     ccgggataat tttcagataa aacccgctat taatacttgt acaagacacc atttcagtag     11160
     cctttttttt cttaatttct ccaaaatcct ttaaattcat tgcttttgaa gcttattttt     11220
     ttgttctcct attttacttt ttaccgaata ttttttttta tttgaaactg gcaatttttc     11280
     ttttatttac ttatgttgac agtctctatt tttcaataaa atcttcaact ttggtggtaa     11340
     attttcaaaa aaacgcacct accccaataa taaaaaaata cgttcaaagt acttttaata     11400
     ccaacgcatt tttttcagtt tgcccctgat cgctcctatg agggaactcc ccctatttat     11460
     ttaaaatctc taataataat ttttctattt tatcaatttt aaaatgtaaa tattcaaact     11520
     gtttctcaaa ctcttggttt ttattgtggg attctaacat actttcaact aagattcttt     11580
     ttaaaagatc gtgattttca attatttttt ctgtatcatt ttctatattg gaaacacttt     11640
     ctctatgttt atgttcataa tattcatcta taatatcacc aataataccc ataattcctc     11700
     catattttta attcatttct ttataattac cgggataatt ttcagataaa acccgctatt     11760
     aatacttgta caagacaccg tctcagtacc cttttttcat ttccaaccca tttgaacctc     11820
     aatattaaca gtgattaatc catgttttta agtgtatcaa tccactttca ttttcttttt     11880
     tcttcagaca gcttttttat aatccacata attatggtgc taccccttta acagtgataa     11940
     ttaagagatc atcgtcttca ttatagtata agtaatactt ataattttca taaatataat     12000
     ttcttgtaat tatatttgtt gtcattttaa acataatatt aagccctgtt actaaattat     12060
     ctacatcatt aaaattaaca tttggttttg tcattcctaa aaataagcaa atatgatttc     12120
     tgaaatcatc aatttgtttt tttgtttcag gatatttaaa agtcatttgt agaagtaata     12180
     ctttttcagt ttttaactca tatgttatgt aataacatgt ttttttagcc acacaaaatt     12240
     cttctcttcc agtaccagat tttttgtata atcttgaagt tgttattgta gaatcattta     12300
     tcttataacg ttttaaaaaa gtttctaaat tattttttac agttgttaaa gtgatatcta     12360
     cctttcggct attttcaatt ttttcggctt gacttttttt taatttatct attacctgat     12420
     cttctatttt gtttttttta taagtataag ttgtcttttt tgttgtattt ctccctacac     12480
     atgatttcat catgccagtt ataatcagtg agatatataa gaaagaaaga cattttacac     12540
     atatttcaaa caatctatct actatattat taatttgttt gtatttatga atctgttttt     12600
     ttaatattaa agatattata aatagtattg ttataaatat aataataaaa aatattattt     12660
     ttagtaaaat tagaaatata ttcatactaa taatatctcc ttattttata gacttaattt     12720
     taatcattat tagtaaaatt aataaataaa actttttctt ttgggttatc taaaaataag     12780
     ttttgatttt tagcagccat actttcaatt cctttaataa aagtatactt tagtttcact     12840
     tcattaatct tatgattttt aaaaagaaat aatttatact ctgctttact ttcactttca     12900
     ataataagct cttgtaagct cttctcgata ccttgttttt tattcaatat attttgcacc     12960
     attatgtcag ttacaaccga tgtcctataa tacatatcat aattagttct tatttcatca     13020
     atgttaatat aaaaaataag cttattctct tctcctggta taataataat agacgaacta     13080
     tcatcaatat tttttccaga atagaaatta aaagctttaa atttattaat atcatcatat     13140
     ttaggcatat atggtccggc caaaattatg atattcataa tgataaaaag taaaaaaatt     13200
     gtttttttca tacgtcaact cccatagatt gtttaatgat atttatttaa aaccagatct     13260
     tatataaact tatttataaa ctcttttatt ttttcaatat cttcatcact taaaaggttt     13320
     gctatttcaa taattgtaga tttcttttta gtttttatag aaattttttc agaacgcccg     13380
     gcgggcgttt tgataatttt ttcaatttct ccaacttcta aaggtaaaac ttcatttata     13440
     attttagaag aattagaaaa attcttcttt ttcaacaagc tataaattgt atcagccttc     13500
     cgtatattga ttttgtccat aacttctaaa agttcttctg gatatttttc aactctaaga     13560
     tatctattga cagaacgctt agaaattcca taatcctctg caatatcttc gattttttta     13620
     tttttatgtc tgctttcttt ccatattttt aaagatagtt ctaaagttgt taaatcttcc     13680
     cgtaatgtat tttcatgtaa agatatagtg tctagcaatt catatggagc attcctaggg     13740
     ataataacta aattattacc gccaacaata ttatagtctt caatgttttc aaaaccccaa     13800
     aaaatagctg tacttcttct aaaaccactt aaaatcttgt agccttctac tttttcaatt     13860
     aagtatatag gatttattag acctatagtg cctatagatt ttgataattc atgaagtttt     13920
     tcatctttta ataaatcatc aaaaagaatt tctctgttaa taaactctct gtcagaaaaa     13980
     tcaatctttg ataatatttc tttatcaatt ttagttaatt tagcaccctc aagtttcatt     14040
     atttcctgtt tgatgagatc atcattatct aattttttca ttaaatcttt tgctttaccg     14100
     ctattgatat tatcaagagg atttctatta ctaaatatac ttttcttagc catttgtatt     14160
     taacccctct ctttctaaaa tttcaagagc taaaaattca taatcttttg ccccattact     14220
     gtgcggagcg aaagtgaaaa tatcctgtgc caatgcaggg gctttaccta aatcaacgtt     14280
     ctgtctaatt ttacttttca ttagagagct gccaaagtaa ttttctaact cattttgtgt     14340
     atctgaggat aaattcgatc ttatatcata ttgtgtgagt attattccgt taattttcag     14400
     actactatta agttcatctt ttaattgttc aattgtgtca attaacattc ctgcaccacg     14460
     aagttcaaaa tacccagctc taagaggaat ataaatactg tctgcagctg caagagcatt     14520
     aaaagttaaa acagataaag atggtgaagt atctatcaga cagatatcaa aatcatcttc     14580
     tacatctttt aaagattttt tcaaaagtgt ttctctgctc acctgactag caagatttaa     14640
     attagctgct tcactttcta agtttgaagg taataaatag aaatgatcat attgaggaag     14700
     ttttataaga aagtccttag attttctatt aactaaaaca tcataaattg tattatccag     14760
     agtgacagga tttattccta aagaatcagt tagatttccc tgtggatcca tgtcaactac     14820
     taagacttta aaaccatttt ttgcatagta tgaagctaga ttataaactg tagttgtctt     14880
     tgcaactcct cctttattat ttgctattgc aatttttctc atataatcct cctaaataat     14940
     ttcatattcc tgtaataaat aattttctgt ctgctctttg gttggcttaa cttttatgtt     15000
     catgttgttt gtttttttca tttgctctat aaccaggtta ttaaattctt ccaatgttat     15060
     tttctgttta tcagaagtta tttctgcagt atatttaagc ttgcttttac ttaaattttc     15120
     tgtcccggaa atttgaagtt gttcttgccc tgttttatgt gttaaaaata aatttttatt     15180
     atgacctttt tcaaaaaata tttcaaaata ggaattttca tattttttat ttttttcaaa     15240
     atgatatccg gaaatcaatt ttttttcttt taattcatca aaggccttta ttatactttt     15300
     tacactttta ttaatatttt cttttttcca ggataatggt attcttgaag caagaaaaga     15360
     agagtatctt tttatatata atgctttatt tctccatttt gtaatcattg tatataacga     15420
     tcgagctata tcgtattcga tcagctgcag atcagccgca ttaaaatata aaaacccttt     15480
     acttataata ttatcaaaga ttttttcatc aaatgtaact tctataagtt cttttatttt     15540
     atgatgataa aaatattcag ataaattatt actgaccttt atagcttctt caaaggtaac     15600
     agtatcaata gaaagcattt tagtttttat ttcccgattt aaaatgttag catttggatt     15660
     ataataaaaa caattgttaa aagtgtaact tgttgttgct aatctattta gactctcttt     15720
     aactgctttt agggttcgcc cattgtattt tattcctgat ttttccatta ataatttgta     15780
     ataaaagtaa actttcctat tatatttttg atctcgtaat agtgacatta gtccatgaaa     15840
     aattctctca tcaaattcat gaggaatttt agagtttaaa gcaggtataa cttcaataaa     15900
     ttgatttttt ttatcattaa aaatatattt tatcccagta ttgatatcta tttttttatt     15960
     tttggtaaat aaaggatatt caatagtatt catttcaatt cttataatat ttttagtttc     16020
     ttccatatca agaagttttt cggtttcata attttcttct tctatcctaa tttcactaat     16080
     tggttttata agttcagttt tcacttttac ctccatagtg tcggtgtaag ttatttttaa     16140
     ttaataataa cctgtagcga catttttgtc aactagattt tttaagggag tttttgttcg     16200
     tatatagttt aaagaatatt gatctttatt agtatgcatg ctgaaaagca ataatttaaa     16260
     tactttaata ctattatctt aacttcattg aacatataaa ataacttcaa tacacatata     16320
     aaataactta gatgaacata tagaaataac ctcaatacac atatttagtg aaaaaaggaa     16380
     ataataaaaa aataacttca ttgaacatat aagaatgaca agaaaattgc tgttatattg     16440
     tttagcatat tattttacta gtagagtgtt tttttaataa caataaattt ctaaaatcat     16500
     agttaatagt actaataact tgaaatatag gtaatataaa actgaaaggt gatactaatc     16560
     cgaaagatag aaatttgact aaataaaaaa tacagaacag caattattgt tctgtattta     16620
     ggggttactt ataaataccg cctctgctat ctatattaat aactaatata atgagttcat     16680
     cattttgaat tgtaaatata gcccggtatt ttccaattct taatctaaaa aaatcagaat     16740
     tccctttaag cttaacgata tcataaattt gaaaactacc tttgatgtcc tttgaaattt     16800
     cctcaaaagc tgataaaaat ctttcagctg actttttgtt ggctaaaatc catttttcag     16860
     cctttttttg gtaatatacc tcgtagttca tctgtgctta tcttccttcc cctatcacct     16920
     gggtcaaaat ctttaatgat ctcaagaata tcattttctt cttctaaagt agcaaaatca     16980
     caattctcaa gtaaaaattc ttttaattca agattttcct gcatttttat atattctttg     17040
     gcagcatatc tcaagaattc tgagaatgtt tttccaactt tttttgtata tctttcaatc     17100
     atttcaaaat ctttctcagg gatagttata tttttagtaa tacttactcc ctgatttttc     17160
     atagttaatt cctcccaaaa ttattttaca tacatagtat atactataat catatttaag     17220
     tcaagctttt tattatgatc taaaaagtag tttttttgtt cactcaaata ctaaaatatt     17280
     atatttgaca aaaaaatata tatagtatat attgtatatc atgatttata atttggaggt     17340
     ttttatggca agcttaagga aattaatttc aataaaagaa gatgaatata acaaaataaa     17400
     taattatgca caaaaagaaa gaattacttt ttcagagttt gtaagaaagg cagctaattt     17460
     ctatatcgat aagcaagaag aaatagaatt aggtcagtat ttaaaagaaa attgtgattc     17520
     tgtttctaaa gaggagcaag cagatataga aaattggata aaagagttaa aaaatcatac     17580
     tgattatgat tttaatgagg ggagtgaaat aactcttgaa aaaatcatac aaggtaatct     17640
     atagtaaaca ggttaaagga attttttcag aagaaaaatt tttagcattg aattttttta     17700
     aagcttttga tgaaattaca aaggatttta caaatatttc atatcataat ataaaatata     17760
     tccgggataa ttattatgtt ttaaaaatta ataattacaa tgcattattt caggttttaa     17820
     aaaataaaaa tttggttttt gttattggtc ttaaggaatc aaaaaattaa tatatatatt     17880
     tataatattt tataatactt tatatgctct tgggaaaggc ttatcgttat tgattttcag     17940
     aagatataag gtgacactaa tccgaaaatg aaaataacta agcttatata gtgttttcaa     18000
     gtcttctgat aataaataag tattataggt gctattttag gcgtaaaaat gaaaggtgtc     18060
     ataaatccga gaaaatggaa aggagtacta atggctttag ttccactgaa taatgatgat     18120
     ttaaaagaat atgcagtttt acataatgac attgtagata aatactcttt caaagattta     18180
     actgaaagag aagagaacat tctcattgtt ctgttatcaa aacttcaaaa gcaagaagca     18240
     tttagcaaaa taagtttaaa agaaataaaa aatatgatag ataaaagcat gacttataaa     18300
     acactgtcgg aagaaatact aaaattaggc aacaaaagat tatttttaat tgcagaaaaa     18360
     gagataaaag acaataaagg aaatgtaata agtaagaaaa atgatctatg gcgacctgtt     18420
     attttttcta cagtcataat ccatgatgat gaaaaaaatg taagtgttcg ttttaacccg     18480
     gatatagaat atcttttttg gcagatgaaa gaagaatttg agaaagtaaa tcctcatcac     18540
     tatttgaaaa taaagagtca aaattggaaa gcattctaca gactatgcaa aaggtgggaa     18600
     aattacccta gccgagttga aattacagtg gagaatttga aaagaatact tatgtatggt     18660
     gaggaaatgg aatataagac cttgaaaaga cggctaaatg ctgttaaaaa ttaatgaagt     18720
     tacaagcctg cacgtagaat ttgaagaaaa ataaattcat tgattttttc aattaaaagc     18780
     ttaaaagatc aaataagaga aagtatacct aatagtgatt tagagaataa atatttacag     18840
     atgtcgaaaa agtttaccaa agtctaaaaa tccgggtaaa ttacaaattg aatgtattag     18900
     gaggaataat gagtttattt gaagatttat tttttgatga tgcttatcta gcacagaaat     18960
     tttcaagaaa agtattaaaa cattctgatg agttaaaaaa tgacaatgaa ataataaaaa     19020
     aaattctaat tgaaaatatg ttagattctt taaaaaatgc agaagaaata aaaaatgaaa     19080
     tcaaaattct aaatgataaa atttcaggaa tggaaaaatt actattagaa attttggaaa     19140
     gtaaaaaata aatggtaaaa tgaaaaaatt ttttaaaagg ggttttgtca aaaaagagag     19200
     aaagccccta aagaattgtt aaatatatgg ttttttaact cataacgtcc gataataaat     19260
     tgttaaatta aaaaacttgc ggtaatatct attcttttgc ttttagagct tttttacccc     19320
     ttgtccaaag aaagttgttg cttgagtcaa aaaaaactct ttaaatcgaa aatttgaagc     19380
     tttgattatc atgaaaaaac agtattcata aaaaagaaaa atatgacggg aattttaaga     19440
     atttaatttt ataattcata gtaatttata tagaatgaat tataaaattt acctgcaagt     19500
     caccagggaa atctaaaaaa taaataattt tattatttgg cattttcctt tgctgcttct     19560
     ctttaaggat aaataccccg ctattaatac ttgtacaaga agacatttcg agagtatttt     19620
     tatatgtttt atactcacaa actattaaaa acattagctt taagttgtta ttttttgctt     19680
     tccatataag ctttttttct attagagctt agcgtacaaa atttccgaaa tgttggcggt     19740
     atccctatta aaatttattt tatattcaag aggaatttct ctatccaaat aattatactg     19800
     ttctaacaga aattctaaaa ttatctgcta ttttctttct cgtaagattt tgaatataat     19860
     aactatctaa tatcaaataa gtgttatctt ctttgctcta ctctctaata gttattttct     19920
     ttattttata tttgcaaaga aaaggttgac aagaatcgga aaatttgtga ttttctttga     19980
     atgaggggtt agagggaagc ctagttatcc tcctgcgttt taacagaaga atattttgac     20040
     gttttcccgt catttcgggg aatcggtcgc aagtcttaaa cttttttctg cttctttgcc     20100
     cacagaatcg ctttttcagc ttcgtttaag tcctcccccg cagttaaatt atgtattatc     20160
     taatcgcagg caacaaagaa ccttaaaccc tatttctagg gtttataacc acttattttt     20220
     ttacgttgct agccacaacc ccctctgatt acgtcgttta tatgccactt acggtaggat     20280
     tccgccgact tatttatttt tacaaccgcc tgtatgtctg ctagtttcgg caaggctgtt     20340
     gtccatgatg taggatattc agttttatat taatatagtt aatctgttgt tatagttgta     20400
     acagtattgt cttttataag aattgagaac tcccccctgc atattttgct aggtctcaat     20460
     tccattataa ttttttctgt ttcttcatct acaatctttt tttcgatttc tttaatatca     20520
     attcctaaaa ctctttctat atatcttatt acagcatgtt ctgaaataat tacactttcc     20580
     tgtgcatttg ctattttagc ttttactccc tctaattttt ttcttttaat ttctaaattt     20640
     ttatctattt ctttcttctt tccttttata tcctcaattt cactgactaa ctctttttct     20700
     cttctaagta atgtttttat actctcgttt ttcattgaac cctccgatct atgatttttt     20760
     aattttattt tatacaaaaa gtattaatca gtttttttct taattttttt atcaaataaa     20820
     tcgaaaaaat aaagtcaata tttatagtat ttagaacaaa tttgagattt tttcctggaa     20880
     gaggaaattt tttcctgaag gatttttttc tttaatctta ttttatataa aaatcatttt     20940
     acaggactaa gaaaatataa aatctctcag tcctgatctt attaattttc acttactctt     21000
     tttatattct gctttatttc caaacctttc aagattcaaa atcagatttt tagcagtttt     21060
     tttcacagta taaactacat aaaacacttc tttgttcttt tttatgcata tttctgctat     21120
     cattgaacaa tcataagatg taccataatt gtttatgtct atttcaagta ttatttttat     21180
     agctgtataa atatctgatt ttctctcttt aaaatctgat aattcgcctg taaattgtgg     21240
     agatttaata aattttactt tcatattctc ccctattttt ttattaccca tttttttata     21300
     ctttcatctg cttgttcaaa atatttacta ttacattttt cacagcaaag cattatttta     21360
     tttgggtctt tttttgttgg tatttctgtt aagaattctc cgcaatcaca tttttgagct     21420
     gattttttca tttccttttt aggagataaa tcaggcttac cattactatc cttgtaattc     21480
     tgttgacatg ttttgcattt ccaaaaatct ccatatttcc ccttaatttt atataatata     21540
     ccaccatctt ttggacaagg gatttctgat ttttctgcag gtcttttttc agtaaaatca     21600
     ggttttcctt tattatcatt gaaagtagaa ccacactttt cttctgaaca agcccaaaaa     21660
     ttatactttg atgtttttat attttttaaa aatccgtcat tgcatttagg gcagatcaca     21720
     tcatctttat gtcttatttt tatatctttg tttgtttcca tagcttgaat aaccgactta     21780
     aatacactat ctgttaaatc tgtaattgtt tttgttcctg cgattatatc ttcctggatt     21840
     acccaccata aagctgttaa atctgctgtt tttatttcat caggcaagac attattataa     21900
     aaatttttac ctttttctgt tgcccttatc tgctttcctt ttctttctaa atatccgtcg     21960
     ttaatcaatt cttcaacggt gcttgctctt gttgcaggcg ttccgatact tccttttgct     22020
     ccctctttgt ccttatcttt ccttaacaga atctctttaa tttcagggtt ttttatatat     22080
     ttagcaatac ttgtcatatc tgatattaaa gtagcttctg tgtaaggttt tggtggtttt     22140
     gtttctcttg tatctatcgg tgtagcaaaa tttacaaagt catagagtct gtcttcaaat     22200
     ttagatatat tacttttttc ttcctcttct ttttcttcat ttatactatt aagaaacttt     22260
     ttatatccta aatcctgtac agttctatct gtagtcttaa aatcataatc tttaacttta     22320
     aatattcctg ttgtttcttt aagtttttcc ggcggcataa attgcactaa ataaaattct     22380
     gctataacct gatatacatt tctttctttt tctgttaatt ttgacagatc aaatcttgta     22440
     tgtgttggta ttattccatg atgtgctgtt acttttgagc tgtcaaatac ttttgatttt     22500
     ctgtttgtat caatattatc aagtgataaa tttaaatttt cttttataat ctcaattaat     22560
     tgaggtgctt cctgaaaatg ttcctcattc aaatactgac tatctgatct gttatatgta     22620
     attatttgat gtgtcgcttg caagacctgt gttatttcca aaacttcctg ggctgtataa     22680
     gaaaatttat tgttacagta tgcctgcagc ttatcaatat tgaatactaa aggcggattt     22740
     ttagttaata tctttgatgt aacattaact ttataatctt ttatgtcagc tatctctgcc     22800
     tgtacttttt caatataatc taaatcaatg ataagtttat cttcattgac aggtgtatta     22860
     gcattttttt ggaaagtaaa agtaatgtta ttatccttat cattattatt tgctattatt     22920
     ctaagaatat aatgtaattg ttttatatgg ttttctattg cataatctct attaactacc     22980
     agaccaagcg taggggcttt taccctccct acatgcagag tttttgagga cttacaacta     23040
     taaaatcttg ataagtttat cccgataatt gcgtctgcta ttcttcgtgc tgcagcactt     23100
     attcccaagc tttcatattt cctgttatct tctaatttag taaataattt tcttatatat     23160
     tcagtattat tatcatttat cagcattctt tctacaggct ttttatagtc atggtataat     23220
     aaaatttcat ctccgatcaa ctgaccctca tcatcaggat cacaggcatg aataacacca     23280
     gaacattctt tcagaagatc ttttataata ttcaattgtt tcttagaacc tgcatttata     23340
     ggtttcaatt cccaattagg aaaattgaaa ggtaagtccg ggatattcca tttttgaaat     23400
     tttgggtcat aatcttccgg ctcttttaaa cttaacaaat gccccgaagc ccatgttata     23460
     taataatctc ctttttttac ataaccgtct tttgtttcct gagctccatc tattgcagta     23520
     gcaattgccg ttgcaacatt acgcttttct gctattatta atttcatatt ttctcctttt     23580
     agctttaata aaatacatca aattcaaaat tatatttttt caatattata ttttttaact     23640
     gatctgataa ttttgaattt tcaatgaact tcttttggtc tttgaaaaaa tttattttat     23700
     ttttatattt ttcactatgt tctttcatat ctgatatatg tattttttcc tctaataaat     23760
     aatagtaatc agggaaaagt tccatattat tactatattc ttgatagttt ttttgctttt     23820
     ttatatttag tttttctata attttcacat tctctatttt tcagcaatat ttgcataaaa     23880
     ttttatttag aaaattgtct tcccgctcta actgtttttc ttcttttctg ataatttcag     23940
     atattattgt tttttcttct gattttatat caggataact ttttattatt tcttttaaat     24000
     ataatataat tgtaaaggtc gcattattca tatgtgtttt ataatttata ataaatgttt     24060
     ctactgaatc agccccctta taatggctgt taaagtctgc aatctcatat tctagattgt     24120
     catctttttt atctaacatt ctttctcctt ttatattttt atagaaaaaa ttttaatttt     24180
     agattatact atttatatat tatttttagg tggtgtttat atggcttatt atgcttattc     24240
     agattttgaa agaaaaaaaa ttgttttggc aagttcctgt actatcattg ataaacataa     24300
     agagttttat tgtgaaaatc ctgaatgtaa tgccaaacta aaactaaaag ctttaaattc     24360
     caatattgta aataaatatt tttctacttt aaaaaatttt cctcatattg aaaattgcta     24420
     ttttaaaaaa ataactacta ataattttaa tgaaatcgac tataatgaag acttatttca     24480
     attcaatgaa attattgaag aatatctcaa taataatatt cgtaatgtaa accgaaggct     24540
     ttcaacccta tctcaaattt attatatgtg taaaagtaga gatatattta tgaaatataa     24600
     cgatttccaa gttggaaaaa tactttgtga cactcgttct aatcatatat acattaaagg     24660
     aatttttggt tatcgtctca ttgaatgtaa attttattct tatagagacc aggataaaac     24720
     actttacttt aaatatcctt taaatgattc ccttattaac acatttttat taaaaatagt     24780
     atttcaaacc gaagaacttt atttaaatat taaaaatact ttctgtaatt ttaaaggata     24840
     tcctatagtt atagccggtc aatggtataa aaatgaaaaa tatttttcaa ctaacgtcac     24900
     aaatagaaat caattttatg ctccttaaca agtttttata acttgttttt tttatcatta     24960
     ttttcactcc atattttttc gtactttcta gttacatcat acatttcctt ttccgttttt     25020
     atattaaaat ccattttttt atttaaacaa tacagcatag ataaataatc ttctggcagt     25080
     tcttcatcta ttatttttat attatttttt aagaactcaa ttaataaaaa cattccttta     25140
     aattggaaaa ctctgggttc ttttatatca taattattat aaatactttt tgaaaagtca     25200
     taaactttgc taatatacct ttcttctaaa aataagatta cagcctggat aagttcatac     25260
     cctatatcaa attttaaact gtttaaatca tacggaaaag cctttcctaa aatatattca     25320
     agtacatctt gttttgtttt atattttgat agattttcta tactatcttc taaataaaat     25380
     ggcataagag acttttcgct tatacaatct aataaaaaat tccaatcttt atgaactaat     25440
     tttaaaagct ctaaacacac ttgatattcc tcatctgttg tattttctct cattagtata     25500
     aaatttttga aaaatatttc ttccggataa ggtatgtcag gaagttctat ttgtaagtga     25560
     atttcattgt tttttatatg aaattcatta ttaattgcat gactatattt aatatagaca     25620
     tctttatctt ttagtatttc tgtccttaga aaccctatct ttcctatctc tccataacaa     25680
     ttagacattg aaaaaatttc aaattcttca cccttaatag taaaatcagc atttatttgt     25740
     ttcaaatccc gcattttctt ttctatatca ggattacaga aataaaaaac atcatagatt     25800
     ttatctttaa aaaacatata tttatctttg atttgattaa caaattcaca cctaaattga     25860
     ttatctgttt ccaatatttt tttatatgat ataatatctt ctatttttaa attcatttaa     25920
     actccttgat ttttatttca ttttaatcgg aaaatctttt aaataaaatt ttttctgatt     25980
     gaccgtagga ttttagtaca gaacatatat aaccttaatt tagttacgtc catttagagt     26040
     atactctatt ggtactcaat taaacaaaaa aatataccac ttctttaagc ctttttgtgg     26100
     tatatttttt caatattatc tttttttata atttatttat acttactcct tattttttaa     26160
     cagttatatc aataaaatta ataatgtcgt tgattagttc atcttctttt tcataattat     26220
     gattaaattt ttgaaataat tgttttaact tattagaaga gtttttgaaa taactttcaa     26280
     aatcattatt tattatattc caaatagttt tagaagctcc accagtacat cctattggaa     26340
     ttataatatt attattgtca tgggctattt tgaattcttc cagaactcca gaagcttcaa     26400
     ttatttcagt attttctcct attttatttc caaaaataaa tattgatatt ccaactcttg     26460
     atatcatatc ttttctatat tttttccata attcaaccct acttttttca ttttctattc     26520
     cttgaggaaa tggtctcaat aataacctat tgtcattaat agttttactt tttaaataga     26580
     tttcctctaa tgcacctttt atgacataac ttccgacacc taatccaaat ccagaaacaa     26640
     tattgtaacc ttttcttatt aattgtttgg ataaattttc aataaaattt acagattttt     26700
     cttctttaaa atcaccataa tcaacagcac tgccagaaat gaaaacattg tttcgattta     26760
     tttttttttc aatatttctt aatatattag ttatcgtttt ataactatct atttctaaaa     26820
     cttgtatatt gtatcttctt aaatcgtcaa ttaataattt ctgttttgtt tctctataaa     26880
     taaaatctcc ctcatcttca ttttgttctt tggctacttt tttcataagt gcataatgag     26940
     ttttttgagt atcattccca tagtctactt tcattcgact taaaatataa tttaagtttg     27000
     gatcagaaaa gctgaagcca ataaataaaa aagtttttgt tatcaaatca ccatttaatg     27060
     ccgtaatgaa aggagcatat ttaacatggt attcttcata atcttctttt aaaataatcg     27120
     tgtcatttga atgatttcta tcgccatgca ttttataaat aatggaatct cttttaggtt     27180
     ctgtttgcga taaatgggca ttagtatatt taacatcagg aattttttta atttctttta     27240
     aagaatcttc aattaaggaa tcataattag tagtccaaaa tgtagagatg ggtaatcttg     27300
     ctaatattct atgattttca ctaatatctt ttccaccata agaatttaat attagttgat     27360
     tgatttgtga tctatttcca agtgtatttt tatgatactg tgctaaggaa attaaatcac     27420
     tttctttttc aatatctaat cctaagtcct cagcaatatc ttctaataac tctttccaat     27480
     taatacagcc agaatcaact gaaaaaccag ctcctaaaaa aatagcggca ttactttcat     27540
     tgatttcttt tacatattta tcaataaatt ttaatatttt tctatccata aattcctcat     27600
     tcaactattt tatttttgtt tttttaattt aaaatcgctt aatctattac ttttttcata     27660
     agctttttca atatatttat tggggtcaag taagaagtca tcttctttta tgtagcttat     27720
     ataagaacct aaatcagctt cataagtttt acattctgag caatgatact taggtggaat     27780
     tgagttaaaa tggttttctg atattattga atataatttt gagtcatcat attttagggt     27840
     actagtccca tgacaatttt cgctattagt tataaaccaa tcatagcttt tattatattt     27900
     catcacaact gcaacaattc cattgctttt tgatgttcga tcttctcttt taatttcttt     27960
     aagagaatat tctaattccc aatctatcca ttcactttct tttattttag gagataatat     28020
     aacaattaat accgaagttc catatatcat atcctttaaa atttctttaa ttgtttctgt     28080
     ctttttatct gttaagtcag gtgaatcact tgtttcgcca ttgtaatatt tagcatcttc     28140
     acccaatgaa tctaatatct tatctcttaa atcacaagct tcggagtatt tatatgagat     28200
     aaaagttttt cttgccatat tttccactta tccttcctta tattttagta ataaatcata     28260
     caataaaatt ttaaattaat aaatagttat ttttgaaaaa atactttatt gtaaatgtac     28320
     gcatagtttt tttgacattc acatgagttt tattattaaa aagaactttt ataatttttc     28380
     atataatcta acactatttt tatgacttga aactacaaaa ttatctaatc gttttgcaat     28440
     ttctcttgca tgttctgcaa attttaaaga tgcttgccca tgttttttta ttccttccat     28500
     tcatcattgg aaaaaatatt ttcaaagcta aatatagtac cttttttata cttctgaact     28560
     cttcttaaag ctagttcaat ataatcgcgg tctgtcataa atcctccttt ataaaaaaat     28620
     taaaagttat tatatttttt catatatata aaccactcat catctttatt ttttattgat     28680
     atttcattat tactcaaagt tgtactaggt tcataccaag actgattttc aaaatattct     28740
     tttaattctg gagtttcaaa aacataccca tctttagcaa aaggataatt ttgtaaaatt     28800
     tttaactcta tttcattaag tttagataat ttagaagtat ctttagtatt ataaatttcc     28860
     tctaaattaa tttcagtctc ttcatcagag cttgcatctt cgttttttga agtttcactt     28920
     ttagtttttt cttttacctt ttctttatat ttagcttcat caataacata ccatccaaca     28980
     atataagatg gtctatcaag ttttttatat tcaacagaaa aatcttcata gtaattgtat     29040
     gtgtaaaaag attttaaaga ttcaactgat aaatcattta aatcaacact aacaaaattt     29100
     ccttctgtgt aaaaaattat tctagcgata taatcaccat aagaaatagt tgccatccat     29160
     ttgtcatttg tcattttatc aattttccat ttggattcgt tttttatact ttcgagtatt     29220
     tttaaataat cagaaatgta atactcagaa ttataattac cttcaaaatc aacatatttc     29280
     ttatcatttc catgtgcaaa atcttcaaaa gtagcaaaag cgatagtatc ataaataata     29340
     tcttctaaat agatatcttt tttcaaaaac caaccagttt tacttacatc tgtaagcata     29400
     attggtttat caaatttaac tttttttaaa gtttcaatat aacttgaatt cttgttacaa     29460
     gataagatta ataaaaagaa aattagtaaa aaaaattttt tcatgaaaac ctcctaaata     29520
     ttatatgtat attccccaaa ggggtgagga atgtcttaat gcaatacttt agttataacc     29580
     atatataata tgattactac aaggagtctt gtcataacat tcctccaatc atataaagta     29640
     taggcttgcg aaagcctatt taattataat aaaaagccga acctaagtcc agcttttttc     29700
     gcaatttata cttttatgat tgtttttcaa atatattata tcatatctct cagaaaattc     29760
     aagtttttta atccagtgta atattacatt gtttaatcct tatttccctg gatctttata     29820
     tcccaaaaac ggtttttctt cctaaattta ttcaaaaatt atttctactg tttcttctat     29880
     tctttttttt gtatcttcat cctttaaatt ttctaatttt ttcactatcc tggttgaact     29940
     tatacttctc atctgatcca aggctatctg tcctttagtg tttttagtat ctatatctat     30000
     tctcgtcccc cattttctta taacacttgt gattggtgcc actattacct gatttgacaa     30060
     tttattatat atatttgaac ttatcactat acttggtctt gttttcgtta tctccgtccc     30120
     tactgaaggg tcgtagttta ccaaaataat atcgtatttt ttataactca tcatcaaatc     30180
     cctgccattc ttcccaatct ttttcatcat ttattattcc attatcctgg aaacttttta     30240
     tgaactcttc tctaaaagct gctttatcat gtttttttat taagattcca ttatccttaa     30300
     tttcaaaatc aatttcatct cctaatttta tattcaaact atctaaaatc tttttcgata     30360
     tcaaagtccc ataagagttt cctattttta ttatatttga cattttctca cctctttagt     30420
     tataacatgt tattacttaa ttatacttaa aaaattaaat aatgtcaact cttataaaaa     30480
     aatatttcag caatccatta ccagactccc tctgaggtaa ttttgagccc gtagagtgtt     30540
     ttttctgaaa aagactatct gatccttgtc tctgaaattt gaagagctta aaatgactct     30600
     gagaaaaaag gaaaggataa catcaaaatg acattatccc cattaacctt caaattaaaa     30660
     aatgatgttg ttactaaaac attactttta atttcttttt tcattcaatc tttttatctg     30720
     ctaactcttc acatagatgt tctgcttcta gaaaaaatta tatatttggt gacttttttt     30780
     ggaaaaaatg gagctacccc ttctatttcc atcatttcct tttctacttt aatcttatta     30840
     ttccagcatt tcttgctaaa ataaaactta aaatcaatta ttttgttagt atctgttaca     30900
     aatttcaaat cgtagaatta atatctgttt ttattatgga ggtatcctta ataactccta     30960
     attttttttt atcttctaaa ttttttaaaa aaaacatttg tttattttta ttaaaaaaaa     31020
     tttcatcatt tcctaaaaac agcctgaaaa tttttatttc ttggttatca gacttaatac     31080
     taaaataata atcaaatcct aaaaatctat ctattgaagt tttagaaaat tctatatttt     31140
     ttatttcaaa atctttataa ttgaaataat atctttcttt tttaaataaa aatgtcttca     31200
     ctataattat attttcattt tccaatctta tgctttcttt tatttcaaaa taagtaaatt     31260
     ctacaattaa aaataaaata attagtataa ttagaagata atattctaat tttagagaaa     31320
     aaaataaaca taatagaata ataggtaatt cttcaatacc ataatttctt ttaaattcca     31380
     taactctcct taatcaatat tagtatggtt tcttatatcc atgacctatc cctagctttt     31440
     ttaattcatt ataagcttgt ggttgtaaag tcttattata atgtgggtga gaccccattt     31500
     atgagtaagg atatacatta actccatcct aggtattaaa tttttaatgt tcttaagcta     31560
     taacgtccga taataaagtg ttgaattttt atttcaattt atcctggata atctcactca     31620
     atttatttcc tgaatctaat cgccagactc tttctgaggt catcctgagc ccgtagagtg     31680
     ttttttatgt aaaagactat ctctttccct atctttgaaa cttgaagggc ttaaaacgaa     31740
     gctgaggaaa aagataagga taacatcaaa atgacattat cctcacctat cttcagttac     31800
     tcattttaaa taatcgaatc tctgttgaag atttgatctg taaaaactaa aatataatat     31860
     tataattttt tataataaaa taaaaaatta taatgaacga aatggagtaa aatataaaat     31920
     agatgatatt atttaatttt cttagaaaca acatttcaaa catacaaaat aatagataaa     31980
     atgcatatat aaatatatat ggtatcaaat atatatattt aatacttttg tatacgatat     32040
     ttccaatgaa tctaactctt atattcatta ttattggtaa aaacgcaata aattgaataa     32100
     ataaataaaa atataaatta tttactagct tcgatacttt attaaaaata attttgattt     32160
     tagtcgtttt catttatttg actttccttt ctaagctcct cggctcaaga taataatccg     32220
     gatttccaga gctcatataa ttattcaatc tccatatcct atcttttatc tctttttcac     32280
     ttaatacaga ttttccaaaa atttttcttc ctgcattgta tgctttcatt tgtctttcag     32340
     aaaaataaag tgttccatta cttgaaaata actcataaaa ttcatgatac tctttagagt     32400
     aaatatctgc tgctacacga cttctttcca gttcaatctt agctactgtc aatttataga     32460
     gttcctttct agtgttatca tccattataa tatctttggc atcataaata atttttgcta     32520
     cagatccacc tgatgatatt actttcgata ctgttatagt ttttcctgct attacaaatg     32580
     atccaggaat aaatgctgtc aaaccaccta ttaaagctgt ctcagctaaa tcagcagtaa     32640
     aaataagaag attattttca ttattctttt tatttgcatc ttcttcttta aatccgtata     32700
     attcaccaag acattctgct cttccactgc aaactttatc taaagttgat tgtgctgcat     32760
     caaaatattt actattttta acatcaacaa ccttatctaa caaatttcta atatctccat     32820
     tttcaacagc cttattataa gcatctgttc cttctttaat tttatctttt atactctcat     32880
     cagcaattaa atttgattcc gttctatctc cattaatctg tcctactttc tttgctgaat     32940
     cttcgtctac atctttatta acataagtcc catgagatcc atcatgttgc atattctttc     33000
     tcatttcttc agcattacct gctccatgac catttacatt aatataaact ataccatttt     33060
     tatcatctac tcccattatt tgatcaggat caccttcaaa aaattctatt ttatagtcac     33120
     ccttcccaaa ttcttctaag gtttgacgta aactatcttc aatcagtttt tgagcatctg     33180
     catccattac aattttccca tcttcatttt tatacttatc taactgctct tgtagcttct     33240
     tatctcttcc ttcaacaaaa gcctttatat catctgatct ctcacccata ttatttgata     33300
     tttgacctag tattgtctct ccttcattct tagttccttc ttgaatcccc tgcactattt     33360
     ctggaactaa tgatactgtt tttaatatat cctccacaaa ctgatctctt accttttgat     33420
     tccctaaatc tgtgtgtagt actgtatcga tctgctctac aacttcatct tttgttatta     33480
     cctgagcctt atttatatct gtatttattc ccagttcatc caaatcaagt ttttttcctg     33540
     cttctgttac ttcagtattt acaaatgttg cattactatc ctgctgttta tcatgacttc     33600
     catattgtat tcctgtttgt ggtattaagg tatctttact tattccactt aactggattc     33660
     cagaattttc tccattatca tggtctttta aattttctac taccacttta tttgcatcaa     33720
     tactcaattt ttcatttgga tttaaacttc ctattattga tcctacgtta gttaaagttt     33780
     caccaacctt tatgcttcca ccattttctg ctattattga tgtctggtta ttcacccatt     33840
     tagaatctgc actatcctga ctataacttc catttaatga tggtattgca tatccttctt     33900
     ccttattact tcctggcatt ttccctgaaa catctacacc tacgccatag ctacttccat     33960
     ttgatttata ttcatcctgc aaagatatta tattcaaatc cttacctata tcaaaattaa     34020
     ttttatcagc tgttacatta gctccagcaa aagttgcatc ctctttagtt gtaagctgga     34080
     atgttcctcc tacatttatt gttgtgttat cataatactt agaatctgta tttgattttc     34140
     caccagagat attcgctcca cctattacat gattattaac tatatcataa cctgcattta     34200
     ttccactaga acttgatttt gtattattac tatatgtatt ttctccagct agtgctacaa     34260
     aattcttagc atctactata aaattatctc ctactgtcac tttttgattt actaatttta     34320
     catctccttc tgattgtatt ataaagttat ttcctacgtt aatgactcct gccactgaat     34380
     ttgttccgtt tttatttgat tcatagctac tttgattata actcgcactt acacttgctg     34440
     atactaaatt actcaatgca ttttgtttag cattttccat aactcccatg ttcatatgac     34500
     cgtttaaata ttggctgcca tatcttattc cttcatataa atttccacct aattgggtta     34560
     catttcttaa gtcctgtatc ccatttccta ttgtatttat actttgcgaa ctatttccaa     34620
     atccatagtc ttttacatta tctgctacat cacttattgt acttgccagt tgagcaggag     34680
     taaatcctac atttacattc actcctatag ttgtactctt ctgttttact ttttcctcat     34740
     atacttcttt ggcatccaga agttctactc cgtttgtccc ccttattaca aggttttctc     34800
     caatatcagc ctgcattgct tctgttctta ctctgtttcc tgcttctaat actgtatttc     34860
     cttctgacat tatacttgat actgccactg tggtgctggt gttgtttact tcaagactac     34920
     ttctgctgta actcactcct gctgatatac caccgcctcc tgttgaaaag cttgaactaa     34980
     atccacttct cttttctgtc agagaatatt cattattcat gtcatctgtt gttatattta     35040
     tatcatttcc cgctgttact attatatttc caccactgtt ttgaatattg tcatttttta     35100
     ctgctataac atttgatgct tttatattta catctttccc tgcatccagt attacattat     35160
     tccctattaa tgtacttccc actgcacttt cactgtaatc cgtctcatat ctgtaataac     35220
     ttgaaaatgt tcctttcttc tcttcctttt cctcatgata cattgtattc ttatcatttg     35280
     atatatttat gttattttct gctgttaact gtactgttcc gtctgatgct accgtacttc     35340
     cctttatatt tatatcattt ccggcattca ttataacatt gtcaagacct gttacctccg     35400
     aacctaattt ctgatttact tctgtatatt gataaccgtt ctttattcct tctctttctg     35460
     attctctcag atttattgta tttattgata tatctttctt tgcttctata tatgttgttc     35520
     cacctgattc tgttactgct cctcttgata catagttttc tccactgata tatgttatat     35580
     ttcctgagct tattactcct gcattctgaa cactatctgc tgtataattt ctttcttccc     35640
     ctcttaatct gtcatttact actgtttcta caccagttgt tatattgctt atcgttcccc     35700
     ctgctgttaa cattaagtct tctttcgctg atattactgc ccctatattc aatatatcat     35760
     tttttgcatc tatctgtata tttgttcctg ttatctctgc tgttaatgct cctacactct     35820
     tatttatcag attatctgta tttacatata ctgtatttcc tgataatctt ccctgattta     35880
     caagactgct gctgtttatt gcaagtgttt cctgtgctga tattgttgtt gtaggactct     35940
     ttatattctc caatgttgcc tgacttaaat atacctgtgg taccaatacc ttttcaccat     36000
     ttacttcctg ttccacatac cagattatat cactcttcaa tgctgctatc tgatctcctg     36060
     ttaaagctac tcctattgtt agctgtaaat ctccgcttgt tgccactgca ttatcaagca     36120
     tttccttcat taactctgta tctgcttttc catttatgaa tcttgtacct aatgtctcta     36180
     ataaaagatt attcatatac tttgtttcat aatatgcatc ccctaatctt cttgccatat     36240
     tccagtcttt tgattcgttg tatcctattt tacttaagaa atagtcactt ccaaaaaatc     36300
     ttgataaatc tatgtactgt gatcttgttt ccattaaata cttggatgtc gggtctttac     36360
     tttctgcaaa taatttactc tgtgaacttg taaatactcc cggattaaat ggtattgttc     36420
     ctgttgttat tatatctatt actgctgttc tgtctacatg tactgttaca ggatcataat     36480
     ataaatctac atctacatct tttgatgtta ttgtacttgg atctattaca attcctgttc     36540
     ctattttact gtaatcataa ccattgttta ttgtcggtgt tccttctatt attacattat     36600
     ttccttctat tactgatgca ctgtctgcta tgttatagtc tcttgatgta ctttcaagat     36660
     ctcttcttac tcctattgca tcaccatata ctgtatttcc acttccgttt gtccacattg     36720
     tctgccataa tgataatctt tcagttccgt catatacttt tattgtcgct acatctgtta     36780
     cattctctat tttttctact ttatttgtta ttcttaatgt cccgcctgaa cttatttttg     36840
     aatttctatt ttctatttct tttacatcaa gtgtcagatt tcctcctgat aatattcttc     36900
     cgccttctgt cacaagtctg cttgtatcta cataaccttt taatacctgt gtttcatatg     36960
     ttgcatttga agctgtaagg tttcctgaca tatatccata atataaatca taatctgttg     37020
     aatcttttat ttttgtaaat tctttttccc tgtttattcc accatttata ttagactttg     37080
     ctatccctat tttccaatca tccagtcctg ttatcaaact actgtttcct gtctgggcat     37140
     atgcatcatc aagctctctc catacatcat cataaatata ctgtccgtcc caagttatcc     37200
     agtataatct atattgtccc gatacttctc cgctgtttaa aagcttattc ccgcttaaca     37260
     gtatatttcc tctgctgtct attattccct tcgtattatc aagtaaatta aagcctgtta     37320
     tattcagtgt actctgtcct actatttctc caccagtatt atccacatct cctgccacaa     37380
     tattcagctc attatcacta tatactgacg catctttatt tacaagcttt gttccttcta     37440
     tatcaagttt atcaagaaat attatcaaat ccttgtttgt tatattattt cctgataact     37500
     ttccactttc tccttccatc atggaattat tcagtatatt tcctgttgcc agtaattcca     37560
     cattacctgc tgatattgtt aagttattcg ttatatctct tccagataat cttaataacc     37620
     ctgagcttat tgtatttcca ttgtttgtta tatcaaatcc tgatattaac aagttattta     37680
     ttccctgtat tttaccttca agaagtaaat tccctgaaga tgttaatgtt atgttatttc     37740
     ctcttattat cccagtatta ttatcataag aaaatatatt ttgtaaattt attgttgttg     37800
     attctattga acttctattt actattgatg tattatttaa gtttatactg ccatttgatg     37860
     ccagctttcc tgtatttgtt aaacttgtat tattagctgt tatcacttct tctgctaata     37920
     tctgaccgct atttgttaat actggtgttg ttatctctat attttttgaa gctattgttc     37980
     cttgattatt tatattgctg cttcctttta attttgatgt ctctactact gttatcttat     38040
     ttgtatttat gatatttgta ctatccacat ctaaatttac tgttactatt tctccagtgt     38100
     tactaaaact aaagcctttt gacactattt tatctgatac ttttaatact cctgtatttg     38160
     ctaagtcttt tgtatttact aatcctccta cattaattat attgtagttt tcaagattag     38220
     aagatatcac aaaattacca tttgtattta tttgtccatg gttcactgca tttcctgctg     38280
     tatctattcc ttctcctgtt gttatctttc ctgtactttt attttcaagg ttttttgtaa     38340
     caagtttttt atttgttatt atttccccat tattatctaa atcctctaca ttgacattac     38400
     cttctgcagt taacttccct gtattgacag tatctttagc tgttaaatct cctgttgttt     38460
     gaacacttcc tgcatttgtt agatttttat ctattgtaac tctgtctttt ccataaagtg     38520
     ttcccgcatt atttacattt ccttttatag ttaaatcctt atcagatata acttttccgg     38580
     tatttattac attaccctct acagcaatcc cgttctcgct ttgtaaatcc gatttattag     38640
     ttaagtcttt ccctactttt acagaattct ttccgtatac taatgaatct gattctagat     38700
     taccttttat ttctaagctt ccttctgata ttagctgtcc tttattttta gtatctccgc     38760
     ctacagtcac attgctcttt gaataaagat tactctcatt atttaaattt ccacttattt     38820
     ctatttcctg tgcttgtgtt cctgttcctt ttaatattgt attatttgct tctattgtta     38880
     attttccctc agtatatgtt gaaccttcct gaataaattc ttttgccttt acctcgactt     38940
     cctctaagcc ttggcttctc tcagtcacaa ctgtaccgtc agcattcaat ttcaaaactt     39000
     tttcacttac caatgatcct tttaccgcta aatccccacc tacagccttt aagtaaatgt     39060
     tacgaccata aatacttcct actactgagg ctgatactaa tacctctcct ggattatccc     39120
     cctgttttac tgtttctttt gttcctgtgt tataatcata ctgtccacct attaatgtta     39180
     aatcatttcc attcaattgt ccatttacct gaatacttct tgctagcaga cttaaatttt     39240
     ctgctgcatt tccattgaaa ccagcaccta tctctatcct accatccctt accataactg     39300
     tcattaaatc atcacttaca tgacctgttg tgaaggttac atttccaaat ctccctacca     39360
     aaccgccatt taagtatatt ccattgggat tacttagaaa catatctact tttcccgtac     39420
     ttgctgcttc tataaaaccg tttattactg acggatcttt atgtactctt aacaaaattg     39480
     ctcttgcagg atttcctgtg taattttcat ttggagctat tattcctcca agttcacttc     39540
     tatatccaat tccttctttg gatgagatat tatttaatat caggtttttc tcatctacac     39600
     ttagtctgtc aaaatcattt actgacacac ctgaatttcc cggattcgcc agttcaatca     39660
     ttggggttcc attcggtgct gttattactc ttgctgttga gccatctctt gtttttatta     39720
     atgaatttgc aaaactcatg ctattcaaaa acatacccaa taatatactt agcgctatat     39780
     tcctttttac aatgttatat cttttccctt tcttcatttt tcctcccatt tatctattat     39840
     ttttttaaaa ttttattcca aatgtcacat atacctcatc ttcaggcttg cttacatatc     39900
     ctgatgcctt atcaggcttc gtatatgcta tatcaaaatt aaatatttcc ccgtaatact     39960
     ttactcctac tgcaaatccc ctcatatatc catatctgta tatatcatgc acctcattat     40020
     tccagctctc tccaaaatca tagcctatat acggcgatat acttcctatc ttggatatat     40080
     ttaagttata tgacagctca ttttttacat aatatccttt atctcctgat atggaatctc     40140
     ctttatatcc tcttattgta tattcatctc ccatacttat cttttcactt ccataaagca     40200
     catcctgtgt atattgtcct actcctacca gtctatatgt aaatctttgc tttcctattg     40260
     tcatcggctt ataccagttt atattaactc catacttgtc aaatcttccc tttggatcat     40320
     cgatttcttt ttcatgatca tctgctgatc tgaaccacgg cagtcctctg tcatatgaaa     40380
     catcaaatcc cagtattcct ccaaagaagc ctctgctgta atttattcca agacttccta     40440
     ttgtcagtct cctgtctaca agctggacat cttcaaagta attctggttt gtctttagct     40500
     ttagtcctcc gtttatactt atcttactca ttttatttct gtataccact ctgtctgcat     40560
     tcagattaaa ctgggttgat ctcccgcttg tatcatacag tccgttatat ccttcactgc     40620
     tgcttatata gtaggaatga ctgtagcctg tactgaatgt ccagtatctg aacggaaatg     40680
     aatagttcaa tgaccagtcc tcattgaact tttccggttc cgcttctgta tctgctggaa     40740
     gaagatcatc cttatccttg attatcgttc ccggcggtat tgatgacgag cctgtataat     40800
     catttctcaa gggtctctta ttcctccctc tctgatatga agcataaaaa ctgtcattta     40860
     ttcccaaaag attatccttc gtaatatcta tctttgctct gtctcttcct gttgattcat     40920
     ctccatagtt attatatgag atatttgcac tgaatgtcct gctctgctgg ttttctatct     40980
     gtagtataga gcctcctgct tcctgtcctg gtgctatttt tatctctaca ttattacttg     41040
     ataccctgtt aaactgatct gttgcctgtt ctgtatcctg taatcttaat attctcttct     41100
     tattctttgg aactgacata aataccttca tcctgtcaga gaaggtattt tcattcaggc     41160
     tcgctccctc tactgttccg ggcagagtta tcagtcttat cgttccctca cttaggtttt     41220
     gtgtttcgtc aagccttacc cttgttgtta tatatccctt ttctatatat ttattattaa     41280
     gatctgtcat aagtttgttt atatccttgg agctcagctt tctgttcaga tatttcttcg     41340
     ttacggcttt tatctcagct ttattcagaa gattatattc atcctgcact tctatctttc     41400
     tgataaagaa ccttacactt gtatcgacct catcagtacc atctattatt tgaggttctt     41460
     ttccaaaatt ttcacgttct aactcccttt gtcttctctc taattcctgc tgtcttcttt     41520
     cattttctat cgcagcatta tttctttcta ttatatctcc cactcctgct gaaaatacaa     41580
     tgcttcctaa taaaaaaaat gctaatatta tacttttatt catttctctc cttaaaaaaa     41640
     taaagcaaaa aataaatgag atatccagta attgtaatta gtttatttaa ctatgtacca     41700
     ttaatatttc ttttatttgt tgctttttat attttatata tttctttttt taaactttga     41760
     tttaccttag tttactcatt atacattaaa atatctctta ttgtcaattt atttttactt     41820
     ttttgagaat ctgtatctaa tctttttata ataaaaaaga tagtccgttt tataggaact     41880
     atctaaatta catgttaact atatgttatt ataaagggtc ttaaaaatta aactgataac     41940
     caaatgataa agtcagcttt tttatatcaa aatcatagtc attgttaaaa ccttctttat     42000
     cctcataatt atatattttt tcttctgctt ctgattgtgt aatatcataa gtaagatcta     42060
     ctaaaaaatt cttatactct attcctacac ctattccata atatatttta tctttcattt     42120
     ttgaattata ttcttctacc aattttcctg aatacatatt atttaattta acatttgtat     42180
     cccctgaatt tattgagtat cctaagttag ctttcacata tggtgttata gatgtaaaat     42240
     ttctgaaatt gtatcttgct gtaatatata caggaatgct gtttaaacta tctgaatcat     42300
     aactgtaatc aatattttca gaatatactc ttctgtttcc tggctgatcc atatcacttt     42360
     ttctatactc taatcctgca cctatttgaa agttagttag tatttccctt ctgtattcaa     42420
     caccaaaatg aaacccattt tctacaaatt tgtccaagtc atattcagaa taaatatctt     42480
     tatcaaaact cgtagtactt gacaaatcat atcctcctct tatttcaatt acattctgtc     42540
     ccgcaaatga taatgaacct attaaaccaa taataagcaa tatctttttc atgttccctc     42600
     ctcatattat aaaaaattta gtaacaaagt attaatatca catattatat acaattgtca     42660
     atttttttaa ttaggcgaaa taactatatt tttctttttc tatgaaagac ataccttaaa     42720
     tcccgctttt aaaaatagag ggggaggtaa aagggatcac ccttaatttt tagtaaaaat     42780
     cagtttaaag gactctattt aagaacttta aagttcccta gagcattttt cacacgagag     42840
     aaaccttgtc cttcctctct taattttaaa caactcaaag gaaaaagaaa acatcaaatt     42900
     aatgatgcta tcttttttta tttattcgat ttaatatttc agaaatagaa aattcccttt     42960
     caagtttaag gtcataaaaa ccaacatgaa tatcattttc atacaaccaa cataaatctg     43020
     ttccataggg agcatgaaaa agtgctaaaa ttattggatt aatatcatac attgattttg     43080
     cacttaaaat tataaaattg tcactgttac ttatatattc ttcgtcttca tcaattgcat     43140
     agaaattcca accatttaat tgaggaatag aacttttttc cctaaaagaa tatctaatag     43200
     atttcccata aattatattt ttagaaacaa taaaaccacc ataattttca ttttttattt     43260
     ccatcttcaa actcctttat aattttcaaa gcatcatttc tccatgataa ttttttcata     43320
     taatcaatac atgttttccc gaaactatct ttcatgttat aatttactcc actttttaat     43380
     aaacatttat aaacctgttt taattcaatt gtttataccc tgttttcaag tattatatat     43440
     cgttattttc tgccaatgta taatggttga catttcacaa aaatcttccc aagtttcaaa     43500
     aatatctatt attaattttg aatttataaa tgtttctcta caaaaatctt ccattgttat     43560
     ttcactattt ttatattttt ctttttttct caatcttcta tacttaccta ttaattctgc     43620
     tattgtatat tttttttctc ttttctttgt tatctttcca tttcttttac aatgatcctt     43680
     caattgattc aatatatctt tatcactata tttatcccta gaattagcca tatcatcctc     43740
     ctagttttat attacataac ttaacacaat tttccttttt attcaaactt ataaataaaa     43800
     aactacttca gcattgaagt agcactcatt ttaatttata tttttaacca atttctataa     43860
     atatccaaat actaaaaaaa aaactgtcta aatttttgtt gccattccaa aatgaaaaaa     43920
     tatgcttaga agtattataa atactagtat atttttacag cttacatcta gtaacaccaa     43980
     tactggtact acccctaata aatacgattt ggtaatattg gataaactgg actatatatc     44040
     atttgataaa gaagggagta aaatactttt taatttacta tcggataaaa atgaaaatgg     44100
     ttcaatagta ataacaacca atttagtatt tgaaaggtga gatgaaatat ttaaagatcc     44160
     tgtattgaca ggagcagtgg tagacaggct tgctcataaa gctcatattc ataatctttc     44220
     aggagaaagt tatagaatta aagaaactaa aaagttactt aaaaaataat tggtacactt     44280
     ttaaattgac aaatacacgt ataatttcgt ttcattattc aaggtaaatt ccagctgtaa     44340
     aaatatgaaa aaacaagaaa ccctgttaaa tcagcctttc ttgtttttat tcatttctca     44400
     taccgtataa ttccgtttcg ttgttctaat agcacacatt tttttatgac tatatctttt     44460
     ttgatacagc ctctttttat tttaaaatta tttaggtgtt tttgatttaa tctctgccat     44520
     ttcttttttt ctttgaaata gtatttcttc tctttctaat tgttctagct tctttctttt     44580
     ttcttcatca tcatgataat catctgttaa agttctcaga tctttcaagt ctacatcttt     44640
     atttacttca taattcattt tctctttttg atgtagattt attttccctt tatatttttc     44700
     cgaaattgta ccattatcta tgtttatttt taattctgtt cgacattcat cacattgttg     44760
     atcaactatt ccatgatttt gatctgaact taagtataac tctccattac atacaggaca     44820
     gactgaaata attttgtatt ttaatttagt tttatctttt ttcaatgtta ttaaaattaa     44880
     tattattcct ataattgttc cgataggaat aaaaaataat aaaattattc ctattaatct     44940
     taatgtaaaa gttttagttt tataccaaaa tctccctgtt gttttttgtt tttcaactga     45000
     gacgtatccc ttccttctta gtgtttgttt atcttccaat gtaaaatctt cctccttcaa     45060
     acttattgta tttttaattc aattaaaact tataaaaacg tactgtagtt actttttcca     45120
     tgcgtagtag gttaatataa agtgatttta tcacagtttc taaataactt gtttcatctt     45180
     tatacttctc ttttatttct tttttctctc gttttaacca ttctcttatt gtatttgaac     45240
     ttactccata ctcctgggat agatactttt tcgtcttctc ttgaatatac agttctacta     45300
     tcattttctt aaattcttct gcataccttt ttcctaagtt tttccattcc tgccactccc     45360
     aatttttagt ttatcacaac ttcacttttc ttcacaatcg ttgtcctaaa atttgagtcc     45420
     gatccatatt atttccccaa aaagattctg aaatttcttg tatttcttct tcatttaaat     45480
     tcttcttttt tactaattta tttatataca atacttcgta tattgagccc ataaacatac     45540
     ttaactttaa taatatttta ttttcctctt ccaaactatc tttctcttct aacaataatt     45600
     tcttaaactt aatcagaata tcctgagatt ccagctcttt atccaaaaaa catgttcctt     45660
     tcatacttaa taaaaagcaa agtatctctt cgcgttcctc taaaaatttt atcagtgatt     45720
     tcgtcagatt gtataaatag tcccttttgt tctctttttt ccttacttta tttaaatttt     45780
     ttattatttc ttcagccgaa taatctgctg cctctttata tatatcactt ttatttttaa     45840
     aatgataata cagatttcca ggacttaatt ccagcctctt tactatttct cctatcgaag     45900
     ctttctccag tttcttctct tttatcagtt ccaacgttat tttaattaca tcctttttat     45960
     ccattcttat cctttcagag ataagaaaag agtgtttccg gtgtgaacat accaagtttt     46020
     ttccggaaac cctctacttt ctctttttat taattaaaat actgccttta aagttactcc     46080
     tgctctgtaa tcattttcct tatcatttcc tgttgagtac tctcctgtaa ggaatattcc     46140
     atatctgtct tctacctcta ctcctattgc cgcttttgtt ctgaatgttc ctttttcatc     46200
     ttccggcttc gacaatttat gatagccgtc ttctatggct accaatcttg ccttttctct     46260
     ttcattaagg tctgcaagct catattcata tgcaaggtca agtgttcctt tcagctgcca     46320
     tgctgtctta gctcctaaag gtattgcccc tttcagctct accccggctc taggcttcgc     46380
     actccatgca tcatttcctt ccacctcaag ggcttccagt ccgctttcat taaatgtagg     46440
     tcttgtcaca tacattgctc tgaatgctcc atatggcatt atacttgctt tttttcctaa     46500
     tccgaattct ttcccgagta tattgtcact tgttatactg tatgtttcat atgtcccgtt     46560
     catttctgat ctgctgtttg ggcttggcca gtctatattt ctgtccacat tatggatact     46620
     tgctcttcct gtcaggtcat ttactatttt ccatccattt gatctatact tgttatgtac     46680
     tcccagctgg attgtatcta cccattcttc actttcattt ccgtctttga attcaaagcc     46740
     tgtatgaaca tatcctaatg aataaccgaa tgtatgttta tatgttcttt ccacttctct     46800
     taatgccagt actcctgttg tcgtataatc ataacctgtt gctccgtcag tttcttcttt     46860
     atttttacct tttcctgcta ttacacttat ttttacattt tcttttgtat tatttgttga     46920
     atcctgtaat aaatgtaatg aattttcaaa tgtttttgct atgtcgtctt ctctttggtt     46980
     tatattagca tatacatttc ctgcaagact tgccattact cttctgaatt ccggttcttg     47040
     atctgtttca atcatatcta ttttgttgaa tatttctatc gctttgtcag atattccatc     47100
     ggttccatac tttgaatcta atgctaatcc aaaatcttca taccataaac cgttagtaaa     47160
     atcatcataa ggtatttttt ccatccatat atctatattc cctaaagaat ttacttctgg     47220
     tgttgctctc caagtaagtg atttacttat tacatgaact gttccggaat ttggtcctcc     47280
     tcccggagtt gtcgggttaa atacatcttt taatttataa acatttgcat tagttccctg     47340
     tgtaaaactt gccagtatct gaacaggatt ttcttcactt acactaaaat atggtgcatt     47400
     tatctgtaca gaatctgcta caaattttgc tccgtcatct gctgagcctg cagctgccgg     47460
     tcttattgta gaaggatcta cttttattgc tactactact ccctcatttg aaaaatattc     47520
     acttacattt atcactccgg aattaactat actaggtgtt ggatagctat tccccatact     47580
     tgagatcact ttatttccat ttatagttgt atttcccaga actgttcctt ctccaaacaa     47640
     tccacctgca cttactatat cagtcccgct cccttttcct attcctatat tgttattccc     47700
     agaaccaata tttattgttc ccttattttc tatacttccg ccagtatttc catatatccc     47760
     aataccatta tcggcattta aatttattat cccgctattt ccgtttatta atgttgaagt     47820
     aacaccagcc attcctattc cgtcattacc atttacatcg atagttcctt catttataat     47880
     tattccattc tctgcatata aacctattgc tccagctccg ttcagtatta tatgtccata     47940
     gttttctgca atggttgctg tattattatc ttttatataa attccaattc cgcctgctcc     48000
     tacttctatg tctgaatggt tttctatttt tgctccttca ccatagagcc ctactgcata     48060
     tttattactt ggatctgaag ggttacttgg tacaggtaca ttagaattcc ctacatatat     48120
     tttcccggca ccagtactta atatataacc atttttatta taaataccta tatttcctat     48180
     tttacctgta gcatctataa ctgaagtatt tgatacatat tctccatttg tggcataaac     48240
     cgccacattt tcgtcaccag tcatagttat aggaaaatta tttgttattg ttcccccgcc     48300
     agttgaatag accagaacct catttgtccc catatttata gcggcattat ttacgaaacc     48360
     tgctcctgtt tctaatacta caccatagtt attactccct atactaagat tagagcttgt     48420
     atttgttata acagaattat ttgtcccata tactccgact gcttcattat taccctgcaa     48480
     catgatctgt gaagttggtg ataatgtaac tagatctcca ttactatata ttccgactcc     48540
     tccgcttcca actgttattt ttccattctg ttgaatagtt ccacttaaag tcggatgccc     48600
     aaacttatat attcccagag aacctgaccc tacttctatt tctccgtcat ttatgataac     48660
     ttcatcttca ttttcactgt atatccctac tgccggatta gaaggattag tcgaatttcc     48720
     tatttttatc tttccagttc cagtattcca aatgactgcc gtacttcccg gagaagctac     48780
     agagaacatt cctattgaat ctactccgct taaatcaatc gtcccgctgt tcaacatagg     48840
     agttacgccg gatgcataca ttcccactga atttgccata gttccgttaa tcatatttgt     48900
     attttctacc tgtgctatac cttccgcata taatccctgc gaactctggc ctactgttat     48960
     aactccatta ttttttatag ttcccattcc gtttttacca aaaattccta ctgaattatc     49020
     tcctacagtt atattagcac tgtttagtcc actggcacca ttagatacat aaatagctgc     49080
     tgaattatct cctagcgcta tagtcccctg attttcagct tctacactat atggtaatat     49140
     taatggagga gtggatacct gatcagctga caatgctaca ctatttgtac ctgtagatgt     49200
     tacaactgtt cctgctccta tcatcacacc agatttagtt cctgatatta aaacagaatt     49260
     tgcgccagct gttaaagttc ctgctcctgt tgtaaataag ccttcatcta tattagctaa     49320
     aatataagtt gatcctgccg taggatttat tgttaatccg tttggaattg gtgcacttga     49380
     gccttttata ttaaatatta ctatatcagt accatctaca ttaactgttc ctgtcgcacc     49440
     tgtaatatta cttccgtttt ctaaatgaaa ccctacagct ttatttcctg tcaaatttat     49500
     agtaccgcca gacatattta catcagtcat atctgccaat actgctattc catttgttcc     49560
     tacgctcata cttcctgtat ttgtaaatgt tccacctgat atataagcac ctatagaatt     49620
     taatgaattt cgcagatcaa ctgtatttga atttgtaata ttagcatcag ctctatttaa     49680
     agagctatta ttttgagcat acattcctat tggcgcagtt gctccattag aaattatatt     49740
     tccagaattt gtcatattaa taagattatt tccagctata cttaatgttc cttcttgtgt     49800
     ttttgcagct aaacctatac tgttattacc cagattgatc gtccccacat tgttaatttg     49860
     tgtattatta gttccatata tacctattgc tccatttgaa ctatttatta tattattatt     49920
     tgtgacaatt ccataacgtg aataaaaaga tattgagttt gttcctgaca tatctatatt     49980
     tccattatta acaattgcta ttttcgcctg ccctgctgct gtattatcag gattagccat     50040
     tttcgccaat atctgtccag ccaatgttcc ttttacataa gttccggaag taacttctat     50100
     ttctgaactg accactgata ctttattggt agaatctagg ggattatcta aattatacgg     50160
     attagaaact gatcctatgg aagaatcatt atcaatattt aattttccgt ttgctactaa     50220
     accaaaccta taatttccac ctggatttat tgataacccc aaaccagcta ttgaccctat     50280
     cgctgtatta gcagttgtta aattaaaaat tgttttgttt aatacaaata aattaccgta     50340
     ttctcctgct gtagtcggca tatttatatt aagatttgat atattagtaa atgtatttgt     50400
     aatataatca ctgaaatctg tagctgaata tgtaaaatat gctccgctag gtgtaccatc     50460
     aaaattaaat accgttcctc cgtcttctac tgttattcca gctcctgaag caatattgaa     50520
     ttttccatat gttccaagtg ctgcacctgt tttatattga ttataaaaca tcagtccgcc     50580
     gttcattatt gtagtattgg ttccagaaac tgttatattc ccagttgaaa ctcctgtatt     50640
     aactcctgaa taataagcga ttccgccatt atctgctatt attccggtat tcttagttcc     50700
     gtaatctgca tggtaagctg aatatggaac tcctgataaa gaacttaaaa gaactccgcc     50760
     atttattact ggagcagcag ttatatcaga ataaacacct gctgaaccat tttttgtaat     50820
     aataactccg ttagcagtat ttgtaaagct tcctcctgac aaaattacag ctccgccatt     50880
     attacttttt tctattattc cgttattcgt tacaattcca gaagttccgc taataattgc     50940
     attcgtccca attcctattg acttaatagt accattatta ataatatttc cattattttg     51000
     tgcataagct ccactattat tagaattagt tattatattt ccaattgtat ctgtcccgcc     51060
     tgaaatgagt aaagttcctg ttgaagctaa agttacagtt cctgttcccg ttgccaccat     51120
     tcctaaatta cttgttcctg catcaacttc cgctattccc attattgtca ttgttccacc     51180
     atctgctcta aatagagaac tttgattagc aaaatttcca aagaaaacat catgttcgcc     51240
     tatattttta ctcgctttat tgttatctgc tgtaacagtt aatgttgctc tatctgtaaa     51300
     tattcccaca gctccctcta ctaaattaac attatttcct aatgcatttc ctatagttgc     51360
     cgatttatta gcagtatttc ctatatttat atttattgat gataaacttg ggctaaaaga     51420
     agaattattt attactgcac caacagtatt atctcctgtt aactctatag gtttaacaaa     51480
     attaatatag gatcccccca ttgtacgaat atcattcaca actataccta aagcacctaa     51540
     tccatttata tttatattac ctgtggaact attcaaaaaa taagaacctc catttactgc     51600
     cccattaaca tcatatattc caagtatatc aattggccca tctaagtcta ttattccatt     51660
     attttcaaaa tataaatatc tatttggtgt tcttccatca tcaattgtat aaaaaattgt     51720
     tctatctctt ggatctatag tatatgtagt tgcattataa atataagatg tatctgtatc     51780
     tgcccagata tgtccattat taaccattcc tgaatcagtg acattgccat gatattgcac     51840
     accaaacatc aacccatttt gtcctttcat acgaacattt gtacttgaag ttaatatcca     51900
     actggaagat ctgtaaagac tagaattatc attatagtta ttatgagcat cggtatgaaa     51960
     tagcatcata ttacctgctg cactatttga tcctacaaaa ttaatatcca tatctgaaat     52020
     tgttatatca tgaccaccta ctaatttcat tgcagatctc tgagtttgat ttgtaaaatt     52080
     tatattttgt atgccataat ttgttacaac atgtgcctgt ttatccactc cttttgcatc     52140
     agtatctgct aagtgtaaat caaaattcca atttgtatta gtagtacttc tactaatgac     52200
     atccatgctt ccccttgtcc ccataccttg actaccatct aaattaattt gtgataatgg     52260
     tccatttgag ccattatttg ttatccattg agcatcacca tttccagagg gaccaaatac     52320
     aaaagttttt gtagttattg tatttgtagt tacaggttga acatttactg tcaccggtgt     52380
     aaaaacagga acacttatag tcggaattga tacaaacgga gcagtaatat taactcctgt     52440
     cggtgtaact atattaggaa cctgtggagt tccaatattt aaatttaaag gctgtctatt     52500
     tgttcctttt aaaggtatcc gtattcctaa ttcaacttct tttggtactt gatcaggagt     52560
     cagtggctta ccactaattc catttttcaa ataacttgta actatatagt caccatttgc     52620
     atcataatag ccactttgtg catacaatgg attagagtga tactttgcat tttcttttgt     52680
     attatccact ccttcattat attcttcata aaaccctgta aaaaatacct gccattccag     52740
     atattcaggc tttactatat aatctccctg taaatataaa tcctttaatt ctttattttt     52800
     ctgattcagt attctctgta tcgtctggta agtctgttcg ttcgaacttc ctttttccat     52860
     attttttact atactgttat acattcgctc atatcttgcc gattgtactg tttctgcctg     52920
     tgcataagat gttagtatcg cattcagtgc tagaaatgat actaataatt tcttatttct     52980
     tttcattatt cctccctgtt atcttatatt atttgctgcc ttgtactgct ctattctgaa     53040
     taataaatct tctatttcct gtatctcact taccttttta tctatctgtt tatctacttt     53100
     tataagctct ttttccagcc tttgaccgct gttcaggtgt tttctcagat ttgtccattt     53160
     tcctcttgca ccttccctta attctctttt atattcataa gtcggcgctg aataaagcat     53220
     cgttcccatt actgtcaaaa atatcaagat tattgttttt ttcatttttc ctccctaagt     53280
     gctaccttct tctcattctg ttaatttctt ccggcatcag ttcctcttcc tctgctttta     53340
     ctctgtccag tattgtatac cagtaccctc ttttttcagg aagctttaca tatactgact     53400
     cctgagctct tcttaaggcc ttttcatatg aggaataaac tccgtcctga tcatagtcct     53460
     ttgttatact ttcttccact gatctgtcta cttttacttc ctcgccaaaa gccattaatg     53520
     acagtgttaa cagtgaaaaa atcaaaatta tccttttcat tctgcctcct actttctgga     53580
     tttattaaga tatttcagta ccttgttata ttctgtttta tgccatgcta catctttctt     53640
     ggctctatag ttttctattt tatctgcttt ctccatttgt gcttccatat tcggaacttc     53700
     aatttcctgc ttatttttct tagctgctat tgtaaatata gacatggata ccaataatat     53760
     gactattact tttttcatat ttccctcctt tctaatacat taataattta aaaatatttt     53820
     taaatattcg cattagttaa attttacgaa tgaaaaagag gtattttata ctaattatat     53880
     aagtaggaca aatgattgaa ttaatatttt atctttatta aaattgacat taagctttaa     53940
     ttttagtaaa atatttatac caatgtattc gtaaaattta actaatacga cgtttttttt     54000
     aattatattt attttttttt ataacttttt atttttttat ttttttaaat ataaatttaa     54060
     tatctatatt tataaatatt tatacatgtc ccttttaaaa gttatattat agatttaata     54120
     ttaaaaatat taatatcttt atctattatg attttaattt                           54160
//

If you have problems or comments...

PBIL Back to PBIL home page