(data stored in ACNUC7421 zone)

EMBL: CP001742

ID   CP001742; SV 1; circular; genomic DNA; STD; PRO; 1496453 BP.
XX
AC   CP001742;
XX
PR   Project:PRJNA39927;
XX
DT   11-AUG-2010 (Rel. 105, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 6)
XX
DE   Acidilobus saccharovorans 345-15, complete genome.
XX
KW   .
XX
OS   Acidilobus saccharovorans 345-15
OC   Archaea; Crenarchaeota; Thermoprotei; Acidilobales; Acidilobaceae;
OC   Acidilobus.
XX
RN   [1]
RP   1-1496453
RX   DOI; 10.1128/AEM.00599-10.
RX   PUBMED; 20581186.
RA   Mardanov A.V., Svetlitchnyi V.A., Beletsky A.V., Prokofeva M.I.,
RA   Bonch-Osmolovskaya E.A., Ravin N.V., Skryabin K.G.;
RT   "The genome sequence of the crenarchaeon Acidilobus saccharovorans supports
RT   a new order, Acidilobales, and suggests an important ecological role in
RT   terrestrial acidic hot springs";
RL   Appl. Environ. Microbiol. 76(16):5652-5657(2010).
XX
RN   [2]
RP   1-1496453
RA   Mardanov A.V., Svetlitchnyi V.A., Beletsky A.V., Ravin N.V.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   Centre 'Bioengineering' RAS, Prosp. 60-let Oktiabria, bld. 7-1, Moscow
RL   117312, Russia
XX
DR   MD5; b462f2a75f081d2677a7cb00545b6fac.
DR   BioSample; SAMN02603091.
DR   EnsemblGenomes-Gn; ASAC_R0001.
DR   EnsemblGenomes-Gn; ASAC_R0002.
DR   EnsemblGenomes-Gn; ASAC_R0003.
DR   EnsemblGenomes-Gn; ASAC_R0004.
DR   EnsemblGenomes-Gn; ASAC_R0005.
DR   EnsemblGenomes-Gn; ASAC_R0006.
DR   EnsemblGenomes-Gn; ASAC_R0007.
DR   EnsemblGenomes-Gn; ASAC_R0008.
DR   EnsemblGenomes-Gn; ASAC_R0009.
DR   EnsemblGenomes-Gn; ASAC_R0010.
DR   EnsemblGenomes-Gn; ASAC_R0011.
DR   EnsemblGenomes-Gn; ASAC_R0012.
DR   EnsemblGenomes-Gn; ASAC_R0013.
DR   EnsemblGenomes-Gn; ASAC_R0014.
DR   EnsemblGenomes-Gn; ASAC_R0015.
DR   EnsemblGenomes-Gn; ASAC_R0016.
DR   EnsemblGenomes-Gn; ASAC_R0017.
DR   EnsemblGenomes-Gn; ASAC_R0018.
DR   EnsemblGenomes-Gn; ASAC_R0019.
DR   EnsemblGenomes-Gn; ASAC_R0020.
DR   EnsemblGenomes-Gn; ASAC_R0021.
DR   EnsemblGenomes-Gn; ASAC_R0022.
DR   EnsemblGenomes-Gn; ASAC_R0023.
DR   EnsemblGenomes-Gn; ASAC_R0024.
DR   EnsemblGenomes-Gn; ASAC_R0025.
DR   EnsemblGenomes-Gn; ASAC_R0026.
DR   EnsemblGenomes-Gn; ASAC_R0027.
DR   EnsemblGenomes-Gn; ASAC_R0028.
DR   EnsemblGenomes-Gn; ASAC_R0029.
DR   EnsemblGenomes-Gn; ASAC_R0030.
DR   EnsemblGenomes-Gn; ASAC_R0031.
DR   EnsemblGenomes-Gn; ASAC_R0032.
DR   EnsemblGenomes-Gn; ASAC_R0033.
DR   EnsemblGenomes-Gn; ASAC_R0034.
DR   EnsemblGenomes-Gn; ASAC_R0035.
DR   EnsemblGenomes-Gn; ASAC_R0036.
DR   EnsemblGenomes-Gn; ASAC_R0037.
DR   EnsemblGenomes-Gn; ASAC_R0038.
DR   EnsemblGenomes-Gn; ASAC_R0039.
DR   EnsemblGenomes-Gn; ASAC_R0040.
DR   EnsemblGenomes-Gn; ASAC_R0041.
DR   EnsemblGenomes-Gn; ASAC_R0042.
DR   EnsemblGenomes-Gn; ASAC_R0043.
DR   EnsemblGenomes-Gn; ASAC_R0044.
DR   EnsemblGenomes-Gn; ASAC_R0045.
DR   EnsemblGenomes-Gn; ASAC_R0046.
DR   EnsemblGenomes-Gn; ASAC_R0047.
DR   EnsemblGenomes-Gn; ASAC_R0048.
DR   EnsemblGenomes-Gn; EBG00001013629.
DR   EnsemblGenomes-Gn; EBG00001013630.
DR   EnsemblGenomes-Gn; EBG00001013632.
DR   EnsemblGenomes-Gn; EBG00001013634.
DR   EnsemblGenomes-Gn; EBG00001013635.
DR   EnsemblGenomes-Gn; EBG00001013637.
DR   EnsemblGenomes-Gn; EBG00001013639.
DR   EnsemblGenomes-Gn; EBG00001013641.
DR   EnsemblGenomes-Gn; EBG00001013642.
DR   EnsemblGenomes-Gn; EBG00001013643.
DR   EnsemblGenomes-Gn; EBG00001013644.
DR   EnsemblGenomes-Gn; EBG00001013645.
DR   EnsemblGenomes-Gn; EBG00001013646.
DR   EnsemblGenomes-Gn; EBG00001013647.
DR   EnsemblGenomes-Gn; EBG00001013648.
DR   EnsemblGenomes-Gn; EBG00001013649.
DR   EnsemblGenomes-Gn; EBG00001013650.
DR   EnsemblGenomes-Gn; EBG00001013651.
DR   EnsemblGenomes-Gn; EBG00001013652.
DR   EnsemblGenomes-Gn; EBG00001013654.
DR   EnsemblGenomes-Gn; EBG00001013656.
DR   EnsemblGenomes-Gn; EBG00001013657.
DR   EnsemblGenomes-Gn; EBG00001013658.
DR   EnsemblGenomes-Gn; EBG00001013660.
DR   EnsemblGenomes-Gn; EBG00001013661.
DR   EnsemblGenomes-Gn; EBG00001013662.
DR   EnsemblGenomes-Gn; EBG00001013663.
DR   EnsemblGenomes-Gn; EBG00001013664.
DR   EnsemblGenomes-Gn; EBG00001013665.
DR   EnsemblGenomes-Gn; EBG00001013666.
DR   EnsemblGenomes-Gn; EBG00001013668.
DR   EnsemblGenomes-Gn; EBG00001013670.
DR   EnsemblGenomes-Gn; EBG00001013672.
DR   EnsemblGenomes-Gn; EBG00001013674.
DR   EnsemblGenomes-Gn; EBG00001013676.
DR   EnsemblGenomes-Gn; EBG00001013678.
DR   EnsemblGenomes-Gn; EBG00001013680.
DR   EnsemblGenomes-Gn; EBG00001013682.
DR   EnsemblGenomes-Gn; EBG00001013684.
DR   EnsemblGenomes-Gn; EBG00001013686.
DR   EnsemblGenomes-Gn; EBG00001013688.
DR   EnsemblGenomes-Gn; EBG00001013690.
DR   EnsemblGenomes-Gn; EBG00001013692.
DR   EnsemblGenomes-Gn; EBG00001013694.
DR   EnsemblGenomes-Gn; EBG00001013696.
DR   EnsemblGenomes-Gn; EBG00001013698.
DR   EnsemblGenomes-Gn; EBG00001013700.
DR   EnsemblGenomes-Gn; EBG00001013702.
DR   EnsemblGenomes-Gn; EBG00001013704.
DR   EnsemblGenomes-Gn; EBG00001013706.
DR   EnsemblGenomes-Gn; EBG00001013709.
DR   EnsemblGenomes-Tr; ASAC_R0001-1.
DR   EnsemblGenomes-Tr; ASAC_R0002-1.
DR   EnsemblGenomes-Tr; ASAC_R0003-1.
DR   EnsemblGenomes-Tr; ASAC_R0004-1.
DR   EnsemblGenomes-Tr; ASAC_R0005-1.
DR   EnsemblGenomes-Tr; ASAC_R0006-1.
DR   EnsemblGenomes-Tr; ASAC_R0007-1.
DR   EnsemblGenomes-Tr; ASAC_R0008-1.
DR   EnsemblGenomes-Tr; ASAC_R0009-1.
DR   EnsemblGenomes-Tr; ASAC_R0010-1.
DR   EnsemblGenomes-Tr; ASAC_R0011-1.
DR   EnsemblGenomes-Tr; ASAC_R0012-1.
DR   EnsemblGenomes-Tr; ASAC_R0013-1.
DR   EnsemblGenomes-Tr; ASAC_R0014-1.
DR   EnsemblGenomes-Tr; ASAC_R0015-1.
DR   EnsemblGenomes-Tr; ASAC_R0016-1.
DR   EnsemblGenomes-Tr; ASAC_R0017-1.
DR   EnsemblGenomes-Tr; ASAC_R0018-1.
DR   EnsemblGenomes-Tr; ASAC_R0019-1.
DR   EnsemblGenomes-Tr; ASAC_R0020-1.
DR   EnsemblGenomes-Tr; ASAC_R0021-1.
DR   EnsemblGenomes-Tr; ASAC_R0022-1.
DR   EnsemblGenomes-Tr; ASAC_R0023-1.
DR   EnsemblGenomes-Tr; ASAC_R0024-1.
DR   EnsemblGenomes-Tr; ASAC_R0025-1.
DR   EnsemblGenomes-Tr; ASAC_R0026-1.
DR   EnsemblGenomes-Tr; ASAC_R0027-1.
DR   EnsemblGenomes-Tr; ASAC_R0028-1.
DR   EnsemblGenomes-Tr; ASAC_R0029-1.
DR   EnsemblGenomes-Tr; ASAC_R0030-1.
DR   EnsemblGenomes-Tr; ASAC_R0031-1.
DR   EnsemblGenomes-Tr; ASAC_R0032-1.
DR   EnsemblGenomes-Tr; ASAC_R0033-1.
DR   EnsemblGenomes-Tr; ASAC_R0034-1.
DR   EnsemblGenomes-Tr; ASAC_R0035-1.
DR   EnsemblGenomes-Tr; ASAC_R0036-1.
DR   EnsemblGenomes-Tr; ASAC_R0037-1.
DR   EnsemblGenomes-Tr; ASAC_R0038-1.
DR   EnsemblGenomes-Tr; ASAC_R0039-1.
DR   EnsemblGenomes-Tr; ASAC_R0040-1.
DR   EnsemblGenomes-Tr; ASAC_R0041-1.
DR   EnsemblGenomes-Tr; ASAC_R0042-1.
DR   EnsemblGenomes-Tr; ASAC_R0043-1.
DR   EnsemblGenomes-Tr; ASAC_R0044-1.
DR   EnsemblGenomes-Tr; ASAC_R0045-1.
DR   EnsemblGenomes-Tr; ASAC_R0046-1.
DR   EnsemblGenomes-Tr; ASAC_R0047-1.
DR   EnsemblGenomes-Tr; ASAC_R0048-1.
DR   EnsemblGenomes-Tr; EBT00001535626.
DR   EnsemblGenomes-Tr; EBT00001535629.
DR   EnsemblGenomes-Tr; EBT00001535631.
DR   EnsemblGenomes-Tr; EBT00001535633.
DR   EnsemblGenomes-Tr; EBT00001535635.
DR   EnsemblGenomes-Tr; EBT00001535637.
DR   EnsemblGenomes-Tr; EBT00001535639.
DR   EnsemblGenomes-Tr; EBT00001535642.
DR   EnsemblGenomes-Tr; EBT00001535644.
DR   EnsemblGenomes-Tr; EBT00001535647.
DR   EnsemblGenomes-Tr; EBT00001535650.
DR   EnsemblGenomes-Tr; EBT00001535653.
DR   EnsemblGenomes-Tr; EBT00001535656.
DR   EnsemblGenomes-Tr; EBT00001535659.
DR   EnsemblGenomes-Tr; EBT00001535662.
DR   EnsemblGenomes-Tr; EBT00001535665.
DR   EnsemblGenomes-Tr; EBT00001535668.
DR   EnsemblGenomes-Tr; EBT00001535671.
DR   EnsemblGenomes-Tr; EBT00001535674.
DR   EnsemblGenomes-Tr; EBT00001535679.
DR   EnsemblGenomes-Tr; EBT00001535682.
DR   EnsemblGenomes-Tr; EBT00001535685.
DR   EnsemblGenomes-Tr; EBT00001535690.
DR   EnsemblGenomes-Tr; EBT00001535693.
DR   EnsemblGenomes-Tr; EBT00001535695.
DR   EnsemblGenomes-Tr; EBT00001535699.
DR   EnsemblGenomes-Tr; EBT00001535703.
DR   EnsemblGenomes-Tr; EBT00001535705.
DR   EnsemblGenomes-Tr; EBT00001535708.
DR   EnsemblGenomes-Tr; EBT00001535711.
DR   EnsemblGenomes-Tr; EBT00001535714.
DR   EnsemblGenomes-Tr; EBT00001535717.
DR   EnsemblGenomes-Tr; EBT00001535721.
DR   EnsemblGenomes-Tr; EBT00001535722.
DR   EnsemblGenomes-Tr; EBT00001535725.
DR   EnsemblGenomes-Tr; EBT00001535729.
DR   EnsemblGenomes-Tr; EBT00001535733.
DR   EnsemblGenomes-Tr; EBT00001535734.
DR   EnsemblGenomes-Tr; EBT00001535738.
DR   EnsemblGenomes-Tr; EBT00001535741.
DR   EnsemblGenomes-Tr; EBT00001535743.
DR   EnsemblGenomes-Tr; EBT00001535746.
DR   EnsemblGenomes-Tr; EBT00001535749.
DR   EnsemblGenomes-Tr; EBT00001535751.
DR   EnsemblGenomes-Tr; EBT00001535758.
DR   EnsemblGenomes-Tr; EBT00001535764.
DR   EnsemblGenomes-Tr; EBT00001535768.
DR   EnsemblGenomes-Tr; EBT00001535771.
DR   EnsemblGenomes-Tr; EBT00001535774.
DR   EnsemblGenomes-Tr; EBT00001535777.
DR   EnsemblGenomes-Tr; EBT00001535780.
DR   EuropePMC; PMC2918975; 20581186.
DR   EuropePMC; PMC3310297; 22481976.
DR   EuropePMC; PMC4619763; 26539062.
DR   EuropePMC; PMC5797428; 29434576.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00095; snoPyro_CD.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001742.
DR   SILVA-SSU; CP001742.
DR   StrainInfo; 845999; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1496453
FT                   /organism="Acidilobus saccharovorans 345-15"
FT                   /strain="345-15"
FT                   /mol_type="genomic DNA"
FT                   /country="Russia:Kamchatka"
FT                   /isolation_source="solfataric field of Uzon caldera"
FT                   /note="type strain of Acidilobus saccharovorans"
FT                   /db_xref="taxon:666510"
FT                   /culture_collection="DSM:DSM 16705"
FT   gene            complement(69..185)
FT                   /locus_tag="ASAC_0001"
FT   CDS_pept        complement(69..185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18410"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC2"
FT                   /protein_id="ADL18410.1"
FT                   /translation="MYPVSAPVTIRNQGMVLKLEEVVHDDEDYFNGETKEWC"
FT   gene            complement(1241..2173)
FT                   /locus_tag="ASAC_0002"
FT   CDS_pept        complement(1241..2173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18411"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="InterPro:IPR041165"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC3"
FT                   /protein_id="ADL18411.1"
FT                   /translation="MSLLNIIESNMPRALLRLELEVTPRDDVILQPMSSKALKSAAADP
FT                   NGCLHPLWELYLAHREAVTFRSLADGSGRRLYSQGDRPIVVRKGERLRGAVVAVASSLS
FT                   APQVAQLASCEGSVSLGPGALEYRVTSASLVRGEELSVGLGGRGGAVRLLFLTPTAIPL
FT                   KVMTPPWASRLSRRVPNAYRLLPEPAYIAAYAAKLLLGLSGAGGDAPLYHYYVGRLVDM
FT                   YAVEVDYDVKPTTAVIGRDYLGRLRLLRGFTGWALYSVKGGLGSAILDRLLAIASELGV
FT                   GKLRAMGMGEVRAEVVGPKGAQPATRQQF"
FT   gene            complement(2208..2780)
FT                   /locus_tag="ASAC_0003"
FT   CDS_pept        complement(2208..2780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18412"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC4"
FT                   /protein_id="ADL18412.1"
FT                   /translation="MGLRLLLMPWLRPDAAFAAAEELGAREGERAVLVSFDGGRQAPLA
FT                   ALRWLRASQLSGDAASLLAGLSEELARGYDEVLAWAGPRPESPLLAAFAAAAAVMGFRA
FT                   WLLVPGAGRLELTPLRRLGVSGDQLKALRLVVAGASSVERLAARMGVSLKTASNLAWSL
FT                   RSAGLLEGRGRLRPTPWGAVAAALRKD"
FT   gene            complement(2771..3319)
FT                   /locus_tag="ASAC_0004"
FT   CDS_pept        complement(2771..3319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0004"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18413"
FT                   /db_xref="GOA:D9PZC5"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC5"
FT                   /protein_id="ADL18413.1"
FT                   /translation="MAEAAVTGTAVKDYSYCPALPWLKVRLGLREPETWGMRAGRSLRA
FT                   SDVAYKLGLERPWLEEVPLRDRGLGAAGVVDLVSGSGRLRVLEVKAFRAAGERLRPFAN
FT                   QLKFYALLANRLLGRVREAYLYHGGDLLALEVDGHVLREAEELVARVRDVLESEEPPRA
FT                   YRSERCSSCWFRRVCPAWD"
FT   gene            complement(3312..3596)
FT                   /locus_tag="ASAC_0005"
FT   CDS_pept        complement(3312..3596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18414"
FT                   /db_xref="GOA:D9PZC6"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC6"
FT                   /protein_id="ADL18414.1"
FT                   /translation="MRVLVVYDVSDDSRRLRLSRELERMGLSRVQRSAFVGPGGLAVAK
FT                   EAARAAAQLVDDSTDVVHVVLLSEVEWANALVVGRPLAAPRVAEVTLLG"
FT   gene            complement(3593..4582)
FT                   /locus_tag="ASAC_0006"
FT   CDS_pept        complement(3593..4582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0006"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18415"
FT                   /db_xref="GOA:D9PZC7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC7"
FT                   /protein_id="ADL18415.1"
FT                   /translation="MRALLLTGYGLLLGASGSSLVVRSKDGRREEVPLSQVDLVVVASG
FT                   GVSVTSRALRLMAAAGVEMVVLDRGGMPVSVTYMSHYSRTPETRRAQYMAASGELGGSM
FT                   ASSLVACKVLSQASTLRRLALRAGATVKSTVSRMRELAREVMELRGTPNDLRPRLLELE
FT                   AAAAREYWGFVASLLPRDLGFDGRDQEGDDPVNACLNYMYAVLYSLGLRALLLAGLDPY
FT                   AGFLHVDRSGRPVLVYDYVEQFRAPVVDEPLVALVTSGWRPRLEGGLLDVGSRRALLEA
FT                   LFNRLKDQALGAYRPMTYSEALREYAYRLASSLRSGQAYSCYAGGEPL"
FT   gene            complement(4579..5376)
FT                   /locus_tag="ASAC_0007"
FT   CDS_pept        complement(4579..5376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0007"
FT                   /product="CRISPR-associated protein, Csa1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18416"
FT                   /db_xref="InterPro:IPR009260"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC8"
FT                   /protein_id="ADL18416.1"
FT                   /translation="MLQLLRQELKYLHGLQLSVPSELRGWAWDRPPVRPRYRAGLGVAE
FT                   VAYYSCCPREALEARLRGPRQDAAMLLGAAVHELFRRVAYGLQGLVGRGVEPWEAARRV
FT                   MESRAYAEVASQLGLAGEAQRLRDLQGALAVMLAGDATLQRLLGGSATGSWAPWLSEYV
FT                   VDGTPLGLARRLRVDALMSGAVVEFKVGQARDWHAVQMAGYAMALESQLEVPFDYGLLV
FT                   SVSLSPPSLSVHGLLLGEGPRSRFLEARDSMAEELASSGVAAV"
FT   gene            complement(6580..7452)
FT                   /locus_tag="ASAC_0008"
FT   CDS_pept        complement(6580..7452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18417"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZC9"
FT                   /protein_id="ADL18417.1"
FT                   /translation="MTYLLIRPLTPAVFRWGGLSSVLLSGSMYQGYFEAMPLPSTIYGF
FT                   LKLAYIVNGLGSDAPRFRGPMFYVEGSRGSYLCAYSFTKKGRAMLCPSGESLRLYKVED
FT                   RHYIKKIGIALDKGTKGAKENYIYMERDVDLGLIARDILGEGPTRYGVLVEVYDDEAYD
FT                   KTLKLNNSIGAFGGESRPAKIEVIKDIKVKEGALGLGSVLISPAIVDVVDDNKIVWDKN
FT                   QATATPVKAETKEGDRECTAVIYRLLSLGFDNGRRLPMALAVMPGVKVDVKGPVGLCTE
FT                   RGWGSVMEF"
FT   gene            complement(7459..10350)
FT                   /locus_tag="ASAC_0009"
FT   CDS_pept        complement(7459..10350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18418"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD0"
FT                   /protein_id="ADL18418.1"
FT                   /translation="MQSGDLLELKLIAYFHDPPWKAWIVSKSPSRAILADKGGHEDDAK
FT                   ELLSMMGVPVQGNFPPAVALADHLASSLDRWVISLLLKDVEAGARAEEIVKKNLFAPWY
FT                   KIKVPPNIDANKVKEYARELSGLVMNAGGLKYHVAYYLAPLLWYEHFPCAPNGPCWVPV
FT                   ADTRVPTHTIFDHATATAAMLNILRCDGTKPQFYGSVAVIDFPSVQEFISFSRKTSDLW
FT                   ASSWLTSLLLWRSIEPFVERYGPDVVLRPELSLNHFFIAWLANKVQDKRLRDRIVELGR
FT                   KYAGLQDGPLTSMMGDKVVLLLPEQRDDVERQLRDNFKKAWEQVASEAFKRTGIDGLLR
FT                   DGPLKSYIDKAKETPPVRPRVVALDVGEAFKKYSDAIRGLAEGSLSCSGQYVSVEYSLF
FT                   FEYLLHRINSEELKIKVKYMYGVDLADTVRSLTSSGDYHLCTMCGMLPAAVSYVSWRTG
FT                   AEFRRLRDVKEGEEEEDRLCPYCALKRSLNDGRVVIEVLKDMDLLVGSGVRRGFPSTSE
FT                   IAMLNVDEVLGPYVGNENVRGPYLAELYEKCYGGSREACETVYSLIKDRAANHIKNEEE
FT                   LRKIIRKYGDAYFAVLKADGDFMGKGYWSGLLRKGDGKCFSIEDYIKTAMAIRLEDEKK
FT                   LSEEVKRIVEVRERLAHEDNEASEDKGYERSLDHVKKAASEEPPCTFDVSSGGGTETRY
FT                   MIPITPAYAYALSRALTAQAVLDIRILTDRRASPVYVGGDDLLAFSPTKYRGELVPLDA
FT                   VEETRKAYWGFSGGAVSGFKYLGDGKGYMPVDALANYGRSYVILPAHYKDPLPLSLSTA
FT                   SELLEEKDHVKEKDVLFIYSGRGIARSLEWLVSTLKLSEAGRLNTQLLEAVRDLYDAIS
FT                   SKRLSVSFIHDYFGIKDYMEMAMGNGSAKDVYTMLALEVVERNKVGNSDVSKVKKHVSD
FT                   LASVSSCLPSRDGSSVCSGDRLYSVVLAVDYMR"
FT   gene            complement(10337..11089)
FT                   /locus_tag="ASAC_0010"
FT   CDS_pept        complement(10337..11089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0010"
FT                   /product="CRISPR-associated RAMP protein, Cmr6 family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18419"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD1"
FT                   /protein_id="ADL18419.1"
FT                   /translation="MAAQQGGNRLLGALLKYQQEMLKGSPREDARSMSLEGLVKGWDLS
FT                   RARGYVNEVRQSIVSSGMDFISLKLTTKRKFMGGWSPIYFITEVPLAWDLIIDVPYIPG
FT                   SQAKGIVRDAFLEVSGDDKMADCVFGSRKAEGKVTFTDFYPVASQGGLLVYDIINPHYS
FT                   PERRPFNEYNANPVPVKFVAVNSGVTFEGFVVFRRDELEPCGQDAFKLLLQAIFYSSVS
FT                   GWGRRTTRGYGELDLQVELEEVRSGAVR"
FT   gene            complement(11095..12315)
FT                   /locus_tag="ASAC_0011"
FT   CDS_pept        complement(11095..12315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18420"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD2"
FT                   /protein_id="ADL18420.1"
FT                   /translation="MSLDETLVKEARMRALGLFNERRLVARLRLTPTTPWWGGDHSTRT
FT                   SQEVDEDEINGRLRWFLRTVYNRFCARDLSDYSEAEKFVSGFLGSTGMVSRYVFRASTL
FT                   GPGDVAKQFDQLPRVKLTLLGNRRGLSKGDLLPLNLRGLDLSIYRSRAEKDPGYDDLVV
FT                   GGVLITLAFVGVGRGANRGFGRFAPSECPAGGSQFIEKLCTYVKDGNVTEAFRLYYNRF
FT                   KEVAGCSSENSWEESAVPLAPLVDGEGPDVIRAVPNCTARDSYEALRVLQEAFLKVNLR
FT                   SVMGRGGLSSAEVHSWLLGLPRRIKSTGYFLVSEESEEPGRRQSMLVASPVRVNNAYRL
FT                   YFLPFLSLRDHEQIYSMLEHRSGSGEVTKVGDMIRGEELRDVISELVDAVARAAEARCR
FT                   GAKRVTR"
FT   gene            complement(12312..12797)
FT                   /locus_tag="ASAC_0012"
FT   CDS_pept        complement(12312..12797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18421"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD3"
FT                   /protein_id="ADL18421.1"
FT                   /translation="MSDFVGFAADVGTKLIAAGCQGGGSSNSKPGIVRRAVDFPSLMIS
FT                   LGFQPAFTFFLSKVERFSAVSAIYSYLTGKAKLDDGVKAAICDELRRSEGAGYAGYVAI
FT                   ILYALSRVGESVSVGGNEEEIYKSLLGIALKELALAKERLLSEYLLEVKKVLEAMPL"
FT   gene            complement(12805..13686)
FT                   /locus_tag="ASAC_0013"
FT   CDS_pept        complement(12805..13686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0013"
FT                   /product="CRISPR-associated RAMP protein, Cmr4 family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18422"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD4"
FT                   /protein_id="ADL18422.1"
FT                   /translation="MVLAYAVTPVHVGSGRSPGFVDLPFQRDSMGYPVILGSSFKGALR
FT                   FHLTPPSSGKPNDKGGGNDKDNKLVRCAFGPDIDEGGAKFMGRLVFTDLVPFLYPAPSL
FT                   SEGYIYVTTKYLLNRAYDILSTVGVSPPKALGAGGTVTVGLREVRYAYTVNVSDVLGGR
FT                   VDTRSLGYLLKDKAYVFDDDVGLQVVESSLVRVTRNALDDKTKTVKERALWTEEYVPQG
FT                   TVMVGAMLDSMRGSVDSMGGNDECRDIDVMTELSNKLNRASLFIGGKETVGKGLVRLLI
FT                   VSGTGAVSGAVR"
FT   gene            complement(13875..15467)
FT                   /locus_tag="ASAC_0014"
FT   CDS_pept        complement(13875..15467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18423"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD5"
FT                   /protein_id="ADL18423.1"
FT                   /translation="MGKALTLIVAPLGSVKYLRPATYLAQDRRGRFSCRVESKGKVPSA
FT                   AVTYVYLRRMFPDAVVRVLGLVPESLIAELGMASGPYWKAVDELLSLQRRHIEEGVESS
FT                   SDSCGLLGDFIKEDNLELRAVPLRGTFRLSGGGSMRIDVSPYDSQAMAAYHISRKLLEL
FT                   RAADYDAVYVVSDVTNAPNQLQVMTVRAVQGAASALSLAVPVTLGFSALDPYVDDRTEL
FT                   TLSVTFQRQLPSIRLPTRRTSRLLSPRRCAPRDVVRALVGLHGKPIRAAISSLTAAAAS
FT                   INVGALFLMPYFLEDALEKLEGLGRGPSSSTCYSAAALDAGQLQRAILDLASTFVEEYF
FT                   TLTKVTQGGDSVEVTRYADFNEDFETMLYLALAGGTTIKPEGGCLNLNELAREADNYSR
FT                   RGLGITITTEIEHDNIVNAINSSKDEVKGRLASDGVCLYELKGHTSSSVNNEYTARNLV
FT                   AHAGILENAVKIKVRGDGSPMACLSGDCGDCRIPCGKLMEIIKRSLFKVVNLDKAHRSP
FT                   PGEASRGRLSLDM"
FT   gene            complement(17989..18114)
FT                   /locus_tag="ASAC_0015"
FT   CDS_pept        complement(17989..18114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18424"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD6"
FT                   /protein_id="ADL18424.1"
FT                   /translation="MNLYVIIRPADLEAFLRNEVPTVMWWENLRANRFTLGHRVT"
FT   gene            18128..18889
FT                   /locus_tag="ASAC_0016"
FT   CDS_pept        18128..18889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0016"
FT                   /product="putative CRISPR-associated protein, APE2256
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18425"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD7"
FT                   /protein_id="ADL18425.1"
FT                   /translation="MRYASRSAGLSREQAELLERCSRLDVDAEDECERLAGAGRSDPLL
FT                   DRLRSYLSSSPYEASAELNSLQPFLEAGMVQRVVLYYYSDSGAAHLVALLLTEYLKRAG
FT                   VAAEAVPAGEGERNLAAGLLNIMREVGSRALRDQGEGYTIMLNITPGFKAEAAYFTLGL
FT                   MLRNITALAYYRHEAMKSTVGVPLLHTTALRDAVTSLRAKVGARLEDLDANELVTVIAA
FT                   RLNSGRLSLGPVVKDDLVWAEELLAASGITS"
FT   gene            complement(19564..19731)
FT                   /locus_tag="ASAC_0017"
FT   CDS_pept        complement(19564..19731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18426"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD8"
FT                   /protein_id="ADL18426.1"
FT                   /translation="MVSELWDTIQVMFAYRARGLPLPLPLCPTVVLCTGILKFTAGSRA
FT                   ASHVEHGKPP"
FT   gene            22469..22738
FT                   /locus_tag="ASAC_0018"
FT   CDS_pept        22469..22738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18427"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZD9"
FT                   /protein_id="ADL18427.1"
FT                   /translation="MMLKLKLTTTPLATLVLSRTPQGFVVKPVYAYQRLLWAVKAFADM
FT                   QIFNYLENIIAAQRGGEGAGLVHEARPSPLALGVLGVIPCLAIP"
FT   gene            22892..24094
FT                   /locus_tag="ASAC_0019"
FT   CDS_pept        22892..24094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0019"
FT                   /product="putative major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18428"
FT                   /db_xref="GOA:D9PZE0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE0"
FT                   /protein_id="ADL18428.1"
FT                   /translation="MVLTRDQRLVLVSTTLDMFLEGVFVTLPSVSALLSSIPSWATPLV
FT                   FSTIPVGTLIGNLALGRLTDLRGRKSTYMAMLGVYALGALLILAFNSLYAVLAGLLITQ
FT                   TAMGGEVPIVLSYIVESAPADIKERLVVLITNVGNVGAVVISAVALAFGGLSAASGRAA
FT                   VGALVAGAIAIMAVTRSMVPESRPWLSLRPEERGRVVLGAEARLWLALLTLMAVSSVLT
FT                   FGLLALSIGPEEFPSHALEIIMLYFAGEALGGLIAAAAMDRVGSRAFTLASFAGGFATS
FT                   LAAIPALRAGLAPFMALLFVNGAFTETVWASRNVLESLSFPTTFRATGIALVRAAPYVL
FT                   MLASFFATAGMGVVDFLWYATAMWALGLAASAAWMARGREVVGSPVAIRPEDLDRLRRR
FT                   A"
FT   gene            24132..24863
FT                   /locus_tag="ASAC_0020"
FT   CDS_pept        24132..24863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0020"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18429"
FT                   /db_xref="GOA:D9PZE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE1"
FT                   /protein_id="ADL18429.1"
FT                   /translation="MGSPLANAIEVRDVVKFYGTVPALRGLSFEVPEGGRYALLGPNGA
FT                   GKSTTLRLLVGLMKPDRGEVRVLGRDPADDYSVKAQMGYLPEDATPYLALTVRENLEYI
FT                   AALRGLDDPRDRAEKMMDLLGLRKYENYRVSALSRGNVQKLAIALAIIHEPKVVFLDEP
FT                   LNYLDIPTQEEVIGVLSRMGSTMLVSTHIMSVAGRLTDHILMISGGRLVWQGTFDDLRR
FT                   MAKEEEPVESVVARLMRSVEA"
FT   gene            24850..26322
FT                   /locus_tag="ASAC_0021"
FT   CDS_pept        24850..26322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18430"
FT                   /db_xref="GOA:D9PZE2"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE2"
FT                   /protein_id="ADL18430.1"
FT                   /translation="MSRLKLIAFVVKTRISRPLLIITLIMLFYGVMSGAYLYANHIELP
FT                   PSEVAQERTMAVIYSAIVIFLASLQGGVTVIKSDRDYLFTLPISRGSLALSLYIGQMVL
FT                   SGLLAIAWLGWYFPFIDVPLGYAVVDMVLFVLLLTSLTASIAELQAKRRVAVAAALAAW
FT                   SISALFRNPVSPSGVFDGYYLAGTATLAILSLGLTSYVATRLGRAPLLYGYSSVVSEGR
FT                   GQVASSALSFAGVRGLRAELRMKLNTLTITGRVGGFGAGGSRYFTRTVSVRKFMGYMSL
FT                   AAAAYLAVGVALMATGLVPQRLTPQGPGNGVLFGLLFVPAIAVEAFFIGSSASQVGNER
FT                   PWLAFTAADPGAYMWLGALSWSLVVLLASLPFAAAYLTLWLMGLREAINMVPQLLLVGP
FT                   AFSLLSYAASAYMAVSPQVRSEGFMPGQVRARGLVITFIIIVPFALISAAMASLSVSVY
FT                   SGLASLLVAAPFMALRGFWRSASRRIVEAGYV"
FT   gene            complement(26313..28985)
FT                   /locus_tag="ASAC_0022"
FT   CDS_pept        complement(26313..28985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0022"
FT                   /product="Putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18431"
FT                   /db_xref="GOA:D9PZE3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE3"
FT                   /protein_id="ADL18431.1"
FT                   /translation="MALQDDEEVLSLLRPYVAAWFREKYGSFTDPQREAIPLIKQGRSV
FT                   LISSPTGTGKTLAAFLAILDDLLAMGERGELEDKIYAVYVSPLRALDNDMYRNLVQPLG
FT                   EIYEKAKSMGFQPPEVRVATRTSDTPANEKAKMLRRPPHILITTPESLAISLVAPKFRE
FT                   RLSTARWVIVDEIHELASSKRGSHLALTLERLEELVSEAQGRGLQRVGLSATISPLEEV
FT                   ARFLGGYYDDGTPRPVEIVDARFAKPFDIRVITPKVDLIHGDPEKINEEIYNTVAELSR
FT                   TARTTLVFTNTRSATERVVFKLKKLMSSKGYVDMDEIEAHHSSLSREVRLDVEERLKRG
FT                   ELKLVVSSTSLELGIDIGYIDLVVLLSSPKSVSRLLQRVGRAGHHVSQVSRGVMVAVNR
FT                   DDLIECTVLAKAAMERKIDNVRIPRNPLDVLAQHIVGMSIERPWKVEEAFRVIRRAYPF
FT                   HALSWEDYMSVLRFLGGKSQGLEDEGVYSKIRLDEDLGEFGRKRSARMIYQLNAGTIPD
FT                   EAKIKVISKGKSIGSLEEEFVEILEPGDIFVLGGKTYRFLRADGMKVYVEPAENERPTV
FT                   PSWFSEMLPLAFDSALLVGEFRERVGELIAQGKLDEARRMLVEEYRLEPHAAEEVIQYV
FT                   WEQLAYTGVVPGRRNILIEYFQGDEGEWSIAFHTLFGRRTNDALSRAYGAVLSDRLNVP
FT                   VKVSVTDNAFMLTYEGREPDEGLIRYLLSSVRSDNLRQLLEGAVVRTEMMRRRFRHVAQ
FT                   RSFMILRRYRGHERSPERMQLSAQKLLDVMLEEMPGSPVIRETYREILEDYMDIQDAGR
FT                   VLRWIEGGEVKVTVRGPLPYPSPFAHNLFIKEYSDVVLMEDKQRIMAYLHDRIMEYLRS
FT                   KGKVLEEGVQQAQGEEAHT"
FT   gene            complement(29119..29916)
FT                   /locus_tag="ASAC_0023"
FT   CDS_pept        complement(29119..29916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18432"
FT                   /db_xref="GOA:D9PZE4"
FT                   /db_xref="InterPro:IPR009198"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE4"
FT                   /protein_id="ADL18432.1"
FT                   /translation="MAYMEKMGRMVALNQLYILIYSALAAVIGINVYLFLLIFVFIAIS
FT                   MFVQSILMSSGLNEKSSYVAEVLSGKRLFHEDNTRAIQSKDTLIYVDLQEQTKFSLYTT
FT                   LGILIGLAYFFVLWRYVPDLAAYLSLELFGRQIKDVGIEYLRLLLFIAFLLYFEGYFVI
FT                   NQGIMMWSLSRIKKLPALNVPTSYIVTDKGIVIKGLITTKGIRFPLPPDIEVVLNKDRR
FT                   FVELTRQGKRTVTRLRLYTKNPEKLYEIIRKVAFPASSRGQES"
FT   gene            30000..31107
FT                   /pseudo
FT                   /locus_tag="ASAC_0024"
FT   gene            complement(31069..31422)
FT                   /locus_tag="ASAC_0025"
FT   CDS_pept        complement(31069..31422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0025"
FT                   /product="Putative sterol carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18433"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE5"
FT                   /protein_id="ADL18433.1"
FT                   /translation="MVTLDDVRKALQQLFSRAVEEVPEIRSWDKVYQFSVQGLGDFYVE
FT                   IKSGALRVVEGRHPKPIATLTTTSDVLERMMSGQLDAMKAFLGGQLKITGDVLDTINLK
FT                   KLIDAGLGKVSEM"
FT   gene            31619..32809
FT                   /locus_tag="ASAC_0026"
FT   CDS_pept        31619..32809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0026"
FT                   /product="Putative 3-ketoacyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18434"
FT                   /db_xref="GOA:D9PZE6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE6"
FT                   /protein_id="ADL18434.1"
FT                   /translation="MRNVAIVGYGHTKFGVRNEVNLAELAYEAIREALEKAGLEPKDVE
FT                   HVVVSNVGGWSSEPLPAVVVAEYAGLSGKPLHRVEAACASGSSALASAYEAVASGMADI
FT                   ALAVGVEKMNESPTPNVVELIGRAGNYFWEFQNFGLTFPGYYALYATAYMNKYGATEED
FT                   FCRVAVKNHYYASMNPKAQFPRKIDLETCMSSRYIAWPIKLYDSSPITDGAAAVVLASE
FT                   EVAKKLTDSPVWIHSIGMASGTANLSRRDDFTGLMAAQLAARAAYKVAGLEAENTARYF
FT                   DVAEVHDCFTIAEVMAYEDLGFVKRGEGYKLVREGQTYIGGLIPVNLSGGLKAKGHPLG
FT                   ATGISMAVELTKQLLHEVEPGRQATINKGMAVAHNVGGTGHYAYVTVLGLEKPRGR"
FT   gene            32816..33355
FT                   /locus_tag="ASAC_0027"
FT   CDS_pept        32816..33355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0027"
FT                   /product="hypothetical protein"
FT                   /note="DUF35 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18435"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE7"
FT                   /protein_id="ADL18435.1"
FT                   /translation="MSQRQEADAYLKQLEAYANAMKSSVGVPVIVDPKTNVAIWYDQRE
FT                   MRFKFLISVERTRRFFEALSEGKVLATRCRQTGEVFFPPQVDCPGVKDGEVEWVELPRE
FT                   GELVTYTVIYTKPYSFSHYDDYTVGIARLSNGVQVLAWVRERDPKRLRVGMKVRLEVVK
FT                   REPEGYLTYELVPEQP"
FT   gene            complement(33392..34717)
FT                   /locus_tag="ASAC_0028"
FT   CDS_pept        complement(33392..34717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18436"
FT                   /db_xref="GOA:D9PZE8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE8"
FT                   /protein_id="ADL18436.1"
FT                   /translation="MLLLGVGLRSLGLVGVAVVFFLVGLFLGGFVLAAHGGAGVGLSPG
FT                   VRASFVNGTPVTPSALERVLRTPRVGIVTPMAMEMAPLLAAMKLAAIVNYSGYTFYVGS
FT                   IGGTPVVLVRSGEKEYAAVEATTLMDALFNVRAAILSGTAGSRNPYVVPGDVVIGAFVV
FT                   DKSSIHYHRASLVNSTMAYSETPYSGVEVVNVTPLRGDLVSGFGEAMPSYSNASSYGYG
FT                   YGVDLSYVYVEYLAASAQLVEIAERAASALSPIPLANVTGLNVSGELVPRVIVGVIGSA
FT                   NQWTEPLSWMAQQNALYETDAGENEGMGFAYVNSRLGIPWVIVRGISDSPWFPSVYIGP
FT                   TAAEEAANVTIYIVEHLDLNSVSDAPAAFSALSNVSNAAIHGYIVAARAYYLGLRVIGV
FT                   SYVSQQGQMVNETGPAFEYEYYSEYSYSAAMKDLLVANKVIG"
FT   gene            34854..35720
FT                   /locus_tag="ASAC_0029"
FT   CDS_pept        34854..35720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0029"
FT                   /product="Fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18437"
FT                   /db_xref="GOA:D9PZE9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZE9"
FT                   /protein_id="ADL18437.1"
FT                   /translation="MTPHLVEVKAMTHPGVNYGAVGVRVRLGRILRDGKAVIFAFDHGF
FT                   EHGPKDFPEDRVAARNIIQQVVDAGVDAIMLLPGMARLTHDIWAGRTALIVKLTSKTEL
FT                   RPESSIYLQTRLATVEDAVALGADAVAATVYWGSEHESEMMENWMIIKEEAEAYGMPAL
FT                   QLAYPRGSHFKNWYDPEVVMYGVRAAIEVGADLIKTYYTGSRETFAKVVEMAQGIPVVM
FT                   SGGAVRDRPVDFLTDLSNVIAAGGSGVAVGRNVFRAKDIKSMARAVMAVVHEGLSPEEA
FT                   AKRFNLE"
FT   gene            35739..36701
FT                   /locus_tag="ASAC_0030"
FT   CDS_pept        35739..36701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0030"
FT                   /product="ATP-dependent 6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18438"
FT                   /db_xref="GOA:D9PZF0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF0"
FT                   /protein_id="ADL18438.1"
FT                   /translation="MEQKDLDVVAIGHALVDLRFTVSKFASPDEEADIEEQSTGPGGSA
FT                   INVALITSRLGGKAAVITKIGLDNFGRQIVEELVRSKVDISGLKVGFGSTGFSVLMIDK
FT                   EGNIVLYGYKGCAEKLDPDEIDEKVIARGKFVHIASLRPDTSLRAAVRAKELDAMVSWD
FT                   PGRRLSMAGLKALRGLIKFVDIVELNSRECANLTGIRDPVACAEEIQRVGPSTVIVKMG
FT                   PRGLYALSDDFTGYVPAFKVSVVRDSTGSGDTFAAAMLLRLSRGDKLRDALVYAQAVAA
FT                   LKVTMLGANALPPIEEIEKFYQEHRKEVEAGIADKPPAE"
FT   gene            36707..37291
FT                   /locus_tag="ASAC_0031"
FT   CDS_pept        36707..37291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0031"
FT                   /product="Probable aromatic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18439"
FT                   /db_xref="GOA:D9PZF1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF1"
FT                   /protein_id="ADL18439.1"
FT                   /translation="MPCGTLSVAITGASGVRYGIRLLQAASELGLRLSGVIVTRSADLV
FT                   AQAEEGMRAGELLELASRYSQTYSEDDMTSPLASSSSQPDCMAIVPASMKTVALIANGL
FT                   ELNLVARAALAMLRLRRPLVVAFREAPLGVAELRNLLSLAEMGAVVMPLAPGFYSKPRT
FT                   VEDLVDFMVGKILDSLGVDNSLYLRWRGGRP"
FT   gene            complement(37266..37874)
FT                   /locus_tag="ASAC_0032"
FT   CDS_pept        complement(37266..37874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18440"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF2"
FT                   /protein_id="ADL18440.1"
FT                   /translation="MARKLIVFDCRDVRVVDPSQLSQLDREGPGDLFIVLIDGDVIASG
FT                   RLTVVRNIVEGQQEAQQAPAAQQAQRGERGGVAAVLDQMFRGYYPDVIEREEPDVELHV
FT                   IVGRGLQAPQQAGPRRVLEPANDDFDVLKVVERVARGARRVLFFTGDKRLAGQAEVTAS
FT                   QLGNVEVHYMPPNEFPGKESLAKAMIEAIEKAKASLPST"
FT   gene            37942..38628
FT                   /locus_tag="ASAC_0033"
FT   CDS_pept        37942..38628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18441"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF3"
FT                   /protein_id="ADL18441.1"
FT                   /translation="MLIMGESITSNTIIERLITMAQGVEDTSSHMLQVLSSAPISPELI
FT                   EKTYRQDLLQFRDVVTKGKEGLLDYIANGRLSLIAYKEFYIEAALQMECIMSRLEAGTY
FT                   RLLLSLSLERNLPESLVESVRGLLRELQGSSIALVDMLRASEGPVKDPAARRKLLDDKF
FT                   DLVSESEKRADAIYREALAMVAERYSNEAAKLLMLKEVIDSFEDAVDCAYNASTYVRLV
FT                   GLGLLS"
FT   gene            38612..39175
FT                   /locus_tag="ASAC_0034"
FT   CDS_pept        38612..39175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0034"
FT                   /product="tRNA-splicing endonuclease subunit alpha"
FT                   /EC_number="4.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18442"
FT                   /db_xref="GOA:D9PZF4"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016442"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF4"
FT                   /protein_id="ADL18442.1"
FT                   /translation="MDSSAEPVRAKLIGGVVVVPSVEGSRRLYSIGFYGRPMGVEKVRD
FT                   PSSISSPLVLDPLEALYLVERGMIEVEGEDGRVLDFSGLREALGLTGRQEKLYLLYRSL
FT                   RSRGLVVRSGLKYGASFVAYRKGPGLEHAPFIIHYYDPDEPFDPVELVRAGRLSHSVKK
FT                   TFIVATTGQVGEEPYYIMLKWLRP"
FT   gene            39207..39596
FT                   /locus_tag="ASAC_0035"
FT   CDS_pept        39207..39596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18443"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF5"
FT                   /protein_id="ADL18443.1"
FT                   /translation="MSFGHRRQGDPRPEASQGTRQEPRPKPIGDRCNPLCPFFRCGQRA
FT                   LRVSVEHYRGRPVKVAMCSLVGDRCVGTQCRYAYCEKKAMLPDGRCSFAIESRARQVKS
FT                   FEEELKEEGELPGLAIKDKRLSDEL"
FT   gene            complement(39565..40443)
FT                   /locus_tag="ASAC_0036"
FT   CDS_pept        complement(39565..40443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0036"
FT                   /product="Cation diffusion facilitator family transporter
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18444"
FT                   /db_xref="GOA:D9PZF6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF6"
FT                   /protein_id="ADL18444.1"
FT                   /translation="MISRSLLRHASRLFLVTGLAGLPLAVYELYLGLGRGYYLLQADGY
FT                   HALFDSLLAVLYAVLLKVAYRRSRSFPWGLYNAEGIVTILVSIFVVYLVASAFADSLAG
FT                   PQVMPSWTSWILWASAALSASVAIAEVRYMRLLIVKSDLMHASVDTALDLVAGGVISTA
FT                   YFSLTPVVLGAMMLVVLYNAAESSWTSLQSLLGAEVFGTGLREAIGRGIAAMGLRPLRI
FT                   YVARAGSFYLVQAIIALPPETTLARAYRIKKRVSRLIASFDGVAIADVRVVPSSELRQQ
FT                   GARARRTASYL"
FT   gene            complement(40542..41348)
FT                   /locus_tag="ASAC_0037"
FT   CDS_pept        complement(40542..41348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0037"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18445"
FT                   /db_xref="GOA:D9PZF7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF7"
FT                   /protein_id="ADL18445.1"
FT                   /translation="MDRAVAVIGAGTIGGAIIRGLLRAGGGYRVVATARSSSTVERLRG
FT                   LGVEATTDNVEAVREADLVILTVKPYVVADVLREVAAELEGKPLVSLAAAVSTGYIASR
FT                   APKAKVIRGMTNINVEVNEGFTTLSAGPNCDQAARSAAEELFRRLGTVEWVDERYMDAL
FT                   TALSGSAPAFIAEVIDALALGGIAAGLPRDLAYRATLMAMMGTSRNLLETGRPPHQVRD
FT                   MVLTPAGTTIRGVMVLQGNGLKRTLMEAVLEATRRAKEMRDEMGLS"
FT   gene            41419..42204
FT                   /locus_tag="ASAC_0038"
FT   CDS_pept        41419..42204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18446"
FT                   /db_xref="GOA:D9PZF8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF8"
FT                   /protein_id="ADL18446.1"
FT                   /translation="MLSEDGARLLRDTMDMPSIFLLGSLEGTQWLSSLEEVREVDGDVV
FT                   GLQRSNYSEDYFIDVVCRGPCSGALGAALDYLRSYGRAWVSTSNFGVIQELVRGGARVE
FT                   GLTAFHVMEVDRASFRRFEGRPDFIQFSTLDEHHIEDLRDLLSKWDESRAQWADDMIMR
FT                   STAFGAWDGERLVGVAATYAMAEGWWYLGSLFVDPEYRSRKVGISLSSVATEEALARVE
FT                   RVYITVEVDNITSLAINSLLNYRSRGISYLALVSLAQSP"
FT   gene            complement(42192..42992)
FT                   /locus_tag="ASAC_0039"
FT   CDS_pept        complement(42192..42992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0039"
FT                   /product="Putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18447"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZF9"
FT                   /protein_id="ADL18447.1"
FT                   /translation="MALKFIVMVGPAGSGKSTLTMQLASAMESLGATVVKVNFDPAEDK
FT                   PPYEPDVDVRDYVTAEEFMEKGLGPNGALVSAIDSLINHVDKVREEVEQFRPDYVIVDT
FT                   PGQLEPFAYRVGGPLVLDALIQDDKAVTVFLMDSVFFESPADIVSILTLASSVNVRLRR
FT                   PQVNVISKADLLSPEVVNNVLPMLHEEGYLEAAVRDSKVLSGTELNLSLSLARALYEAG
FT                   YIGEILPVSAYDDVSLKELYGKVQEVLEGGDDYRIYDVDEDQGD"
FT   gene            43127..43504
FT                   /locus_tag="ASAC_0040"
FT   CDS_pept        43127..43504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0040"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18448"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG0"
FT                   /protein_id="ADL18448.1"
FT                   /translation="MAELVECSDDFRVERAHLAVSVGSGDVEVLSTPSLLAFVESVASR
FT                   CLSGAVSPGYTTVGTYVELRHKAPAPQGATVKVTVRVENFDGKRARLSFRAECCGRLVG
FT                   EGVHERVVVNKDDFLRRAGVR"
FT   gene            43547..44581
FT                   /locus_tag="ASAC_0041"
FT   CDS_pept        43547..44581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0041"
FT                   /product="Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18449"
FT                   /db_xref="GOA:D9PZG1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG1"
FT                   /protein_id="ADL18449.1"
FT                   /translation="MIYVRLGWSGVKVSRLCLGTWHLPPSRQVDEFGVLKVDEEEALKA
FT                   MRRAYDLGVNFIDTANRYHGIMQPVDLNHVGNSERVVGKFLATVDRESIVLATKVRGQM
FT                   AAWPNGEGLSRKHIMWQARESLRRLGTDHIDLYQLHWPDPDTPKLETLRALQDLVRMGL
FT                   VNYTGISNHPAHDVVEFLELADRVGVDRFVTMQELYNILERGIERDGRLEVAKRYGLAV
FT                   MVYSPLAQGVLTGKYYDFKENRWAVPELSRASITDEIRRRYFSDRTAAVLKAMKEVADS
FT                   KGITMAQLALAWVIKRSEQLGVTLIPITSATKASHIDEAVEALSVSLKDDDMKAIDEAL
FT                   QGRG"
FT   gene            complement(44578..45777)
FT                   /locus_tag="ASAC_0042"
FT   CDS_pept        complement(44578..45777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0042"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18450"
FT                   /db_xref="GOA:D9PZG2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG2"
FT                   /protein_id="ADL18450.1"
FT                   /translation="MSGRRLPVIVASATVTMFAWGVVLALAPLLTEWPVVPSSYDVYLL
FT                   VASPASLLAGSFIMGRFTDAFGRKSGFIVDMVLFAASIPFILFATGPLDLIVGIALAEF
FT                   SLGGDETTLLAYLAEEAPEAHRGKILVGVTNAANVGALTASAISLVTSFSVGLQRLAFA
FT                   LLLASAVPVIVVTRFMAPESFRWLKYRSGERVSLGRGDYAVRVYLLLTMAITVVLTYAL
FT                   MALVIGPYLFPRLTSLIVFTYNLGESLAGFALLPIIDSTSRRTFPFIAYLGGVITMALF
FT                   IPQYVVARSSLMAFESLLFLNGVFGEMAWAARVVLEPELFPTRLRATGVGAVRAAAYAL
FT                   YTASIFFTQPFSEFSYLVYNVGLWAVGLSGAALWLARGMDTARRPLEAISDIQVPVRKR
FT                   "
FT   gene            45891..46130
FT                   /locus_tag="ASAC_0043"
FT   CDS_pept        45891..46130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18451"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG3"
FT                   /protein_id="ADL18451.1"
FT                   /translation="MISQSLKLKDGETLRVESFKGDRWLEITRKRGDGFSVTEHGFKNA
FT                   TYEVGEEELRQLLRRLIDFEFPRSHQLRVSKSKG"
FT   gene            complement(46119..47321)
FT                   /locus_tag="ASAC_0044"
FT   CDS_pept        complement(46119..47321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0044"
FT                   /product="hypothetical protein"
FT                   /note="DUF162 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18452"
FT                   /db_xref="GOA:D9PZG4"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG4"
FT                   /protein_id="ADL18452.1"
FT                   /translation="MSDELLEGYARAILRALEDPDLQEALHTYVPGSEERVRRFLESRP
FT                   DIVQLAREVKAIKEYSIAHMDELIDEAMRSLKSVNAVPHYAADAREARELALSLVGRGK
FT                   VVVMSKSMTAEELGIREALEEAGNEVWETDLGQLLVQLEGGKPMHSIAPAIHMTVARVA
FT                   QLLRDRLGLDVSPSDAPQQMVAKVREFLRSKFVSADVGISGGNALAAREGALLLVENEG
FT                   NIRMVTNLPRLHIAFVGVEKLVPTMLDAFKVILVQAAFAGLYPPTYVSLIAGPSSTGDI
FT                   GHRRVYGAHGPVEVHVVLVDHGRRAAAKDVVLREQLRCIRCGYCQFVCPVWGQVANNWG
FT                   GSTYGGPMGVNWTAITEGVDRGAALAMLCLGCGRCDVACPVEIPISGILADLKRRFTSS
FT                   L"
FT   gene            complement(47314..48156)
FT                   /locus_tag="ASAC_0045"
FT   CDS_pept        complement(47314..48156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18453"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG5"
FT                   /protein_id="ADL18453.1"
FT                   /translation="MALGGGGSGRLLFTGALYQLVPYIEGTVELLRSLERAEGVSWAAL
FT                   RAARVASRRLDLSLLVRPDPELVEWSRRVLRSMARLLLASGAEFDYVPELSDMYSGALL
FT                   RDYGMAEAFRRHAERVVRAVRSAGYEELIVVDPHTMDTVTRGYQEVLGEGLRAVNYMEL
FT                   VRPTARRGLAATVHDSCVYARKLGIVDRPRELLREAGVNVTEVSRSGRWTYCCGGPLEA
FT                   LLPSLAQAVAATRVRELAGAGDTAITMCPICYVNLRRASRSSGVPIRLLDLAEVIGGE"
FT   gene            complement(48337..49104)
FT                   /locus_tag="ASAC_0046"
FT   CDS_pept        complement(48337..49104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18454"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG6"
FT                   /protein_id="ADL18454.1"
FT                   /translation="MSQSKVDKYTVIELRLTDAELAALERRAKDAGYQDVRSYLEAIVK
FT                   GGGPSPPAQGESLEGLAKRLERLIQDMLNPFTQKVDDLAKRLAQIEEDIESLRQERQAA
FT                   QPQAERREAEAGGRQGGSTAVERLRRQGVVFQEELPWLKAPDKFFAKLGREGAVVLTLS
FT                   DGKAAVDPEFWKKFVAEVESTSLKDPRQVSDKVQADMGDRAAALFNKMVRSGLIIYDED
FT                   TKKWRVAKTAGKGSGGPPEYEAEEDEEDEEGYL"
FT   gene            complement(49173..50093)
FT                   /locus_tag="ASAC_0047"
FT   CDS_pept        complement(49173..50093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18455"
FT                   /db_xref="GOA:D9PZG7"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG7"
FT                   /protein_id="ADL18455.1"
FT                   /translation="MQSQLSLTEEDMRKIEAYCRDELGTYLLYEALADEEEGELSQKLR
FT                   QAAEQERGHYLFWRSLLGRDCQASPPGRAFRLLYKVFGPVFTLEALERREASAAREYRR
FT                   FMPRMPQELRPRLEQIIADEEGHESEFLRGLKDVRVEYLGFVALGMADAITELVGVYAG
FT                   FLGATARTLIVGLAGLLVGFSAAISMAAAAFLQSRQEGTTRPGLSAAATGLSYFVTALL
FT                   LGIPYLLLSSTAEALAASLMIGIGVLAAFHFYSATVNGTSFARELGLGLLILLGATAAG
FT                   LLFGDVIGRAFHLTGLFSVALQALR"
FT   gene            complement(50144..50659)
FT                   /locus_tag="ASAC_0048"
FT   CDS_pept        complement(50144..50659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0048"
FT                   /product="NUDIX hydrolase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18456"
FT                   /db_xref="GOA:D9PZG8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG8"
FT                   /protein_id="ADL18456.1"
FT                   /translation="MSEPRLSSSEELCSGARVRLERVRFSYNGREFDADRVTFGLSVAV
FT                   LPVLEDGRVILERQWRPATGSWVLEAPAGRVERGETPEEAAMRELEEETGYRASRLTKV
FT                   YEAYVSPGYSDEVQHGYIAEGLTRVGQRLEPDEVISLAFMRPEEALGQARDLKTIALLE
FT                   AYVNLRRG"
FT   gene            complement(50656..52596)
FT                   /locus_tag="ASAC_0049"
FT   CDS_pept        complement(50656..52596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0049"
FT                   /product="acylamino-acid-releasing enzyme"
FT                   /EC_number="3.4.19.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18457"
FT                   /db_xref="GOA:D9PZG9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZG9"
FT                   /protein_id="ADL18457.1"
FT                   /translation="MSPEDLSKLTLVSSPAASPDGSRALFVVSRPDLQQNRYDSSIWLY
FT                   DGRSYYPVTSGPGDSCPAWSPDGQTIAFIRTVRQEGQPAQTSVMLMRPGYEPVPLFTWS
FT                   FGASAISWSPAGSSIAFLARRPLGQGEWKDYSKREALVIERLPPFFNGEGYIFDRPRNI
FT                   YLVSANGGEPRRLTSHALDVSDFAWSPDGRSIAYVKQLEEVHAQYDELRLINVETGEDV
FT                   QLLSKVSIAGLAWSSDGNSIALLMHRFERGLSSHYKLHSYNLKTGELTKVELGLDRNLL
FT                   NSVNSEARGPSCTKPIQASGGWLYFSVSDAGRAWLYRATLSGRVEPVLRPEDAVIDDFS
FT                   VAQSSDVVYYTQMNESEPAELYVLRGTSGKRLTSFNDDFLRQASLPRAFKARARARDGT
FT                   ELDFWALLPRDAKGKVPWMLYIHGGPKTSYGYGFMVAFHVLASAGIAVVYGNPRGSDGY
FT                   SEDFADIRGRWGTVDYEDLMTIADEATRQFQQLDPGRAGVAGGSYGGFMTNWVITHTSR
FT                   FRAAMTERSCVEFYSDWGTSDIGWFFDEDQLMAQPPWKSAEQYLKASPMTYIESVTTPL
FT                   LIMHALEDYRCPVSQALQLFTALKVLGVEVKLALFPGEDHDLTRSGRPKTRVEYLKLML
FT                   DWMKGHLGEGR"
FT   gene            complement(52661..54985)
FT                   /locus_tag="ASAC_0050"
FT   CDS_pept        complement(52661..54985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0050"
FT                   /product="Probable aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18458"
FT                   /db_xref="GOA:D9PZH0"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH0"
FT                   /protein_id="ADL18458.1"
FT                   /translation="MAFGPKATIKRYVIFMDFDGFRYRGHESIELETQEDLRLDAKGVK
FT                   VTSVKANGSPVQFAQDDEGVTVRTGRFSGTLEVDFEGEAAEKLVGIYRAPYEGGYVIST
FT                   QFESVHAREMFPCVDNPAYKARFKLSVRVPRDLHAISNMPIERVTLDGDKKVVEFMETP
FT                   PMSTYLLYVGIGKWEEVVDSGGRYVLAAVPGKTKYGSLALWAARNSVDFYERYFGIPYP
FT                   LPKMHLIAVPEFAFGAMENWGAITFRESALLAPEDADMAQRRRVAEVVAHEIAHQWFGD
FT                   LVTMKWWDDLWLNESFATFMSYKAVSSFAPELLMWENFLLGETDGAMVRDSLSTTHPIH
FT                   VEVSSPDEIEEIFDDISYGKGASILRMVEYFLGESFRKGLSSYLEHHAYSNAVAQDLWT
FT                   AIQPFTSVPVADLMNDWITKPGYPYLRVTVEGSRVRLEQHRFSLSGKLEDLTYMVPATI
FT                   EVNGRRVDAIFSSRVHEVDVGEEVRQLKVNLDRAGFYRVLYPDLSRLARLNQFETYGLL
FT                   NDYYYFMLAGLVSRDDYLRVVDMNFSVPDYLPALELSSELFNLFLVNPAVFAQRAIDYH
FT                   RSQFALQSRRPEEQHRELAGRVANRLAIMDRSFANELASQFGKEVDPNMRQAVYTAYAV
FT                   AAGDLEGLRREHERQQLDSERIKVLVAAAQIRDRSALQQAIEWIASGKRQDMLYVLTVG
FT                   LNPDGRDLVWGWLRDGGLDRLEKAFEGTAIVQRWLLGYLPFIGLGREKEVSDFFASRPD
FT                   GRSAEVRGGLEILEAYSRLRQ"
FT   gene            complement(55071..56453)
FT                   /locus_tag="ASAC_0051"
FT   CDS_pept        complement(55071..56453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18459"
FT                   /db_xref="GOA:D9PZH1"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH1"
FT                   /protein_id="ADL18459.1"
FT                   /translation="MDIRRALAAAASMLLIAAIVLYPATSLAEGVHVNKSNYIYVYPNS
FT                   AVVVLVNGTASLEHEVPRENLSLEVTYYSASTYLRLTYSGQLPRHAHFKFSGMGKFEGS
FT                   GLGLQSLNASGFINRTSNGRASELRFNGTVAVVGSEGQFEANVSLYRLIEAVTSPSPEY
FT                   VITLNVNVSHTPYLAPIQLAKYESLNTTGINITELKVYENSTFTEVLLKAVVNATPAPP
FT                   NTTLGLVQALIGAALTPGFINGSYHYYVNYQARVASGEVSVNASNDLIGLLGKALTGGA
FT                   QALAKQGDLQGGADLGDYGGLLGELADNAEPFINATSELISYIQQNFRVVVPSTEEINV
FT                   TGYGHSVTFSFRSPMIIKANAKSPKDTLVAIQYLFSNASQFYEQNGLDHIAKAFASVEG
FT                   EEVTLVGVDGVAVKPSQTTIGNLSSVVVTVPSGSAPAKEVIGGSAVVVGLLLVAFFLLR
FT                   RH"
FT   gene            56589..57854
FT                   /locus_tag="ASAC_0052"
FT   CDS_pept        56589..57854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18460"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH2"
FT                   /protein_id="ADL18460.1"
FT                   /translation="MIPRWAVAVLVYSILIAGAIFAAAYPYVSASTDWGVLLEGRRLIY
FT                   FSPSSGWVVADGNGTAVAYFNGRWLSLNVTATAACQLGDQLIVVGSSHDRPSLVDLSGS
FT                   EATYYSVDDYGYLTAVSCQNGVVAAAGVLNTTPFPPYRLLAVSLRNGSLRAYATNFTTL
FT                   VPPYSAAPLSGGVAVAFSDSYLVYVNPSGAQAYYYGSNVTIDYVGSYDGAPLLAGSEMV
FT                   NDLQEAMISLNGTAYVYSDEAYVFAAARTLNGLALYLRPPSGWASVLYTYGGLPEAETT
FT                   AALDYPFSLTAAYPFLHGIVYLGQLFVGSGSDYIALYINGTVQGYLEANGSVIGWATSS
FT                   RPAVVTPSLLERSHLSPLGSYRLSLQGLNVSASRGEPAPTGPLRLEPIRLEHGFYNNAV
FT                   GYSVDAIIVGTIILAFTERRSL"
FT   gene            complement(57832..59004)
FT                   /locus_tag="ASAC_0053"
FT   CDS_pept        complement(57832..59004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0053"
FT                   /product="Sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18461"
FT                   /db_xref="GOA:D9PZH3"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH3"
FT                   /protein_id="ADL18461.1"
FT                   /translation="MSRMASQPHGGRLIDRVARGPRAEKLSCEAAELPAVELSGALAYD
FT                   VANITHGVYSPLEGFMTEDEYESVLRNSRLTNDLPWTIPIVLDVEPRLAKEVLGSEIAL
FT                   SYKGVRFAIMSVEDAYQWDRKAFAERVFGTTDQAHPGVALLYRREGQALIGGKVEQFAE
FT                   LPEPFEKYRLWPKETRVLFDQLGWRSVAAFQTRNAPHMGHEYVMKAALSFVDGLFVNPL
FT                   VGWKKPGDFTDDAIVAAYEVLLRDYFPRSSYVFSVLRMKMVYAGPKEAIHHAIIRKNFG
FT                   ATHIIVGRDHAGVGSFYGPYDAWNIFKEFPDLGITPLFLREAFYCVKCGGIVNDKICPH
FT                   GDEYRRRISGTEIRKLLSEGQRPPDYMMRPEVADALIKLRDRLFISSSSQ"
FT   gene            complement(59006..59245)
FT                   /locus_tag="ASAC_0054"
FT   CDS_pept        complement(59006..59245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18462"
FT                   /db_xref="GOA:D9PZH4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH4"
FT                   /protein_id="ADL18462.1"
FT                   /translation="MARRPEGERGRYTTVSIPTPLYDRIKSLIAGTGFNSVSQFVTYVL
FT                   REVVSDMEREKVQSAVSEEEKEEILRKLKSLGYL"
FT   gene            59357..59899
FT                   /locus_tag="ASAC_0055"
FT   CDS_pept        59357..59899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0055"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18463"
FT                   /db_xref="GOA:D9PZH5"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH5"
FT                   /protein_id="ADL18463.1"
FT                   /translation="MRGLVAWLTGLPGSGKTTIANAAAERLRAMGYRVEVLDGDWFRSH
FT                   IDPEAGYTKEERVRHLVRASWVARLLARNGVIVICSFVSPYRDAREEVRKIISEEADFL
FT                   EVYVKCPLEECIRRDPKGLYRKALAGEIRHFTGISDPYEEPLSPDLVLDTVNNSVEENA
FT                   EKLVNLITSRLRGSRAS"
FT   gene            complement(59877..60092)
FT                   /locus_tag="ASAC_0056"
FT   CDS_pept        complement(59877..60092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18464"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH6"
FT                   /protein_id="ADL18464.1"
FT                   /translation="MALTEERAQVSIPRDLYEKAKNYVEAQGTFKSVDELVEFLLRQLL
FT                   EEQETSVMSKEDEEAVKDRLRRLGYL"
FT   gene            complement(60127..60501)
FT                   /locus_tag="ASAC_0057"
FT   CDS_pept        complement(60127..60501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18465"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH7"
FT                   /protein_id="ADL18465.1"
FT                   /translation="MDWLAIERAMVKAPYHVDYVVPKDSVPRPEEQCLEPSFGKPRGQL
FT                   RNWRATLSDGSCLHVLEFKHFYVVHRDRANLNDSVIRHVALDEPSMAVLSFWLPLLELL
FT                   RALLRARRRKRLRAMGSPCY"
FT   gene            60560..60988
FT                   /locus_tag="ASAC_0058"
FT   CDS_pept        60560..60988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18466"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH8"
FT                   /protein_id="ADL18466.1"
FT                   /translation="MSEECRGTLRAVAGLIALGMTKEMIRAALHYDFKLDMNDEQFESL
FT                   YFRAAKCVEEGLVKVRSWSTPFRPGDCNNEVVREVAAMIMRGEDLDSIVPAVLRRHYML
FT                   RSGTAYRVLTQRDVEYAYDVALLCIKDKVERAKKWSAP"
FT   gene            complement(60977..61963)
FT                   /locus_tag="ASAC_0059"
FT   CDS_pept        complement(60977..61963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0059"
FT                   /product="Putative xylose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18467"
FT                   /db_xref="GOA:D9PZH9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZH9"
FT                   /protein_id="ADL18467.1"
FT                   /translation="MRIAVVGSRGFGSVHLAAMSRLKDEGFDIEYYTYSSSEQEAKAIA
FT                   ERFGAAGYFTNYDDVLSSKVDAVDLVISHDAHMPMATRALRAGKHVMLEKPIARNMEEA
FT                   EAIVRAAESSGLKFMVAENYHFDETFNELYRQLPNVGRVHTVIVRDIHYNQPRTWRKVK
FT                   ELMGGGAVIDGGIHMIHVMLNVAGDYSSVCSMVYRTGSVDMEGEDVGVAMFNFRSGARG
FT                   VYMYGWAFRSAAPAPIIEVYGDKGSIYEDPSSRLFLESRGFRYFARHGDLVVNGSRVEV
FT                   AKKDMIGEEVRAFADYVDGRRKDNPMPTELELRDLRAVLDIYSSSRC"
FT   gene            complement(62011..63381)
FT                   /locus_tag="ASAC_0060"
FT   CDS_pept        complement(62011..63381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0060"
FT                   /product="Dipeptide/oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18468"
FT                   /db_xref="GOA:D9PZI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI0"
FT                   /protein_id="ADL18468.1"
FT                   /translation="MSEEAGSSFTFYLKYVLKSKSALAALVIIFVFVGLAAYVSTWPKS
FT                   VAFNYINNLQYWESAYPTVAAPSWMAALSPSSYAPSLYVNPHSVKVYEHVGTVYVYELT
FT                   YIFEWRYSKVPTDVVFNFASNATMQYMLVEWVKPSGSTVNATVTVTGTTYSFDLSALAK
FT                   PLSAYLLQKTGTVPTVLTTQALATALFSNLSRRTVGPTELGTYRVNVFIATAGPAKFKA
FT                   AQVRVMGNAYGALGTDIYGRPIFLGILLGLPNALEIGVVTSLLGVLIGAFIGGYAGFLG
FT                   GKTDAALNWFSTVILALPALPFLVALGLLLKSGLSIMEEALLITFLSWPFYAIIARSAA
FT                   QSIKTNSFVEADKLMGIPSYRTFLTHFLPRLVPFIVAYTVLGIPGAILLVETLAFIGIA
FT                   PPNIVTWGGILDAAYDANAALNGWWWWILFPGLMIVFVSLPFVVVGFAIERASFGGR"
FT   gene            complement(63388..64461)
FT                   /locus_tag="ASAC_0061"
FT   CDS_pept        complement(63388..64461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0061"
FT                   /product="Dipeptide/oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18469"
FT                   /db_xref="GOA:D9PZI1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI1"
FT                   /protein_id="ADL18469.1"
FT                   /translation="MGYKTFLAKTAIIYITVLFAAMIILYVFTYPVIQKLYADYVKYSA
FT                   SQLKTELIRHARGSLNLTQVNLEVESYEKSLEAAYGLNQPLIVRFALQMKALITFHFGV
FT                   TPPGVSYPGYTSSNNIAQIIAVALPRTIILFTTGTIIIIAVGTLLGVLAARYQGSAYDK
FT                   AIPVIAVVHQSLPTWWIGFLLIAGLAYGLRWFPPGGIVSAGLNFSREPLQYVASLLDHM
FT                   TLPLLAFFIVNVGGFAYVVRSLTLATTKEDFVLTAKARGLPERRIVFGHILKTASPSIA
FT                   TQAMLWLASSFAGGLTTEIVFVWPGIGLLTYYAVLESDEATVMAITYVLTLVLVIALFL
FT                   NEIIKGILDPRIRASQG"
FT   gene            complement(64485..67202)
FT                   /locus_tag="ASAC_0062"
FT   CDS_pept        complement(64485..67202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0062"
FT                   /product="Dipeptide/oligopeptide ABC transporter,
FT                   dipeptide/oligopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18470"
FT                   /db_xref="GOA:D9PZI2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI2"
FT                   /protein_id="ADL18470.1"
FT                   /translation="MKLVLVASLFVVFSLVLLNPLAFTARAQTSGQPASTIILKSYSGS
FT                   DTAGVGDFDHGYIAFYDYAIPPYKMGTLPSGAVAYEMPSTYYDVLLNPVEYIQNPSGQE
FT                   VLNPFYYQSVRFAINYIVDRSYFVNDVLYGYGIPSLTLYGGEYEMLTTSNVTAKFSNIT
FT                   YNPSYANETIYKTLTAHGYKYINGQWYYPNGQPVVIYVFVRSDTTVRYIYASFLIDQLK
FT                   SLGFEVQPIYGNLQKEITDIYSMVPNETTWNVLIEAWGGTYGFYDWSLPASLYGAAFGN
FT                   LPASDAYGTAWGLGVNTTNIQEPELTQELNIIDNLSLRLALSEFTSEQQYYEWLNTINY
FT                   YGIVSAIRIGLGMSLIPIFVNSNMVTGLVPNYIEGLVTPFSFLNARTPTGTLTIGVRHL
FT                   AMGSMNPVAGFTDSYSVATASSVFLPIIYYIPGNGFPVPAGFTYKLVALSPVANITVPT
FT                   SALMYNATSMKVQHVPPNTTAKVAVIVNFAPLLQNDRFVDGQPITLADLIEQYLIAANV
FT                   SLSSNSPIYDSTAAAVYGPSLQQIVGFEILNSTSLEIWSTAWWFNPEYAALSTVGDFII
FT                   LGYAEPGGGMMPWPLYAAMAYVVAHGEAAWSTGAATSEHVDWLSLVNPTDVGNVLKAMQ
FT                   LYNSTGYIPEGLLEVQSLSGVQLVNETFAHEAYTDAINYINTYGNAVIGEGPYMLVAYQ
FT                   PGQYAKLVRNPYFNVPVPSILTSTPVLYSVHVALPPLGMVPAGGSISATVYGTPDGTNV
FT                   TTTQSGVFVIAQFVTPEGAVVAQENLTSGADGSVSIPVPASLSPGSYYLVLWAYTPANI
FT                   LLDPVKVPITVTPMVTTTTTTTTTTSTTTTTTTTTTPVATTSTTTTTTTTTTSTTPVTT
FT                   TTPKPVTISTTLIVGIVVVVIVIIAAVALLARRK"
FT   gene            67414..68391
FT                   /locus_tag="ASAC_0063"
FT   CDS_pept        67414..68391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0063"
FT                   /product="glycosyltransferase 28, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18471"
FT                   /db_xref="GOA:D9PZI3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI3"
FT                   /protein_id="ADL18471.1"
FT                   /translation="MRALIIASGGGHTGHALALAERLVDSGAIVDFVIPEGDRWSEEQV
FT                   SRLGRVVARTPKFLDPGEGLAEGVLRLPGALLRSLARVPRGYDVAVASGSNHSIASGIA
FT                   AWLKGARLVTIEATERFVEPSRAVRALSPISKLVALQWEEQRRFAPKGVVVGPLLGKLH
FT                   YRVRDEGYVLVTAGSYGYRALFDAAAASGIRDRLVLQTGRVDPGPYVRAGLRAFSFSPE
FT                   LEDMIAGASVVVTHFGRTAVEAACKYGKPTVLAPNTEWVWMRNPVRMVEASMMAKRIGA
FT                   VLLPPDQVTPEGVERAVEEAMKAKPAACDDGSVKLAQIITSWRR"
FT   gene            68405..69334
FT                   /locus_tag="ASAC_0064"
FT   CDS_pept        68405..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0064"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18472"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI4"
FT                   /protein_id="ADL18472.1"
FT                   /translation="MKFIVTGGAGFIGSNLSRLLLSEGHDVIVVDDLSSGARENVPAGA
FT                   RLVIGDVSDRRALEGVEAMARGDEVAIVHLAAVSGVVEAREDPSRAVRANVLGTQEVLD
FT                   MARRLDAYVTIASSAAVYGDVSDVPVKEDAPLRPTSLYGLTKLFDEQLAEQAYRDYGLR
FT                   SSYLRLFNVYGPGMRRGPYASVIYNFMEAAIRGLRPVIYGDGLNTRDFVYVDDVARAFV
FT                   EAVRRRATGPFNVGTGREVSVLDLLRLISKVAGVELRPEFREPRPGDIRRSCADVSRAR
FT                   ESLGWEPRVSLEEGLRLTYSYMRERLRP"
FT   gene            complement(69323..70597)
FT                   /locus_tag="ASAC_0065"
FT   CDS_pept        complement(69323..70597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0065"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18473"
FT                   /db_xref="GOA:D9PZI5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI5"
FT                   /protein_id="ADL18473.1"
FT                   /translation="MNVLSSQQIITTFHQYLQSLHLSISTSRALMAYAAGSAITVGVAL
FT                   VVELVIILHGLPRGRAQGARQPLPATPRVSVIVPTYREGERALRAVRSLLNQDYPRGLY
FT                   EIIIAAEADDPTVDGVLRALGLRKVNGSEATVDGVRVRLSLGDGMTRGKPAALNRAESM
FT                   ATGDIIGVLDADGVAPPDAISRAVSALASGYSAAQLPREVALPPEARRTFAGAHMRAQA
FT                   AEMRLYNQFLAPALMGFTGSAWITGSGYFVRREDLEAVGLWTPWAPTEDLDLSAKLLSR
FT                   DMKVAFLSGSPVVEEPLTSIRAVIRQKERWVRGSMLATFTALRGVRRTWPLLLFLIMPA
FT                   WGYLITPWLGMLAVARLHPELLTWTLAWSAVWLVPSAAYYIIAVAKAGKAVRPLPAAIA
FT                   LYLLAGLVALPKMAFRRYEWRGSRS"
FT   gene            complement(70666..70926)
FT                   /locus_tag="ASAC_0066"
FT   CDS_pept        complement(70666..70926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18474"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI6"
FT                   /protein_id="ADL18474.1"
FT                   /translation="MGWWRFGRWGGGPWPGHGPFSYLPPWERPGWAMAWYGYYGYYDKD
FT                   SELRALEAYRLYLEDLRSWADGQLKEVDRRIAELKGQQANA"
FT   gene            71065..71739
FT                   /locus_tag="ASAC_0067"
FT   CDS_pept        71065..71739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18475"
FT                   /db_xref="GOA:D9PZI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI7"
FT                   /protein_id="ADL18475.1"
FT                   /translation="MLSRVKVSFARVTADDREAVLSILRGAPELSHVDINATFDRWLRE
FT                   GYFIKAVDSDNRIVGVLHARQLEDAVWMEGIGVSSDIRRKGVGRQLAAYVMELTGGKVF
FT                   RVMASERNVPSNALALSLGFKEVDRVYFSDGARVTAPELARRLGLDEAKDVSLEGPGYV
FT                   DSWTWRPIEYYRGRVFSNGQVKVLDTDPPFFVAGDADGYMRFSRQRAAYSEAFIVYELR
FT                   RA"
FT   gene            complement(71726..72745)
FT                   /locus_tag="ASAC_0068"
FT   CDS_pept        complement(71726..72745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0068"
FT                   /product="Putative UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18476"
FT                   /db_xref="GOA:D9PZI8"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI8"
FT                   /protein_id="ADL18476.1"
FT                   /translation="MLQEAVVAVISSLVAMGSVMALEPSWIAVASSRGLVGSDMNKPDR
FT                   RKVAEAGGLWVIVGASLGLLVMEAINTFVNGSLYNPVPLFSMLSLLMLTGLIGLLDDIL
FT                   GWKKGIPPAVRVLSTIPAALPLMIAKYNAYIVHVPILHVLYLGLLFPLVVVPVGVMGAS
FT                   NAYNMIAGYNGLEAGMGVVMLAFTAAFSIVKGLWLTAYLSLIMMAALLGFLFYNWYPAK
FT                   VFPGNTMTYAVGAYYAGIVVLGDIAAFGLFMYMLYYAELLLFIRGLMHGVYKENFGRVR
FT                   PDGSLEPPYDRSYSLTHLMIRLQRRLMGRATERGVTVGLMALQAVVGAAALLIFLRLS"
FT   gene            complement(72779..73723)
FT                   /locus_tag="ASAC_0069"
FT   CDS_pept        complement(72779..73723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0069"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18477"
FT                   /db_xref="GOA:D9PZI9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZI9"
FT                   /protein_id="ADL18477.1"
FT                   /translation="MASLLRYARRIMGRRLTWAAYNAMATVARGLRLVDPSREGRPLGI
FT                   SATVIVYNDPDWLPLALEDAASVADEVLVVDSSDPWDETEQVLEDARSRLGVRVVRQYP
FT                   PRGYAEARELALRESRYRYILVWDSDFIAFEGLGRALRDFVEGEGRDRYVLLYWPFITL
FT                   CGDLSHRCRADRLHEEHWAFTYSRRLRYLWDGRFEYLYAPPYYFRRRLSSSPMGLHLTG
FT                   VRRPERVAVKRLMPRADFYSIASTQGVGKAMEAVRAEARRLYGTDDLREVGLRIMEEDA
FT                   RGRPCFDVGLLPSKVLRRAREIGVPLGSCGSNA"
FT   gene            73795..74256
FT                   /locus_tag="ASAC_0070"
FT   CDS_pept        73795..74256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18478"
FT                   /db_xref="GOA:D9PZJ0"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ0"
FT                   /protein_id="ADL18478.1"
FT                   /translation="MNWDDVVKVVLSMPPHRDLALLKSQLPSPRLSGFRRRWLSEPRGQ
FT                   RADWEKVMPDGRSVHVREYRDHYLVHWDIASPSRSALRHLVYDAPHWLIVAVAAAVTAI
FT                   SVLLGPGAKVGAAGGLMATGNMLLGYRRSLIAPAEPLRLQGQLEGVLTT"
FT   gene            74276..74599
FT                   /locus_tag="ASAC_0071"
FT   CDS_pept        74276..74599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18479"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ1"
FT                   /protein_id="ADL18479.1"
FT                   /translation="MSSRAKYMALGVLDGTSVAVEKVVENPALNARERRPTFIRACREA
FT                   GAQVVIAAHGSYCIPSALEARRGRLRLLVGEGRPEDLRLREAGAWEFIYSSLLATFERA
FT                   KGH"
FT   gene            74610..75290
FT                   /locus_tag="ASAC_0072"
FT   CDS_pept        74610..75290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0072"
FT                   /product="Sugar fermentation stimulation protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18480"
FT                   /db_xref="GOA:D9PZJ2"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ2"
FT                   /protein_id="ADL18480.1"
FT                   /translation="MAYTFEGPLREARVRGRPNRFLVILDDGTECHLHDPGRLRELIYP
FT                   GNRVLVRPTRGLRTSCSVTAAWSNGRWVVVDSRIHNRVASLFLPPEATPEVRVGDSRLD
FT                   FKYDDTYVEVKGCTLVVGGVALFPDAPTERGRRHAEELARLREEGHGATMMFLIMRDDA
FT                   LCVSPNWSTDPAFSSQFVKMVEAGARVEAHKFRLEGNRLIYVGDVPLCDGVLSGMPRAP
FT                   PAAP"
FT   gene            complement(75253..76602)
FT                   /locus_tag="ASAC_0073"
FT   CDS_pept        complement(75253..76602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0073"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18481"
FT                   /db_xref="GOA:D9PZJ3"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ3"
FT                   /protein_id="ADL18481.1"
FT                   /translation="MARRLFVLGLDSLPPYVLYEGHDGGGFKFIRGLVEDSARYLMRTC
FT                   HPPITVPAWMVMFTGRSPGELGIYGFRHRRPGTFDSYVVTSQDVREPAIWDDLGRRGLR
FT                   FGLFGVPPTYPPRPLNGFMVTDFNTPGPQKPYTWPPWLRQELQSSVGDPLFDIVYRTED
FT                   RDAARRDLLAMVENHGRIVKYLAEGKAWDAFIYVEIGIDRAHHAFWKYFDERHPRYTYH
FT                   EVYSRVIPEVYSRVDSWLEEMARGPLRDSIIVIVSDHGTKSMHGAFAINQWLEQEGYLK
FT                   LKERPRSPGTDLTPDIIDWDHTRVWAWGGYYSRFFFNVRGREPHGIVGREELEDLVREV
FT                   KGAIMKIRGPNGEAWRNEAYEPQEIYPVAKGDAPDLTVYLDDLNWRPIGTVGWPSNYTD
FT                   RNDKGPDDSMHDWLGVLSVYDPEGTVSRGDMGVIDITRVRGLLEELLASR"
FT   gene            complement(76730..80884)
FT                   /locus_tag="ASAC_0074"
FT   CDS_pept        complement(76730..80884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18482"
FT                   /db_xref="GOA:D9PZJ4"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ4"
FT                   /protein_id="ADL18482.1"
FT                   /translation="MLRSYKALAAVVLALVLLAPLLGAAAAKAYSLQPGTGKVFTKEVS
FT                   VNGMVEFAFNLSPAYEGAEAHIYLSANGLPNVYYGDVAITPAFSTSNVTAVIGNITISA
FT                   GDVYNFLWSLSTNGSSEDALSAGATKETTVLKDLITQGWALVYLKYSTAAPVQYGGSAP
FT                   AIAAGPFNLTIKPMIKVTIKPMNNLSYVPIAQVTTANKAFLNVTGANQFASGIISDVVS
FT                   NKMDYDLYGSFSNFSVTTGSLLIGGNYPTTSSDVFSSVSLNSSATPPSLGISGTLLSGS
FT                   IILPALTNAVHLKSGAMTSYFNMSAFQLNVISSATSITIGTSSTAYVKLEPSGTYTYGT
FT                   GSVTFSPVNYSLTNYGVSPSTFRPYGLFTPNTTYGTLNIFPSFEVVSESPGVAGPTGQL
FT                   NPGDMLTFEIYDVPEDTTFAAVAAIGNDTLLPTSPYLYPAEENSESFYTSSGYFVESLG
FT                   LTFANYSFTYIVSPLSGSGSFYGLIPNAPYYPLSYLGLEYELHYSPIVVSGTISPYNFI
FT                   ANDTLWYNKAGVPVYPFYQVFTSNRYGMFYFNTTATGNYLLLGNYLLVRGFGFTTSLAP
FT                   AEYPVMTYSTYSSTLAPLSSSLVAADTYGDFAYISQVPVSGSLYLNVFSKAPGTYPVTV
FT                   ANPTYTSLTTNASGFTVPISEHSGNAIVYVNPTPEVFGPTPIVTGLLGQVMLPSFLLKY
FT                   PYEATQYITNMTAPLIPASEGEISTVVVAGAGFTANVSTGKYGTVVLQFNMSSPSLSEY
FT                   YFAGVNISQVTPFDDKAFSGTWYAGGYGVFYNVPVPNLPGTAAYIPNAYDYAYNISIYN
FT                   ASVQAGSTPSYTGVFVARAADILVGQYSIGYLLTNFTHYNGSVIVKLSPLLTSPGYLLT
FT                   LVGTPFTEYIFGSPISYNTTQTLKNPYSLPVYINVTTLCGLALVQVPIGYIINGTLFNL
FT                   QLTGVGSTLQAGVTLQLCPGYNTISESITGPYVPQTAIPPVTVTRTIAPGEVTLYFVQT
FT                   LPAYPVQVQVVAPASASGSPVEVLVPTEVPVLGLPVTYTSDFFVLSKPVIAAYISTPTG
FT                   VEQLPSSDIMYVTTIPGYYVYFIVLPSNVTGGTLAVTVTQTATYIFTGEQFTGEAAAAT
FT                   GVVQVNTTAIQAALNKFESQIGSLLQGLNSTVRSEYAGLSSQLSGLSTQVSGLNATIAK
FT                   DYASMASMLSGLSTKVSSLNSTIASEASMLSSEIGTAESTLSGYIAGNFSAVNASLNTL
FT                   ETDITNLGGQLGAIASNVESIKGTVNTVASDLSGIYSSLQSVNSTVSSAASTISSVASS
FT                   LSSLSSTVSSMSSTVSSISSTVTSMSSTLNSVSSTVSSISSTVTSMSSTLSSLSSTASG
FT                   AESEAHSAASTAASAATYSLGALIVAIIALALIAYVAFAKF"
FT   gene            complement(81011..83833)
FT                   /locus_tag="ASAC_0075"
FT   CDS_pept        complement(81011..83833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18483"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ5"
FT                   /protein_id="ADL18483.1"
FT                   /translation="MRPRQLLAASLLLLILLAAVPLSLPASSPPPQLSAASTDLSVLRA
FT                   YGANVSSLNATLSRALQLYAEGNYTGAEELSLRVMEASYLYLRAQSPRPAPWAEAAGYL
FT                   AVLEYLASSLRFNSTYSSALESYAAKAYALLSQGNYSGSLGVSLRGLGLASGYSAAMSS
FT                   SGLSEGLAQLLSLAQRDVLELNATASGEARANMYSEAEELYLLVSSANVTSPGQLVELY
FT                   SLLALINRSAQQLQPLLNMSFRERVAAQVSANLSLAEGLLARAANETSALNSTYAVIMK
FT                   ELSNASSALSCLQGALEEEYLLREPGNCSAPSLRPGQLEGNISRALADIVAVAQRLPGV
FT                   NVSLGLQAAYENLSQAMGYLNQTYLLVEQALGRMSTGATPAFSNAALSSALKLINYVNA
FT                   SPQGPYVRSATASLESLASALGELVAVVNGSGANLSLSASIARASRAQASELAMLDYEA
FT                   LGNTSLAITAYIGGNDGLTLEYSSASQQLADEALQDATTYYIYVSAPVRELLGNVSAAI
FT                   ASLDGYINYAVNQYPTPPSKYVPYLKEAANATMLLSMSLLMDAEAFNVTGPQAGGALAN
FT                   ATGYLWEAAPYVVGLKDVAYSKDPSLAQQLSQAVADLGELSYAAWSSLLLGEALGQAYL
FT                   GNYSGALILANASAAKAAGIGNYSAAVRGTPNLPWLNATLLAASRDVEAIVNASAPLRG
FT                   LQAEALDQVSQVGSWASQASADWRDLGGALYLDSEAAGYAAEGNYSEAEAYASRAEALT
FT                   QGVTGGGPVELISSLAPLVSNLSGSLMMASLRMGELYSEAQEDAAAGGASVQAYAYLGQ
FT                   AVGLLERAEAELLEGGQGSAYALGAYNYSLRAMEVASEAGGEVTAFEAPAKLIAWAALA
FT                   LEGAFVEVNVTQLNVTVISCAEVNGTAYLVAFKAGGNMYLGLSPRPLEGSVEVRAEGRL
FT                   GIIYLVAPEG"
FT   gene            complement(84249..84587)
FT                   /locus_tag="ASAC_0076"
FT   CDS_pept        complement(84249..84587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18484"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ6"
FT                   /protein_id="ADL18484.1"
FT                   /translation="MIRWAVLLIVIAAVLLPVVHAQVEVSYVGAVEALSFNVTSAPQLL
FT                   KLPLCAEPYSYAAYEQGVGSLYAEYSNGTLQVSVLSPGTVNVSVYLPPAQSRGRWPPTG
FT                   CTSPTGPT"
FT   gene            complement(84636..85748)
FT                   /locus_tag="ASAC_0077"
FT   CDS_pept        complement(84636..85748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0077"
FT                   /product="Probable tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18485"
FT                   /db_xref="GOA:D9PZJ7"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ7"
FT                   /protein_id="ADL18485.1"
FT                   /translation="MRRSPYYIDVMLGMPYYYLDFDWGPLGAQVPRPDGFRVVEEVAGA
FT                   PCTEFRPSGSGNMHVYLLTKVGVDHSTAMRLASRLLGSRPHVIGIKDSNAVTCQLVYTV
FT                   GGSPRVREARRGGVEVRYLGDHDRRVEHTGNRFSIRVVTQRLDELARRVSALASAKRLP
FT                   AYFGYQRFGLVRPNSHTVGRAIVRGNLREALDLLLGRPFSGEPEAWREFRELYDRGMYR
FT                   EALEAAPRSLWPEARVLRELLRSGDPARAMRRYPMPLSFFVEAYQSYLFNLCLSRYLEA
FT                   NEVPERIVVPSSASRAEGACRDVMNEEGVSELASSELSIRARDMVRDSFMEVRGLGLSG
FT                   EWLEFSLGRGMYATVVLRELLRQDPLTFAG"
FT   gene            85815..86906
FT                   /locus_tag="ASAC_0078"
FT   CDS_pept        85815..86906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0078"
FT                   /product="Glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18486"
FT                   /db_xref="GOA:D9PZJ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ8"
FT                   /protein_id="ADL18486.1"
FT                   /translation="MYVAALLLATGVALLLWHAASALAYYALMLRRSRAYRPPKGAFSG
FT                   TVTVVIPTYNESKIIRGKLDNVASQWDPSRLEIIVVDSSTDGTADEVERWSRGRGLPVK
FT                   VLREASRSGKHAAENWALREARGDVVVFTDADCEWSPGSLRSALSSLAAPGVGLVTCIK
FT                   EPPRGVEGTYRSLYNVLRLGESQAHSTPIAHGELLAVRRDLATKLGGLRPGADDSDLAH
FT                   RVAMEGLRSIALPDAVCREYVPGRGYFRWKLRRAQHLVEHMARASRDLPRAPKGYRAVL
FT                   AWESFLHLVNPWLALASLASLVASAALGSLPAAVVLALIAASMTLGMARTWALEQLFLV
FT                   TAMVKNLRGREYVWEKVEKPVSP"
FT   gene            complement(86896..88266)
FT                   /locus_tag="ASAC_0079"
FT   CDS_pept        complement(86896..88266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0079"
FT                   /product="Probable cationic amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18487"
FT                   /db_xref="GOA:D9PZJ9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZJ9"
FT                   /protein_id="ADL18487.1"
FT                   /translation="MSLRSNSVGFLQLAFLSVCAILPGSIYLVVSRNAIAYAGAAAPLA
FT                   FLLGALLVFTNVNSIYQFSSRVSSAGGFYKFVEAAWGRRVAGVIGMAQLLAQLSPIIIT
FT                   PIALAWILDVALRALYNIAVPLSLLVALGLLTQAFMFAVSYLGVRLSARVAMISGAAQI
FT                   AAILAGSVVIVLRSRYLSLEPFTMPSVGPAGFFLAVLTGPYTAYIGYSTIVNFGEEARA
FT                   PRETIRKAIVAAIIMMAAFYTFVEYSLVVSVPPSGVQGLRSLFLPAVAVFSRYTGRAYS
FT                   ALVLAIAISGYFTGVLVFGSSAERTMFSLARDGLLPRYLCRVHERYGSPSSACITTFAV
FT                   AVVMSLLTEAVMVELYGVVRGLLYGILFWITVMSVLNLAYHVAVNISLSRVAVRERLRG
FT                   LATALSHHLLPAIGTAISLVIIYFSLVGLNVPVLYAVPAMAAYLAAAIALVVRRLRG"
FT   gene            88401..89312
FT                   /locus_tag="ASAC_0080"
FT   CDS_pept        88401..89312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0080"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18488"
FT                   /db_xref="GOA:D9PZK0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK0"
FT                   /protein_id="ADL18488.1"
FT                   /translation="MNLDDVTAIVPAFNESEGIGPTVQELIDVGIQPYNIIVVDGGSTD
FT                   GTPEIASKLGVRVVRQRGRGKADAIRCGLKHARTPLILVIDADHTYPAKYVPLMVNALK
FT                   EGGYDEVIGVRPGSSQPLVYRVGNALLTWLFDSMFGVRLRDVLSGLYLVRREAIADANF
FT                   EMGGFSVESEIAAHIVSTGGSVGEVDIEYRKRLGRKKLRPWHGLSIALDMVRLSWRYNP
FT                   TSTLFLAGALLMVPGLLVGGMTAYQFYFMHVDHFVNAIMALVVTATGFNSLLLGILSMY
FT                   LKRMEYRLLKHMRSMKRGQSSG"
FT   gene            complement(89323..90468)
FT                   /locus_tag="ASAC_0081"
FT   CDS_pept        complement(89323..90468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0081"
FT                   /product="hypothetical protein"
FT                   /note="DUF58 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18489"
FT                   /db_xref="GOA:D9PZK1"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK1"
FT                   /protein_id="ADL18489.1"
FT                   /translation="MIGATSRGAGVLALSASLLVIGIAVGAYLLVALGVLLALASLADL
FT                   AVLVASSRPTTLRPSQGEVACSAGSGATVALSHGRLRGNLVKDQLVAGLEAGEGGSLLR
FT                   LSCPHAGSYLLSFVRFTLRSPLGLFEASWEDPVRPPVRASASPRFLPLAVAALAGAGAM
FT                   GGQGTTAFEAPYTLPRGEDYAWTERLQPGEPAEVIDWRATARRGELMVKRFYPQGSREV
FT                   SLVVDLTATDPESADELAAASLSIALGLSGSLSVTPYIYDGERLARVNGIDGLARALLE
FT                   RLGRHYPEAFRVLDDYPGRLRLSEGVPEGKVIAVTQLLSPLPSLLPPGCTVVQPTRPWL
FT                   RAPSLEEAYLMKERHDREVSLLRASGCQVLFTYRRLTTIIM"
FT   gene            complement(90471..91394)
FT                   /locus_tag="ASAC_0082"
FT   CDS_pept        complement(90471..91394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0082"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18490"
FT                   /db_xref="GOA:D9PZK2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK2"
FT                   /protein_id="ADL18490.1"
FT                   /translation="MDLGRARDVVSAIRSAVRTYYAGNDEALDTALAAILAEGHVLLEG
FT                   PPGVGKTTLAKLLAQAMGGQFKRVQMTSDLLPSDVIGAMVWDQAKGEFRFRPGPIFANV
FT                   VLVDELNRATPRTQSALLEAMAEGQVTVDVNTHQLPRPFLVIATQVPRDTGGVFPLTAT
FT                   QVDRFAAKVEVGAPRKEEELKIIRMADELMSPQIKAVASLKDMVEAQEAVKRIRVDDSV
FT                   AEYMVNIIDELRRSNLAEPLSVRASLWLYRMSRAKALMEGRDFVTPDDVKAVALPVLRH
FT                   RVAVSEGLSPDSLIRSVLERVPVPRG"
FT   gene            91484..91561
FT                   /locus_tag="ASAC_R0001"
FT   tRNA            91484..91561
FT                   /locus_tag="ASAC_R0001"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            complement(91583..92200)
FT                   /locus_tag="ASAC_0083"
FT   CDS_pept        complement(91583..92200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18491"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK3"
FT                   /protein_id="ADL18491.1"
FT                   /translation="MSQQGPQDKATPQAAQKPAAQSQARPQAAAAPQAAKPAPGAAKPP
FT                   APAAQQAAKPQAPQPVILPPPPPVDVGTVAVVELLDAIVKLKRSGLLGMISYLADKAED
FT                   SFLSAATDPALMRLMALLASVSYGVSRVPPDDIALAQNSVQDLTSCAVTALGRVDITEE
FT                   RRYGALGMGYRLRDPDVGTSLWILLQIAKGLGRCVRERNKSK"
FT   gene            complement(92291..95071)
FT                   /locus_tag="ASAC_0084"
FT   CDS_pept        complement(92291..95071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0084"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18492"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK4"
FT                   /protein_id="ADL18492.1"
FT                   /translation="MEAGYRSGVRLKVLAIVVILVVVAALAASYVQHTRSQGSRTVLQL
FT                   SPPAPSTYSAVAGQQLSLYIPSPAGYSAEVFLGNGSSVTVRGDYLTVSYRWPGRYLIYY
FT                   ALMKGGRVVASTSQELIEVLVTPNVSGRLSQEVSVPVIAVSGLNGTPVFDVGQRVSVFI
FT                   GYLQPPSGQNMTIYKYFLSLGNGTTIEVSPRNYTAYLDTGNYTYLRPSEDPVNVSFSEP
FT                   GLYPLTLTIETLNVSSGQTFNYSYTQTVAVESRGLRFSMFKLDVDLPNPGTIVVAKNVP
FT                   GGPFSFDPDIDYGNIGFEVLLNVYSTLVEYFGANTTKFIPMAAEYIPTVGNWSNVTARH
FT                   LYGAISPNYTVYVFKVRPGLRAANGDPITAYDVWYSVIRDMLCAGGTPGTPGWILTQYL
FT                   IPNYTPFTFVVTSPNDTQGAEEIVNAITYDNATDTVTFHLVRPVGPVAFFDALADPQGG
FT                   SILDAKWLEEVGDGINFTGLYDHNLTQLAEAFYSYEQTCSEGSYNTAVQWPSGPSAGFT
FT                   GPYYIAVYTPGQSVVLKPNPYWPTNITYFPRPNDTVIIEWVKDPTTAYELFASGQADIV
FT                   TNLPTSYIPRLLQLESQGKAVIYSFSPSLLEWFFAFNLQVNESLLSQLNPAYHIPGWYF
FT                   ANPLVREAFAYAFNYTEYIDDIVGNVKYHFNFGSLYCGALVPGLDIYIPPSELTGCPTF
FT                   NLTYAKQLLEESGFYNVSVYFPIVISSGDTTDYTAAQMWAAALHNIDPNINAVPMYLPQ
FT                   AVIEAYQVPGQNGLPIYYWYWSADYPMADDFMNGMYLEAGDYALPDGWNATYLENLSAY
FT                   FNQSRVSYPGLSPSVEPEIGRWLWQEAVEYINMNNTIGVANYYDIAGNYTGAYELYRQA
FT                   EQEAMSLYMYVYTIYQNALMVTKPYMHGYMGMISWQENPMWGGIDDYAYFWWVKG"
FT   gene            complement(95157..96287)
FT                   /locus_tag="ASAC_0085"
FT   CDS_pept        complement(95157..96287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0085"
FT                   /product="Sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18493"
FT                   /db_xref="GOA:D9PZK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK5"
FT                   /protein_id="ADL18493.1"
FT                   /translation="MILNAGMLSSGGVDMEYIRLEDVWKTYRTKNVTATPLRGLNMNVD
FT                   KGELVVVLGPSGEGKTTLLRIIAGLLRQDKGHVYLRGELVDDMPPKDRRVAMVFQSYAI
FT                   YPFMNVYDNIAFPLRLAHRPKDEIDREVRRVAEMLRISDILQKKPSELSGGQKQRVAIA
FT                   KALVKGADILLMDEPMANLDAQVRVFAREELKQLHRQLGTTIVYVTHDQVEALSLATKL
FT                   AVLHDGVIQDFGDPMEVYRRPKNAWVASFVGNPPMNLFDGVVSGNYIVAKKGKLRVPVP
FT                   EEYRKLVKEGQEVIFGFRPEDIRVGEGELSGTVSMVERVGAYTVIHLDMGDGQLLRVVY
FT                   PSLSTVNRGDRVSFSVPAEAVSLYDPSTGNNLEQRR"
FT   gene            complement(96284..97183)
FT                   /locus_tag="ASAC_0086"
FT   CDS_pept        complement(96284..97183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0086"
FT                   /product="Sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18494"
FT                   /db_xref="GOA:D9PZK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK6"
FT                   /protein_id="ADL18494.1"
FT                   /translation="MRRLSSRSRAKALKALRLTVSYLVLIVMAAWSILPIYYIILISFS
FT                   NVTKLFAFSARDLIPSHVTLAAYRQLLLGRFLPTIKAPNFPLWVMHSIELAAATSLLSI
FT                   VLAMVAGYGLSRLDMPAKKTLAMFTYIITFLPVTATTVPLFLLFARLHLLNYVGLVLAY
FT                   TPGTAVFAAFLAKLAIDSIPPDYEESAMVDGLSRFGAFIRIVFRLAMPVVALTALLGFL
FT                   GAYMDYATAYAFIGINPKMWTAMLGLYYLAGLYNPASAPNYNIFAAGAVLMGIPLMALF
FT                   LVSQRMMTKAYSSLAGIK"
FT   gene            complement(97191..98075)
FT                   /locus_tag="ASAC_0087"
FT   CDS_pept        complement(97191..98075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0087"
FT                   /product="Sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18495"
FT                   /db_xref="GOA:D9PZK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK7"
FT                   /protein_id="ADL18495.1"
FT                   /translation="MPKVSPKLEGLLYFLPLLAAVLFLFLYPLLYSVYISMTDMSLLHF
FT                   YSYKFVGLLNYVLAIKLHYISTLLINTVIWTVGSLVPMMALGFALALILNQRDLKGKSF
FT                   FYAILILPWAFPGFISLLVWQGMWVYPYGFMNRYLLPLLHLPPINSLSSVPGAWAELII
FT                   TNLWLSFPYYMTVFYSGLQSIPTELYELADVDGAGALTKFLKITVPSLRKTIAFVAITS
FT                   FVFTWNNFYPIYVLTGGGPGISTETYIVYAYQQAFAYNNYAMAAALSIISTLITIVLAI
FT                   VVMKYTGVLEGIT"
FT   gene            complement(98088..99632)
FT                   /locus_tag="ASAC_0088"
FT   CDS_pept        complement(98088..99632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0088"
FT                   /product="Maltose/trehalose/maltodextrin ABC-transporter,
FT                   extracellular substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18496"
FT                   /db_xref="GOA:D9PZK8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK8"
FT                   /protein_id="ADL18496.1"
FT                   /translation="MRSRSRRSISTAALAAIIIVVIVIVAVGGYLAYVSTRHHVTTTTP
FT                   TTTTTSTTSTTTSSTTTTTTTTTFTTTTTTTTPPPTTTTQVVTLTVADSYSTSENIAFN
FT                   KSLAAFEQEYPWIHVEVEYGAGVGTSPYTSEAQAHDAPIIIRDTSDSAGALFAAGILVN
FT                   LSQYLPQSYFQRFNPTAIEDWTLNGSVYGLPDNINYIVMFYNKKYVPEPPNTTDQLIQI
FT                   AEQVNKSGVWGIAYGASDEYGYRFAAWFAGFGGQIFVTQNGKVVPALNSTAMVNALNFW
FT                   YNLTYNLKINYLAPSTGAGGAEGQLFMENKAAIIFDGPWDLKPYFQALGCDLGAAPLPV
FT                   VSQTGLYAEPFIGSTGWSITTPQANGVPASQWNATLHAALLFIEFMTNYSNEYGLFEYA
FT                   GDIPALNSAYQAALQNLSAPTSNQTLACLHQVIKGILEQSQHGQKFPNVPQMAYYWNSF
FT                   HQYASEFFAGKINAQQAAQGMEQAFVSSLQSAGLLSPAQLPPSEVLTAPELPASRY"
FT   gene            complement(99771..101237)
FT                   /locus_tag="ASAC_0089"
FT   CDS_pept        complement(99771..101237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0089"
FT                   /product="Type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18497"
FT                   /db_xref="GOA:D9PZK9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZK9"
FT                   /protein_id="ADL18497.1"
FT                   /translation="MKLSLLGLDALSPALLSRAVERLKLKNIGDAVRNGRPVPLHSMPP
FT                   ITPTAWTSIATGVNPAKHGVWGFTKYYRGPKGEHLSRPYTSLDVMFPRVFEDAALMGLD
FT                   VAVVNYPLTWPLDGLCCLDRMTVVGDTFLAPRVDYSPRDLAGRLGRHFITFSDMPDPYE
FT                   RTRRLVEGTLELLSEVDADAYFVVLPYPDQAFHRDHREVLSVGPRSAEVWEAIDELAGE
FT                   LMRRSKAFVLVSDHGAGVHRTCVNALAPLMREFGVGVPRGLRGRLALYLVTAADVISRA
FT                   LPPSVSPRELSRRGPLARLRGRLGGELANIAVAATHESPGESELARQPFTYDAGGLSID
FT                   RILYFRDEASRERGLRAIEGSPASRYLRVSRLEERFRGAYMPPYPSLFVESVDESRYHV
FT                   VSSRSLAALRHDMMPDHEVYGVLLVKGAEVRAEAAEVYDVAPTLLSLLGLKVPRGADGR
FT                   SLVGASAGEYPYDAAVRLKARLRGRAGQLG"
FT   gene            complement(101317..101442)
FT                   /locus_tag="ASAC_0090"
FT   CDS_pept        complement(101317..101442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18498"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL0"
FT                   /protein_id="ADL18498.1"
FT                   /translation="MSVEAGKVEVSARERRVKFEVSAEDEAKLDWYLSSAFAEGA"
FT   gene            101569..102537
FT                   /locus_tag="ASAC_0091"
FT   CDS_pept        101569..102537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0091"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18499"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL1"
FT                   /protein_id="ADL18499.1"
FT                   /translation="MEVQRLKVAIPIKALGHVNSYVIADYDGFSLVDPGMYWANSFDGL
FT                   ARELRGAGLSLRQLKSIIVTHFHVDHATAAPVLANLTGAEVYMGAADLEVVRRGFRDYF
FT                   EGVLETYRHYGVPEAEVNAMREVHPVPRLGDVYDELADAARPLREGDSLDAYGGMMKVV
FT                   ELPGHTPGHIALVGDRVAIVGDVVLDRITPHVILDTPRASRDPLGDYMRTLERVKSMNV
FT                   STAMPGHGEAIGALARRADEIMEHHRARLNEVRSLLSAPATLYDVARRMNWRTSASSWD
FT                   QMSPYERYFAIGEALAHLRHLEVIGEVEEVSREGQVLFKLA"
FT   gene            complement(102529..103323)
FT                   /locus_tag="ASAC_0092"
FT   CDS_pept        complement(102529..103323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0092"
FT                   /product="NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18500"
FT                   /db_xref="GOA:D9PZL2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL2"
FT                   /protein_id="ADL18500.1"
FT                   /translation="MSLEAEARRLAEMLLAAKNAVILTGAGVSTASGIPDFRGPSGLWR
FT                   RLDPSFFEISYFYQDPLGSWRLFMERFGQLRGVRPNPAHVAIARLEELGLVKAVITQNI
FT                   DGLHQAAGSRRVIELHGNASRAVCTECGRKYDIEEAFKAVKEGRLPTCPVCGGLLKPDV
FT                   VYFGEPLPPDALEEAFSLAESSDLFIVVGSSLAVSPANQLPIMAKARGAKLAIVNVGET
FT                   ALDDMADLRVDAPVEKFMPMVCAIAEDMMAKGSGCRAAAGLG"
FT   gene            complement(103333..103539)
FT                   /locus_tag="ASAC_0093"
FT   CDS_pept        complement(103333..103539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18501"
FT                   /db_xref="GOA:D9PZL3"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL3"
FT                   /protein_id="ADL18501.1"
FT                   /translation="MGTELRKSSRALIFSSVVLASLYLLSLAMASAGRLVTMAGPQGLQ
FT                   LLEMLLSVPSGPRFIAVGLIALR"
FT   gene            103532..104581
FT                   /locus_tag="ASAC_0094"
FT   CDS_pept        103532..104581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0094"
FT                   /product="Predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18502"
FT                   /db_xref="GOA:D9PZL4"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL4"
FT                   /protein_id="ADL18502.1"
FT                   /translation="MPKHKGTEKLRLWATRRLAELREESERERQRRSGGSRPGMFVEKA
FT                   GAGQVVLLGPPNSGKSSIVARLTNAKVTVSPIPYTTQLPVPGMMTYLDVKLQLVDTPPL
FT                   LNPDGSVNSRVVALARNADVIAVVIGLDSPEPTKDLTASLEAIEDRGIAYSLEKGFVKV
FT                   ERRTQGGLTFIYRGTPKFTEEEARRLLNSYRVYNAVVEVYGPATLDDLEEAIFSFKVYK
FT                   PTFVIFNKADLPASESRAREAARLLPRDVPWILASAETGVGLSSVGPVAYRLLNVKRIY
FT                   TKKPGQPPSPEPLIVKADATVREIAEKISPSLATSMRYARIWGKGAKYEGQRVGPDYVP
FT                   QDGDIIEIR"
FT   gene            complement(104582..105466)
FT                   /locus_tag="ASAC_0095"
FT   CDS_pept        complement(104582..105466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18503"
FT                   /db_xref="GOA:D9PZL5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL5"
FT                   /protein_id="ADL18503.1"
FT                   /translation="MSETATTRKVQRLGGSSLIITLPKQWARRLGIKVGDEIEVIESGG
FT                   KLLVQPRDQRAEDRAGTVAIRYNGIARMAGVEAIVNCAFVHGYDKVEILIKGLGEADVK
FT                   RLMAELNASKKVASVERGTDRLIVTLAPSLNLDAARLIKEASSSLQQLLEAAASGAEEA
FT                   EIRRLEGQALELIESSLRSSSKGSDIVDPMAYGVLLALPSMVADSSVVLKGRADLLNKL
FT                   KEAVGEFLGGLASASGRRLLNAAMIASELRDMALHEGGAAAVVVPLADALLSASMKLIC
FT                   PSILEQEAEGLAE"
FT   gene            105629..106207
FT                   /locus_tag="ASAC_0096"
FT   CDS_pept        105629..106207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0096"
FT                   /product="Pyruvate:ferredoxin oxidoreductase (POR) and
FT                   putative 2-oxoglutarate:ferredoxin oxidoreductase (KGOR),
FT                   gamma subunitubunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18504"
FT                   /db_xref="GOA:D9PZL6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL6"
FT                   /protein_id="ADL18504.1"
FT                   /translation="MRRSKLVMLEIRWHGRGGQGAVTASEVIASASIIEGKYALAFPEF
FT                   GAERRGAPVRAYTRVTDSPLIPRTPIEHPDVVVVLDRSLLKPSYIEGLKDGGILVANSP
FT                   LKPDELLQKLGFANRYRAATVDATSVAMKWLKANIVNTAILGALVKSTEIVKLDTVLDV
FT                   IRSRFHGKIAEANVMAVKEAYDLTQLSWR"
FT   gene            106198..106536
FT                   /locus_tag="ASAC_0097"
FT   CDS_pept        106198..106536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0097"
FT                   /product="Pyruvate:ferredoxin oxidoreductase (POR) and
FT                   putative 2-oxoglutarate:ferredoxin oxidoreductase (KGOR),
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18505"
FT                   /db_xref="GOA:D9PZL7"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL7"
FT                   /protein_id="ADL18505.1"
FT                   /translation="MEVSRMSVRLPGWKEMAIGGIIVNPGNSLEYKTGDWKVLMPVIDQ
FT                   DKCIRCRICWYVCPDNAIKELDKPHTTKAKRVYKISYDVDYDYCKGCGMCAQECPVKAI
FT                   DMVPVEVS"
FT   gene            106538..107731
FT                   /locus_tag="ASAC_0098"
FT   CDS_pept        106538..107731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0098"
FT                   /product="Pyruvate:ferredoxin oxidoreductase (POR), alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18506"
FT                   /db_xref="GOA:D9PZL8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL8"
FT                   /protein_id="ADL18506.1"
FT                   /translation="MQAQVQYKRPIPLSTNYAVAHAAKDLDVDVIAAYPITPQTTVVEK
FT                   LSEFVANGELDAEFIHVESEHSALSATLAASLAGARAFTATASQGLAFMHEMLHVASGL
FT                   RAPIVMSVAMRALSAPISIWNDQTDLFNARDAGWIIYFVHTAQEAYDTIIQAYRLAEDR
FT                   DVLLPVMVGYDGYVMSHTTEPVVVEDRESVLKFAPKRPYPYRLDPDHPVTIGPIVPPEY
FT                   YYEIKYQQVKAMEGVPEKAEEIDREFGKTFGRSYGIMECYMCDGAEALIVANASYAATM
FT                   KSVLPDAWKQGLKVGLLRLRLYRPFPVKHFVNYTSNVKSVLVIDRAISYGAPYQGPLAN
FT                   EIAGLKVREDLGFNLTSVVAGIGQRAMENEDFLAIARLAWEARTRKYPETIFYGVRE"
FT   gene            107731..108705
FT                   /locus_tag="ASAC_0099"
FT   CDS_pept        107731..108705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0099"
FT                   /product="Pyruvate:ferredoxin oxidoreductase (POR), beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18507"
FT                   /db_xref="GOA:D9PZL9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZL9"
FT                   /protein_id="ADL18507.1"
FT                   /translation="MAEQAKKLPRIKSLFDLPRDEYFLSGHGLCAGCTAGTIMRMLTKV
FT                   AGKDAIIVNATGCVEVSTTRYPYSNWLVPWFHSAFENAGASAGGIARAIEVMKRKGMIP
FT                   KDKQVKVIAVGGDGGTVDIGLQSLSGMLERRDPVMYVLYDNEAYMNTGIQRSGATPFHA
FT                   WTTTTPAGKVWRGEWRTKKDIAMIVAAHRIPYVATANPAYPQDMINKFIRGLEVLDEGP
FT                   SFIHVLMACTTGWRFDPALGITISRLATETGVFPLYEIDHGNFRVTFPIAKRKPVSEYL
FT                   KLQGRFAHLTPAEIEEVQKLVDERVAEINKLAGKEVIGPVVKS"
FT   gene            108947..110800
FT                   /locus_tag="ASAC_0100"
FT   CDS_pept        108947..110800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0100"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18508"
FT                   /db_xref="GOA:D9PZM0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM0"
FT                   /protein_id="ADL18508.1"
FT                   /translation="MADRGIIEEDRKLSRSLGLWHYVAINIGAIIGSGWLLAPLGASAF
FT                   NGPLSVASWVVAAALVAFMAIAYAYLASAAPRTGAVVRYPQMAHGDLVGFSTGALYLLS
FT                   ISSLLPAEAVATVYYASYYVPGLVKSATVLGQQLTVLTPKGLLLALAIVIVIFVINYFG
FT                   VSLVGNVSLALMVWKIAVPLTVIAALLALAFNPHNFALAVSTQASGEGLSSAAAIFAAI
FT                   PVTGIAYALLGFRQAVEYSGEGRKASSDVPKAVILSVALTAIIFILLQVAFIGGLRWSS
FT                   IEVNETVRLSNGTVVRRLEPVTPGNWSALAVSNIAAAPLASELAIVGLGVLSIVMIIDA
FT                   WVSPLGNAVVQMGNLGRIVYGMAANGHLPRRLSGLNRYAVPGLGLIVALALGLIFLLPF
FT                   PSWYAIGSYAVLTTLLTYVTGGTALGAFTARSRSVKLLMAGALGAVGASLIAYWAGMIP
FT                   MIPVFITFISALAAFMIIRAFSSRTSMLAVALPYAAAVAFSDYILAVKVFYPLSSGISV
FT                   PEQAVVRYLALAMLLSVLSTAAALAAGYLIDRGLRPSIRGGAWYVGLVTSIMLVDILGP
FT                   YGLSSVYGGDPPIPFPFDLVAVAAVTLVAYFVSVLTAPKES"
FT   gene            complement(110854..110959)
FT                   /locus_tag="ASAC_R0002"
FT   tRNA            complement(110854..110959)
FT                   /locus_tag="ASAC_R0002"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCG"
FT   gene            complement(111031..112527)
FT                   /locus_tag="ASAC_0101"
FT   CDS_pept        complement(111031..112527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0101"
FT                   /product="lysyl-tRNA synthetase (LysS)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18509"
FT                   /db_xref="GOA:D9PZM1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM1"
FT                   /protein_id="ADL18509.1"
FT                   /translation="MSVEWDKERLKLLEELRSKGVNPYPHKYPITHTIRQIKDLAASRG
FT                   DRPHEPFLRDISTAGRVANIRRHGKASFVDIFDEGERLQLYLRVNELGDRYKEFLYYVG
FT                   RGDIIGVRGDLFYTMKGELSLLVKDYQLLAKALIEPPDWTKLSPEFRYAHRYVDFLYND
FT                   QARRAMEVRFNTIKEIRQYLYSKGFVEVETPVLQPVYGGALAKPFMTHVNALDEDWYLR
FT                   ISLELYLKRFIVGGFDKVFEIGKVFRNEDIDVTHNPEFTMMELYWAYADYNDIMDLTED
FT                   MIRTVAAKVLGTTQLRIPMPDGSVAEVDVGQRFRRETMFDLLSEALGKNIEEVSDDEMK
FT                   RMLDQMGLVPRGGVYSRGLMVEKLFDKLVTPKLIQPTFVLDYPIETTPLCKPHRSKPGL
FT                   VERFELYVAGVELANAYTELNDPVLQDRLFKEEQEMRKRGDLEAHPYDVDFVRALSYGM
FT                   PPTGGLGVGIDRLVMMFTGVSSIKEVLPFPMVSAKLVQGG"
FT   gene            complement(112557..113123)
FT                   /locus_tag="ASAC_0102"
FT   CDS_pept        complement(112557..113123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18510"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM2"
FT                   /protein_id="ADL18510.1"
FT                   /translation="MLYVVYHDPGGDNSKLVEMVRQVEGALLVKVSEAASISPSADDNV
FT                   VLLMPMRGGHSREVMEVAARSGASWRGTIPPELTASAIARAAREAGCSSVRLYFWPAKR
FT                   FLEDQLDDVGRIAAMITLSGLTVVNDGCADCIAPLALLPGKIVSEAEEAAKACGSRALG
FT                   PLIDVAFVEIREWLRELSRGLTLKS"
FT   gene            113242..114471
FT                   /locus_tag="ASAC_0103"
FT   CDS_pept        113242..114471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0103"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18511"
FT                   /db_xref="GOA:D9PZM3"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM3"
FT                   /protein_id="ADL18511.1"
FT                   /translation="MASLLEDQESLDISSLEMYGVTFRDSCFLSISSHAGRLVERAYQE
FT                   LLPLSRGVVVLSTCNRFEVYLDSPAHDRADSAISEMLGCHVHLTGVDAARHLLRVASGL
FT                   ESAILGEDEVLGQVRDAWVYSRRAGYSSELLDTVFHSAISAGARVRSSTNISRGVLGYP
FT                   RAAVEVAAARLGGLDGRRVAVVGAGMAAGEMLQQVCSKWRPSSLVIADRSPEKARALGS
FT                   LCQQAKVETATLQQLPSLAPFDVMLVAIKGGMRPELEVAARRSGLVVDISTPPASPLFH
FT                   VGIDEIKEFVNANLSARLSEVSRAESIIEEELESLQQMILRKAVDRAISSIMRVISVIV
FT                   DEEAKLTAKNIAGGQDPYQAVLTALNSTVKKTMFPIFSYLRESPESRAELAKELMNRYN
FT                   SMIGLRGRRP"
FT   gene            114468..115484
FT                   /locus_tag="ASAC_0104"
FT   CDS_pept        114468..115484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0104"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18512"
FT                   /db_xref="GOA:D9PZM4"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM4"
FT                   /protein_id="ADL18512.1"
FT                   /translation="MTGFPRIRPRRLRSSSALRSLIAEVDLSPSRFIMPLFVDENLKSP
FT                   IPTPGLEGYTTYPPDSKELINLVNAAMEVGVKSFLIFGVPSTKDEVGSRAFAEDGPVQR
FT                   ALRTIRSEVGWEPVLMTDLCICEYTSHGHCGIPVNSRRGTVIDNDSTLKVYQKIAVSQA
FT                   QAGADFIAPSGMMDGQVRAIREALDTAGFTDVGIMAYSAKYASSMYGPFREAVDSAPRF
FT                   GDRKSYQMDPRNAREAIKEVRLDLEEGADIVMVKPALMYLDVISLVKRTYPDVPLAAYN
FT                   VSGEYAMIKAAARQGLIDGVAAMMEALYAIRRAGADMIITYFALDAARAIASGKSPF"
FT   gene            complement(115485..116588)
FT                   /locus_tag="ASAC_0105"
FT   CDS_pept        complement(115485..116588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0105"
FT                   /product="Permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18513"
FT                   /db_xref="GOA:D9PZM5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM5"
FT                   /protein_id="ADL18513.1"
FT                   /translation="MRLRLPRLTHEELLLVLTGSLSGIIFGSTTLALPLYLKSLGLDSF
FT                   QVGLLVGGYVLVGSTTGLLVSALADAYGRKRFFIVGRLVSAAAYLLLFLGVPAAALLIF
FT                   GLGGGSLQALMAEKSRDIDRNMSLLSSLSTAFAIVGASMPWAVGLRNTMLADSLTVMAT
FT                   AALVAPVREGYRGTGRITLRLGSIRNIARLSTDALIGLGAGLILPLMSLWFNLRFHATA
FT                   ATLSPVYMMADATLALASIGAPALAKTMGRVRAIVLTHAIGIALLIALPFSSSLYEAAA
FT                   IFVARNAAMNMANPLFMSLVVTMVPEEERARGSSLINLIDGLPRSMGPWLTGYIYSVGN
FT                   LTLPFFITAALYSAATAAFYVLFRNVR"
FT   gene            complement(116628..117791)
FT                   /locus_tag="ASAC_0106"
FT   CDS_pept        complement(116628..117791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0106"
FT                   /product="putative nucleotidyl transferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18514"
FT                   /db_xref="GOA:D9PZM6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM6"
FT                   /protein_id="ADL18514.1"
FT                   /translation="MAMIGFVLAGGYGKRLLPLTSRTPKPFMQLLGRQLIDYSLDMLRE
FT                   AGVDDVVIIATQGFSGMASAGREGVRVVEQRGLDIQGALRTAYEEAVSSKEREAIVVYT
FT                   GFLASPNTIAKLAVEYYQTSGFPVVLALASAATGLETYGFVTVDYRGAVRDFMWESQEA
FT                   NRWGMGRGYVFGGVMVSGVEELEEASRRPFAESMKSMAKQGVLGGVQWPGRWVEIGYPW
FT                   DILEAINMLLDGAGTRIARGARVSRSAVVGDNVIVDEGAVIEDGAVVKGPAYIGRDVRV
FT                   MSGAVVEGFSSIEQGSVIEENAIVDRSYVGVGVRVGALSEVRGSVVGEGAVVGPGAHLV
FT                   DGYPERLPERLRWLAEYLGEKVKLGAVVSPGHEVQCCTVSGKGAVLP"
FT   gene            complement(117791..119635)
FT                   /locus_tag="ASAC_0107"
FT   CDS_pept        complement(117791..119635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0107"
FT                   /product="isomerizing glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18515"
FT                   /db_xref="GOA:D9PZM7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM7"
FT                   /protein_id="ADL18515.1"
FT                   /translation="MCGIIGATANCSDVVPLIIRGLQRLEYRGYDSVGIAVVGNNELAV
FT                   RKGAGELEVVRRRLSLDEMRGLTGIGHTRWATHGPPNDVNAHPHTDCTGTIAIVHNGVI
FT                   RNYASLKEELLARGHRIRSDTDTELVAHLIEEGVKEGKDFVSALAQALSRVEGTYAFAI
FT                   VNSREPDRVYFAKNRSPLLVGVGDKVKAVASDVPALLDITRDIVFLEDGEFGYVTPREV
FT                   VIYRLTPSGYERLSDEEVRSRVRHVDISPEAASKGGYPHFMIKEIYEQPQAVRDTYEGN
FT                   VEDPALGRVSSAILSANKVIVVAAGTSYHAGLVFSSLLARRAGILAHTIISSELPYLVD
FT                   SIDGGDLVIAVSQSGETYDTLEAVRKAKERGAAVVGVTNVLGSALDRESQLRLYTRAGP
FT                   EIGVAATKTFLSQVMLLELLSIRAGEASGRLRPSEANELLRALREVPQVLANTLEASDP
FT                   VATALSKGLSGSAYILGRGLGAAIAREGALKVKEIAYVHAEAYPAGESKHGPIALVERG
FT                   FPVFIVATSDAREVAGNAVEMAARGARVYVVKPADLGLELEGRESITRIDMPPSSGVLE
FT                   LEPFILTPLFQLLSYRVAVSRGYNPDKPRNLAKTVTVE"
FT   gene            119841..120356
FT                   /locus_tag="ASAC_0108"
FT   CDS_pept        119841..120356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0108"
FT                   /product="phosphatidyl ethanolamine-binding protein (PEBP)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18516"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM8"
FT                   /protein_id="ADL18516.1"
FT                   /translation="MCTWLAKEYVLREGAQFRLFSEAFKEGEVIPVKYTCDGEDISPPL
FT                   SWSSPPQGTKSLALIMYDPDAPANTFIHWVIYNMPPTLARLEEGVGSSGAREIPGVGVQ
FT                   GLNDFGDVGYGGPCPPRGHGPHRYYFALHALSAQLTLRSPVTASSLLNAMRGKVLGYSL
FT                   LMGRYSRQ"
FT   gene            120449..120865
FT                   /locus_tag="ASAC_0109"
FT   CDS_pept        120449..120865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18517"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZM9"
FT                   /protein_id="ADL18517.1"
FT                   /translation="MIAMSDKENGDLEERAIDILRQYKDGVLQSELWKTLGISSREGSR
FT                   LVLRLIRRGVVRREEVTVNGRRTYKLYAVKAGAPTFSIKVDVSSILDIPCAACPRLSEC
FT                   GAGGYYDPSTCPLLEAWLKKEIAKLRVQRVQTAS"
FT   gene            120877..121167
FT                   /locus_tag="ASAC_0110"
FT   CDS_pept        120877..121167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0110"
FT                   /product="signal recognition particle protein Srp19"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18518"
FT                   /db_xref="GOA:D9PZN0"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN0"
FT                   /protein_id="ADL18518.1"
FT                   /translation="MPKEDFEGKMVIWPVFLDCNYPRSLGRRLSLDACVKSPSVQEIVK
FT                   AARDLGLNPAFDEASYPRLWYEIRGRVIVDKKMGRQETLKAIASRIKSMRS"
FT   gene            121233..122396
FT                   /locus_tag="ASAC_0111"
FT   CDS_pept        121233..122396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0111"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18519"
FT                   /db_xref="GOA:D9PZN1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN1"
FT                   /protein_id="ADL18519.1"
FT                   /translation="MSRRGRWPFEEKPLLVFWETTKACPLACIHCRAEAITRPLPGELS
FT                   HAEGLELVRQVAEFGRPYPILVFTGGDPLSREDIWELVDEAHSLGVPVAMAPSPSRALL
FT                   DNLDRIASGKVSAVSISIDHPSPEVHDKVRRYQGSWEAGVTAIRELIRRGVKVQVNTAV
FT                   MRSTVDGLPGMVKLLKDLGVDVWEVFYLVPVGRAEAREDLTPQEWEDVSAFLYEASRYG
FT                   INVRTSEGPMFRRVSLLLNYARSRNLEPSKLVKLGDLYLRLTGQLRALLGEPGEEARFE
FT                   TSGTRDGKGIAFISHDGMVYPSGFLPVPVGNVRRERLVDIYRRSRLMVSLREASFRGRC
FT                   GSCEFKEICGGSRARAFAYSGDPLGEDPACPYVPGSLGVNVKEVMAP"
FT   gene            122393..123364
FT                   /locus_tag="ASAC_0112"
FT   CDS_pept        122393..123364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18520"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN2"
FT                   /protein_id="ADL18520.1"
FT                   /translation="MSGLTDLQVKALMELEYNFPLTSADPYADVASSLGVDEGTLLQEL
FT                   RLLRSRGVLKRVGFYYNFRSQGKDAALVALSAEDVDAVAKATAVDPLVTHSYLRDDPDY
FT                   NVWIVVKRDNMDEIIKAAEELARVGRASRHVVLTSVRTYKLSVKYDLVRGVSRAGRYAV
FT                   VPPRAPRPEALGVSPKLPEALRSLPLEPRPYSAAAKLSGLSEEEVVRLIPRLLEAGVLL
FT                   DPGAAVDGESLGFKENGMVVMEPSGSPEELCEAAARSEYSTHVVLRSSIPEGAWRYPCY
FT                   AMIHAVRRDLVEEVARIIARDAGAKSYRIIYSLRDLKPGVVR"
FT   gene            123361..124533
FT                   /locus_tag="ASAC_0113"
FT   CDS_pept        123361..124533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0113"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18521"
FT                   /db_xref="GOA:D9PZN3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN3"
FT                   /protein_id="ADL18521.1"
FT                   /translation="MIPVSVMVAGKGTVSTKIKGHYGKGSPSRFSEELRPVVFWNITYA
FT                   CNLRCEHCYIDAGPTPRQDELGRGRLLEVAEEMAELGIPLVIFSGGEPLLKPEFWDVAR
FT                   LLSERGRPKMALSSNGTLITREVARRLKELNFSYVGVSLDSLRPDAHDKFRGVQGAFNM
FT                   TVRGIHNAVEEGLDVGIRTTVTRWNYSEAPKVVDLAAQLRASRVSYYLLDSIGRARNIV
FT                   SELPSPQQVKEFVDAIVDKAKEYAGKVEVELVRANFAGIYIADLLAKDGNEFMDYLKLI
FT                   SAQGDCGRKTISIYPDGTVRPCQFIDEYVIGDLRRQSLREILSYNNPELVKFIKLYENL
FT                   RGPRCGPCPFKLVCGGGSRGRAEAASGDFWGDDPLCFIDPLDVWRRRGQG"
FT   gene            124530..125201
FT                   /locus_tag="ASAC_0114"
FT   CDS_pept        124530..125201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0114"
FT                   /product="Siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18522"
FT                   /db_xref="GOA:D9PZN4"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN4"
FT                   /protein_id="ADL18522.1"
FT                   /translation="MTFIPLFIDVSGLRVVVFGGGSVGTRRALEFSSAGAKVTVVASQF
FT                   SHELEVAAKAGQVELVKAEVRPGDNVDRFIRGAHIVVIATSDMELNDYLASRALSLGVL
FT                   VNNATEARRGNVVYPFTAEPIEGLKVAVTSLGLSGVAARRARDRIVECLSSDRYLRTLL
FT                   SVMSKFKEELKESVSDPKVRVPLYFKVSEDEVFNRLVEQGDEDGALRRALEIARASLNR
FT                   A"
FT   gene            complement(125198..125518)
FT                   /locus_tag="ASAC_0115"
FT   CDS_pept        complement(125198..125518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18523"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN5"
FT                   /protein_id="ADL18523.1"
FT                   /translation="MVSKEQAVKLIDAALRKVALGMVVNLDSHFYMTHGRSFAESLVED
FT                   PVGTYREMLQVVPESMARTMIRIAIRSLGSFSVVDIEKALEALKEGNPGPFQSLIGGGG
FT                   VG"
FT   gene            complement(125682..125759)
FT                   /locus_tag="ASAC_R0003"
FT   tRNA            complement(125682..125759)
FT                   /locus_tag="ASAC_R0003"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   gene            complement(125851..126735)
FT                   /locus_tag="ASAC_0116"
FT   CDS_pept        complement(125851..126735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0116"
FT                   /product="Amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18524"
FT                   /db_xref="GOA:D9PZN6"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN6"
FT                   /protein_id="ADL18524.1"
FT                   /translation="MGGLLVSSEVGRLREVLMHVPGQEVSIVNESNYRRYLFRSPVNLE
FT                   EARREVEGLIEVYRKEGVQIHTVEGLTDKPNAMYARDPFFMGPSGAIISRFMYEVRRGE
FT                   ERAFKDKIEGLGYPIVKVMEDDEVFEGGNAMMLSPKVAIAGVGERTNRKGLWSFIETVK
FT                   SMGVEEVVEVQVPINVIHIDEYIAQVDVRTIVTVRQMFPWEAMDRLQRLGFNVLPMEYS
FT                   QLPGGVSARLCLNMVALRPLKVVMGSGCDPVRKALESEGVDVIEVKIDEVLKGGGGVHC
FT                   LTGVLRRDQVSES"
FT   gene            complement(126805..127650)
FT                   /locus_tag="ASAC_0117"
FT   CDS_pept        complement(126805..127650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0117"
FT                   /product="Uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18525"
FT                   /db_xref="GOA:D9PZN7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN7"
FT                   /protein_id="ADL18525.1"
FT                   /translation="MEERMSSASRPFDSEGRAYHLGLRKGDVPKYVLMPGEVERASRIA
FT                   SSWDRSWRLAQRREYSSFRGVYRGVDVAVVSTGIGGPATAIAVEELLELGADTLIRVGS
FT                   TGAIQDDIEVGDIIITTAAVRMDGTSYQYAPAGYPASASYEVIMALVEAAESLGVRYHL
FT                   GITASTDSFYVGQGRPGYGGYMPSWSRNLVPDLRQMRVLNFEMESATLLTLANIYGFRA
FT                   GAVHAVYAQRVKDEFVAHAGEENLIKVADEAVRILHEWDEVKGRAGKRYFYPSLLRPGP
FT                   "
FT   gene            complement(127686..128624)
FT                   /locus_tag="ASAC_0118"
FT   CDS_pept        complement(127686..128624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0118"
FT                   /product="predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18526"
FT                   /db_xref="GOA:D9PZN8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN8"
FT                   /protein_id="ADL18526.1"
FT                   /translation="MPLRIAVLHTRIRLGARRTNTKRFLELAAKAVSDHPVDILVLPAY
FT                   PVTGPIVGYYPDQKVPSILKGFAERISESEMQLSPTLTMVSKVSEEYGVYVIAGPLVER
FT                   AGPRLYLTTIVVGPNGRLIGKYRKVALTRKERESGLTPGKDVLVFEVGRTNVRVGVFVD
FT                   EDINYPEVLRSLSYNGADVVIGAMLPFQSNFIRMRSEPSNGILTLDYEQVMELLDVRTR
FT                   ENGFSAVLVGGAVEGSNGLGYVAFMPTIMAEPENGVIKDRIRLFDDLDLPVYVEVDKAA
FT                   SREPKDFLYPLLRSLCRNSGAKGGEPEEEEL"
FT   gene            complement(129004..130011)
FT                   /locus_tag="ASAC_0119"
FT   CDS_pept        complement(129004..130011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0119"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18527"
FT                   /db_xref="GOA:D9PZN9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZN9"
FT                   /protein_id="ADL18527.1"
FT                   /translation="MELRLFVTREIPFPAFESIKGLFQKVDVWPEYRPPTKEELISRAK
FT                   GAQALVTMLEDKVTCDVIEALSPELRIIAQYAVGFDNIDLECATKHGVYVTNTPDVLTD
FT                   ATADLTWALILAVARRIVESDAYVRSGGWKSSGTAWHPTMMLGFDLVGKTLGIVGGGRI
FT                   GQAVARRAKGFDMRIIYNSRRRHPEMEALGATYVDLDELFRESDIVTLHVPLTPETQNL
FT                   VNESRLRLMKRTAIVVNTARGKVVDIDALYRALKEGWIAGAGLDVYPTEPLDPSHPITK
FT                   LSNVVLTPHIGSATRETRAKMAELVYRNLEAFSRGERPPTLVNEEVLRVRPPGF"
FT   gene            130158..132242
FT                   /locus_tag="ASAC_0120"
FT   CDS_pept        130158..132242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0120"
FT                   /product="Putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18528"
FT                   /db_xref="GOA:D9PZP0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP0"
FT                   /protein_id="ADL18528.1"
FT                   /translation="MTYIGIVNFAWVKQYEALVYAIGFVVFLWLLYAAYDGYRRWTHGL
FT                   PKWRLMFWPPGYPVSKALRNFAQFALLQWKTLRQRFPGTMHALIFYGIGWLFIATILRA
FT                   INMHVVVFLTGDVFYAYKLLNNVAGLMVIVGASIAIVRRRLRLTPNLPQDPYYYLVLGL
FT                   LLVIVVTGFLVDGIAGVAYRYTWERPWFDPVGYLVFTWARTVPVPELQEIYRGLWLFHM
FT                   SIAMAALAIIPFTNLWHIYAASLNVAFQRQGAAPQGVKPVTDLDERIEQGRPLGVVKLS
FT                   DTTWKQRLDFDACTSCMRCTNACPAFTAGKPLSPRDVIVTMRDAMREGLWDQQAWGSGR
FT                   LQVNPEALWSCVTCGACVYECPVTIHHVDTIIDLRRGMVSVGSEDVPKDALDALYRLQQ
FT                   NGNPLGANPYDKEQWLNELAQKYGDDIIAKEGEEYDYLYWVGCITSYDPRIRPVAEAIV
FT                   SLLRSAGVKVAIPAEQGCCGEPARAIGDEALYVELMKQALEVLSRYKFKKLLVSCPHGF
FT                   NNFKNNYRLYRDYLAKREDTAKLAEVLDKLEVEHHSVVLARLIKEGRIRPGKGIDAVVT
FT                   YHDPCYLGRWNGLYEEPRSVIESTGLRIREMPRNRSRSFCCGGGGGQLFYEVKKGERIS
FT                   TLRAEEASKTLGEGGRKVVAVACPFCNTMFRAESGKFNFEVMDIAEILKASVKEDKGSS
FT                   "
FT   gene            complement(132237..132710)
FT                   /locus_tag="ASAC_0121"
FT   CDS_pept        complement(132237..132710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0121"
FT                   /product="Small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18529"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP1"
FT                   /protein_id="ADL18529.1"
FT                   /translation="MSYDDVFERMRKRALRIMRDIMSDFDEMEAWMRSMVDDLEEEMRP
FT                   EQLFEERLKELRSGVLSPLISVHDRGDHLVIVVDLSGSDPRTVDVRLTRDRIAVRAQIR
FT                   SEALRKAYGQVSWARKVSYYSGEQVLPEPVDPRTAKSELKGGVLIITVRKASS"
FT   gene            complement(132724..133500)
FT                   /locus_tag="ASAC_0122"
FT   CDS_pept        complement(132724..133500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0122"
FT                   /product="hypothetical protein"
FT                   /note="DUF75 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18530"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP2"
FT                   /protein_id="ADL18530.1"
FT                   /translation="MPLAAYEEEILGYNFIEYGELGKPKYLVLGIPDAGLVGPIASGHI
FT                   VGSLKLSDAVGIESYGYLPPAAVVVNGSVKYPIRIYSGGNMAVLVTEVMPVASGIVPLA
FT                   IAIVEFARKRGIEYIVGISGLGNPARAEAQPSLYWLATTPEAEALAAPLKDMGKPFPDG
FT                   LIVGPYATILKESVKRGVNTLLLLTDSFVDIPDPEAAALAVQGLSRVTGVSVDVSQLLQ
FT                   EAETLRLRLQGMAREAKDALAKVGKGYEYRAPLIYS"
FT   gene            133784..134023
FT                   /locus_tag="ASAC_0123"
FT   CDS_pept        133784..134023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0123"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18531"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP3"
FT                   /protein_id="ADL18531.1"
FT                   /translation="MTLKVSIDPRDNCIADMVCVSLCGDVFEMSDVDGKSQIIAKWRTD
FT                   PNTINVGQVPDDMKDCAEAAQQSCPTSIIHVEPA"
FT   gene            complement(134075..135424)
FT                   /locus_tag="ASAC_0124"
FT   CDS_pept        complement(134075..135424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0124"
FT                   /product="Glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18532"
FT                   /db_xref="GOA:D9PZP4"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP4"
FT                   /protein_id="ADL18532.1"
FT                   /translation="MGEAEAGKDPDFLEVQYIDLPGIVRSVTIPYESYLKKSDGFIAAF
FT                   DGSSVEGFEPINRSDLLLAADKSTFSRIPWRPERARVLGKIYEPSGQRYRKDPRYVAEA
FT                   TIKYLADSGYGPLAGAEVEFFLFKSLKIDVLNPLRGVGYSVVSQEQPWDTEAPHSVVKR
FT                   AYHLPEPMDTLEPIREKMLKYFRAFGYDFNATHHEVAVSQSEVSVKAGDPLFVADEIVT
FT                   FKQVARQVARENGMVAVFLPKPLYGDNGSGLHFHLSLWDSKGNNLFADDSDGLSQTARY
FT                   FIGGILEHGRSLAAFVAPTVNSYRRLVPGYEAPVYLVWGYSNRSAAVRVPATGGNKGLT
FT                   RVEFRSPDPLCNPYLALAATFLAGYDGIVRKIDPGDPVSDNVYEMEGRSLKTLPKSLDE
FT                   ALDALESDYQYLLPVMSKELVESYIEVKRRESDAIRMYPSPVELYMYMSY"
FT   gene            135610..136635
FT                   /locus_tag="ASAC_0125"
FT   CDS_pept        135610..136635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18533"
FT                   /db_xref="GOA:D9PZP5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP5"
FT                   /protein_id="ADL18533.1"
FT                   /translation="MKALTSDEGSLEGRVLPRKVQKLGTSSLIITLPRDWARSHGLKAG
FT                   SMVTIVEDGDRLVVIPYVKGRPLTASFSLKHLNICKHLGRVVFCAYLSGLDGLTFYSNR
FT                   PIRADLVEKISRVSETINNDSVKVYLNNMYEVNVAIEEYRDDIANALANYGRSLASAFS
FT                   RLSQHVAGIRMTEEELESIYSDLRGLAFRTLRSGAKGVGYGISQEHLNRLLMAGVGLMV
FT                   LVNDSFYKLGKDLLTLDSQLTQDERDRVKFLFQVLEVSLVAASLGVEPPSIKKEEDAYF
FT                   KLRSLLDLEGELSDIVRNSTAAYAYILAKTLDIARIIKNIEETLLCHALFKKYSESEQE
FT                   I"
FT   gene            complement(136601..137275)
FT                   /locus_tag="ASAC_0126"
FT   CDS_pept        complement(136601..137275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18534"
FT                   /db_xref="GOA:D9PZP6"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP6"
FT                   /protein_id="ADL18534.1"
FT                   /translation="MSQQGGPKSKAAAFIVLIALAVVLISTNVAWYFNYTSLQSRYNRV
FT                   YSSLQNVTGYALSTAKLLNESVKLLKDYENLTKYLNTTIDVLNAERSLLITNVSLELNL
FT                   IAVKSFDAAVNLTIEANQTPSVYYRYELVTAASEAANLSVEAIKSLQLVGAEAGANSTL
FT                   TGYLSQAEQAAQNLSVIAKSLVNGPDPQLQGKLTSVTDSFLSSLLRAESYIISLARTQS
FT                   TS"
FT   gene            137363..137920
FT                   /locus_tag="ASAC_0127"
FT   CDS_pept        137363..137920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0127"
FT                   /product="cytidylate kinase, putative"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18535"
FT                   /db_xref="GOA:D9PZP7"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP7"
FT                   /protein_id="ADL18535.1"
FT                   /translation="MSSICDGRRPVIVVSGQPGSGKSTYARRLAAELGLRYYTTGQAFR
FT                   SLAERMGVSLMELNRLAERDPSIDLAIDAESLNEARRGCVVIDSHLAGWLLRDLADVTI
FT                   YVKASLPERTRRIALRDSKPESEALFEASQREISHWERFAKYYGIDLRDLSSYDLVVDT
FT                   TRMGIEETYQVILTFVKKALSV"
FT   gene            complement(137940..138239)
FT                   /locus_tag="ASAC_0128"
FT   CDS_pept        complement(137940..138239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0128"
FT                   /product="DNA/RNA-binding protein Alba 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18536"
FT                   /db_xref="GOA:D9PZP8"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP8"
FT                   /protein_id="ADL18536.1"
FT                   /translation="MVCEGAPEVRIGKKPVMNYVLAVLTTLMEQNVSQVVIKARGRNIT
FT                   KAVDTVEIVRSRFAKNVTIKGIDIGSHDITVTDPQTNQQKTRRVSSIEICIAKA"
FT   gene            138452..139675
FT                   /locus_tag="ASAC_0129"
FT   CDS_pept        138452..139675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0129"
FT                   /product="Probable protease htpX-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18537"
FT                   /db_xref="GOA:D9PZP9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZP9"
FT                   /protein_id="ADL18537.1"
FT                   /translation="MVMYDPLFGLFAFMMAYWWLLILTSIAAGGAVALMAAIAPKAIKG
FT                   EPKSLARLRTSMAITAVAIVLAGVGVFIGVAELIGYIFGYSLAGSYLVMTAVIFTFFII
FT                   LIQWLLSPLFINLVYRTHPPRTDEEKKYQAMLEEVARRSRIRTPKLRIAETNVPNAFSY
FT                   GSPLSGSYVAVTRGLLNLMPDDEVEAVLGHEVGHLRHRDVSWILALSVIPLAVYYLGQM
FT                   LIWSGFFGGGGGEGRGRGSGANGGILLMLVGMLLVVVGVVFRFLVGNFNRLREYYADAN
FT                   SAMVTSPRKIQRALARLHIAVEGNNYFKHQVNSSSGSMLKALFIVAPFVEISGGFLYEP
FT                   DEGAWPWRRRKEPDLSRYRDYDVDQLIEKIKNEKTDPVAEMFATHPPIPKRLRFIDNIR
FT                   YSVNPVEP"
FT   gene            139940..142867
FT                   /locus_tag="ASAC_0130"
FT   CDS_pept        139940..142867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0130"
FT                   /product="DNA polymerase 1"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18538"
FT                   /db_xref="GOA:D9PZQ0"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ0"
FT                   /protein_id="ADL18538.1"
FT                   /translation="MALRNDGSPQAGGQGRANEGRSSAASAKSEGKGGGNDRAPAKQPQ
FT                   SQKQPEPATGKRAARSILDFMSEPSAQEPPQTAQRPKAERIDKQEASEVPTKVQQEPEE
FT                   PPRSEPEVKEVRLPETYAWYASSNDYLVEAQQGQRVPGQWWLFQEETYAAQASGYLLEV
FT                   RYDGDLGKAVAFIYDPSTSKVVKWVDRTGHKPYFLTNMELGEDGRPPIDLTKYKSFSNL
FT                   AVVTKRDPITNRDVKLTKIITNDPLAVKTLRAVLTEKGYRVWEADIKYFLNYIYDSQLI
FT                   PGMPYDVSDSWRQKEWKRSEELEKLIKESFTEDLRDMALDWQYIFEEPSPKVPKVAFDI
FT                   EVVAPGEGRFPEPKEADMPVMSVSIVDDKGNKSVLLLARPASRFSGRQKLEGEVELFDS
FT                   ERAMLLELLRRLSRYAVVFTFNGDNFDVPYIYNRLVNLGVRPEDIPIVFLQDYVTFKGR
FT                   LHVDLHRVFDIKALQSYAFGNKYREKSLEAVSEALLGQTKREISTFLNDVSLDELAAYN
FT                   LQDSVLTMGLVIFNNELTWNLLVLLMRISKSGLEEVSRSQVSAWIKSTLYWEHRRRGLL
FT                   IPSREDIERMIGKQAPRSAAIIKDKKYRGAIVLQPPQGVFFNVIVLDFASLYPSVIRNW
FT                   NLSYETVDNPYCQKYVEAPEVGHRICMDRRGISSQLVGLLRDFRVKVYKKKAKSKDLSE
FT                   EERIWYETVQAAMKVYINASYGVFGNEAFALYSLPVAESVTAIGRATLLETLRRASELN
FT                   LHILYGDTDSLFVWDPPKDALNEIIKYVQEKLGMDLDIDKTFRLVLFSGLKKNYVGFDG
FT                   DSYIIKGMVAKKSNTPEFIKFETADVMKILSGLQRPEDLEKTLDLLREKVQEIYTKLRR
FT                   REYTLDQLAISVMMSKDPMEYKKNTPQHVKAALLLINEGVPVTRGDIISFVKTKDKVGV
FT                   KPVRLARLADVDTTKYLEYVRSAFEQFLLAFGVRWDEMTGVKKLL"
FT   gene            complement(143067..143585)
FT                   /locus_tag="ASAC_0131"
FT   CDS_pept        complement(143067..143585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18539"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ1"
FT                   /protein_id="ADL18539.1"
FT                   /translation="MAAEESSKPVLYRLVLRKTARGLIIQFRGPGSQGREATLVRIGGR
FT                   KAQQLFDMLSTALKNGNYIEEEASTGNYTSYKIKPEVGAAVGGFLVITRRSRDPTAWAP
FT                   YFADLIGGTKYPGSREVLSSVLSLGLQLSKISPPPARARMQLNPKILDAISAGLKVTAR
FT                   KLWGIRSPK"
FT   gene            complement(143752..145260)
FT                   /locus_tag="ASAC_0132"
FT   CDS_pept        complement(143752..145260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0132"
FT                   /product="Na+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18540"
FT                   /db_xref="GOA:D9PZQ2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ2"
FT                   /protein_id="ADL18540.1"
FT                   /translation="MLGIAGWVTFWAFFVVFVFLGFYGARWRRGNLAQLHEWALAGRRL
FT                   GVFLAWFLIGADLYTAYTFVAVPSLEYAQGAIAFFAVPYVAITFAVAMLFMTMLWDKSR
FT                   EKGYITAADFVQDQFNSVTLAILVAVTGIVAELPYIALQIDGMRAVLEVMMTGLSSATR
FT                   ISEIALVVAFIILAAFTYTSGLRGSALGAVFKDVLVWLGVISLIIIVPLSINGGFSAAF
FT                   SAAAKHNLISGTEYLKPAFASAYESLFIGSALALYLYPHAVNGSLSSESRKALRYSTAL
FT                   LPLYGIGLAILALLGILVYASPGAESLLSQFPAAERGLLAVPALAVATLPSWFAGLVLL
FT                   GIFVGGMVPAAIMAIAQANLLVRNLIKPFFRLSERGETRAAQWASVFFKFLALGFVFVT
FT                   PLTYAIQLQLTGGIIILQTLPPVFLGLLTRKLNKHSLIAGWVAGMLSGIYLLLLANHFG
FT                   PLTKSAYPVFGHSIYIGIISLAINIAVVLLGTAIAYAAGWRPSK"
FT   gene            complement(145267..145494)
FT                   /locus_tag="ASAC_0133"
FT   CDS_pept        complement(145267..145494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18541"
FT                   /db_xref="GOA:D9PZQ3"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ3"
FT                   /protein_id="ADL18541.1"
FT                   /translation="MIEMSGGLTVGQKVVIAILLIIPLIAYMAYTTYDFVSPSLGGVPF
FT                   FYWYQTLWLVISSLLFIVAAVLWERWLSGR"
FT   gene            145656..145877
FT                   /locus_tag="ASAC_0134"
FT   CDS_pept        145656..145877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18542"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ4"
FT                   /protein_id="ADL18542.1"
FT                   /translation="MQGAGEGYPRKLVIGDINNMWIEYDKQSDTLYIGFSDKEAEESFM
FT                   LDDGTIVNVSGDELISIVIQNASSRLNL"
FT   gene            complement(145874..146326)
FT                   /locus_tag="ASAC_0135"
FT   CDS_pept        complement(145874..146326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18543"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ5"
FT                   /protein_id="ADL18543.1"
FT                   /translation="MSDCKVNCGNITELIQFNVTRAAQALQEHADLLERMRGQLNQYMS
FT                   LRDEEREGMVEQIEDTIRSIRSAREGIEKATREYEMLVGCCLARDDYMEALLGYYLMAG
FT                   SRRERELLSAASRVVDVSEDIDGIGRVTGLIQEVLVSVSSKVRRSG"
FT   gene            complement(146323..146670)
FT                   /locus_tag="ASAC_0136"
FT   CDS_pept        complement(146323..146670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18544"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ6"
FT                   /protein_id="ADL18544.1"
FT                   /translation="MSSGDEGKVDIGKMLSFIPPASTLYSKQSKIQEKRVKLIHDAAVE
FT                   QGTLRISKKLATELGITDEAEIAVGGKIRLRLKAAIDESTDDDTSVWANPDEMREHGIA
FT                   DRSTVSVRSPK"
FT   gene            complement(146676..148427)
FT                   /locus_tag="ASAC_0137"
FT   CDS_pept        complement(146676..148427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0137"
FT                   /product="Glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18545"
FT                   /db_xref="GOA:D9PZQ7"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022960"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ7"
FT                   /protein_id="ADL18545.1"
FT                   /translation="MTEDIYDKIVDLAKRRGFFWPSYEIYGGLAGFYDIGPYGLTVKRK
FT                   IIEAWRRLFVFNHQDYVVEIETPAVGPSIVYEASGHVESFTDPVVRCTKCGRIYRADHL
FT                   VEDALKVSAEGLSPEELTRKIRENNIRCPVCGGELSEVSTFNLLFKTQIGPYEGSVGYI
FT                   RPELAQGMFVSFRRVLETMRNRMPLGIAQVGRVGRNEISPRQGMIRLRDFTIMEMEFFF
FT                   DPQSGQCPNLDRVMDRKLRVRQYKVRLEGGGPQEFTVRELIEKKVVAHPCMAYWMTVGL
FT                   DLVKYIGVTEDETFFEEKGPKEKAHYATQVFDQLVRTSRWGWVEVAGYAYRGDYDLSRH
FT                   MKYSGQDLKVFEPYKEPRVEKVKKVLVDLAYAGRTYRSRASEAVKLAESLPAEEAERQL
FT                   REMGKLRVGDFEFPASAVKIVEVEQKVSGRSYTPHVVEPSFGTDRLLYVALERAYREKE
FT                   GRVVLSLPRYLAPVDAAVFPLIEGEEKLEARARQLRDLLVSAGFTVLYDDSGSIGKRYA
FT                   RADEIGVPAAFTVDYQTLEDGTVTLRDRDTWRQVRLRLEDAPEALKKFIYNLVDIAQLG
FT                   KPVEPEG"
FT   gene            148502..149416
FT                   /locus_tag="ASAC_0138"
FT   CDS_pept        148502..149416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0138"
FT                   /product="Agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18546"
FT                   /db_xref="GOA:D9PZQ8"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ8"
FT                   /protein_id="ADL18546.1"
FT                   /translation="MGLGRLYITTANRQFAGIEGNPKSKYRIIGVPYDSTTSFRPGTRF
FT                   GPDAVRLAAAGLESNSAFIKDVYLEDLSPLDEGDVAVSIGDTGETLARVEAVVRELASA
FT                   GLPVMIGGEHTVTLGALRALADRKPCVVMFDAHLDLRNEYLGLKVGHATFMRRALEQVN
FT                   IPRLIYIGARAFSREELEFARSKDNIITIFGPSDLITLGPINVASNVLSALKSCESTYL
FT                   TVDMDAFDPAYAPGVGNPEPLGLAPYEGLYLVSRIVDERLIGMDVVEVSPHYDPGGGTA
FT                   ALAAKVLIEAMLKHYVSRAKASR"
FT   gene            complement(149409..149651)
FT                   /locus_tag="ASAC_0139"
FT   CDS_pept        complement(149409..149651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18547"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZQ9"
FT                   /protein_id="ADL18547.1"
FT                   /translation="MSEEPVDEGEAQGTGESGEVELYGIKPREVYYMCLRCGYKASKSE
FT                   LSQYYSMVCPKCGYRIFVKVRAPSTIVAPRRVYAI"
FT   gene            149744..150049
FT                   /locus_tag="ASAC_0140"
FT   CDS_pept        149744..150049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0140"
FT                   /product="translation initiation factor Sui1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18548"
FT                   /db_xref="GOA:D9PZR0"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR0"
FT                   /protein_id="ADL18548.1"
FT                   /translation="MSENIECGGLPPEICEQLNAEQQIIKIRLEVRKFNKQVTVIEGID
FT                   SKQFNLKEIASKLKSELAAGGTYKDGRIEIQGDHRRRVKEILVRMGFPEENIMIIE"
FT   gene            150090..151139
FT                   /locus_tag="ASAC_0141"
FT   CDS_pept        150090..151139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0141"
FT                   /product="nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18549"
FT                   /db_xref="GOA:D9PZR1"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR1"
FT                   /protein_id="ADL18549.1"
FT                   /translation="MAGYPSQPGTALRPIAVYVGGSTLTSTIPGLSIAGPSPEGTLYTP
FT                   TLDLEYLTLGLPRTMNVIPMTPDGLPTPALITRAALELIKVPYLVVDAGTYYGIKAPHV
FT                   RLPSARHGGNIAEGPAMPRGTARSLFEEARTLGRLISRGHDLVLIGETIPGGTTVAAAI
FT                   MSAAGLDGVSYVSSASPDNPKDLKRQVVSKALSRVSEGSDIFSIVDAVGDPVHVTMAGV
FT                   ALGAMEEGAMAVLAGGTQMGAVLAILKGVGADTSKVSLWTTKWILNDETSNIRAIAEAF
FT                   DVRDLEGSEVDFSDSPFEGLRMFERGFVKEGVGAGGTMVLAAKMGFDANSVKSAIYSEY
FT                   KRLRNLGSA"
FT   gene            151126..152208
FT                   /locus_tag="ASAC_0142"
FT   CDS_pept        151126..152208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0142"
FT                   /product="adenosylcobinamide amidohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18550"
FT                   /db_xref="GOA:D9PZR2"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR2"
FT                   /protein_id="ADL18550.1"
FT                   /translation="MAALELGDRYLIVNFGAPRHILTTAHPEGLVMASKVAIYQVTDSD
FT                   DLSRPERFKEEVRRALGLGGSDPVMLTAADVSKYRSAVEGNYGVVATVGLSHPSCHDMR
FT                   STYVPLMPSTINIVAWVPDRLTASAMVDLLRVVAETKAAASADLMLRCDGGRATGTVSD
FT                   AIAVAATLDPSGALWAGQATTVGSKVASLVYRALVSEKPSREQVLSWALGLSLEELVDD
FT                   AMKLYRSAPVPGVAEGKVKEMVARELSRILQDPNVWAFIVAARENDIRGQEGLLPGLGS
FT                   DEFAADTKKVIADELLATALSLYINGFKALTATYWADAMKDRLGLKLASLPMFEDDIAA
FT                   SLAASALSRVYDRLLGEGHD"
FT   gene            152201..152716
FT                   /locus_tag="ASAC_0143"
FT   CDS_pept        152201..152716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18551"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR3"
FT                   /protein_id="ADL18551.1"
FT                   /translation="MIEVAAIMAGGLGSRLGGPWKPTVNVCGRPLISYVIDAVSPVSRL
FT                   ALIVTSPASSSYLRGLSLPPSFAELMLDGSGYGYDLGRLLNVVRPRPLLVLPADLYGLR
FT                   ARDLEEACRVSLRVAEPVVTVRARGEYVGISIFKGYSYDEWADVDIDMDVINVNDGESL
FT                   EEARGRCK"
FT   gene            152688..153764
FT                   /locus_tag="ASAC_0144"
FT   CDS_pept        152688..153764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0144"
FT                   /product="Threonine-phosphate decarboxylase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18552"
FT                   /db_xref="GOA:D9PZR4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR4"
FT                   /protein_id="ADL18552.1"
FT                   /translation="MRRPAAGVNRAHGGAAPPGALDFSAPANPLGPPPGLREAVSECAA
FT                   LGSYLRYPSPSDYLNLLGAVSEFLDVDEDHIVLSNGSAELLSLIPLSLRARSLIVVEPN
FT                   FGDHELLARATSLELVRVVMRPSDNAFSLDEDGVIRAAKAARGPAVLVLSRPNNPTGLT
FT                   VDEKAIDRIASSLPRHAWMVVDEAFVDLCPSCRSLGDRDDIVVLRSFTKSLASPGLRLG
FT                   VMVTADRRALEAIAGSMQAWPVDSITACSLSKVLALKSTALHVERGKEIVRQELPRVTS
FT                   ALRSMGLKAFDSSAPYVLVRHTLPNPQFQRSLLAHGFYVRDASTFYSLDSHYSRISIRS
FT                   PAENDAILKALEVVMGWA"
FT   gene            153755..154477
FT                   /locus_tag="ASAC_0145"
FT   CDS_pept        153755..154477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0145"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18553"
FT                   /db_xref="GOA:D9PZR5"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR5"
FT                   /protein_id="ADL18553.1"
FT                   /translation="MGLRDLLALFTRLPVGSGDLEAAASSFYMVPIVGLAEGVIVSLVG
FT                   FAVSAVKPAPMLAAALMLIAHVAVTGGLHLDGLADYSDVLGSGLRGEEAVRVLKDPRKG
FT                   SFAIMAVVVALVARLSAFYYLYRCPAIIVAAYASSLEASFVAARAGVQEPYEGMASRFE
FT                   RAARDGRQLLLNALTYIAIMTAIAVLRPLSLIGAAALLAGFLLAADANSRLGFVNGDVM
FT                   GASIEVGGVVALVLGALA"
FT   gene            154477..155418
FT                   /locus_tag="ASAC_0146"
FT   CDS_pept        154477..155418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0146"
FT                   /product="Probable cobalamin biosynthesis protein cobD"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18554"
FT                   /db_xref="GOA:D9PZR6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR6"
FT                   /protein_id="ADL18554.1"
FT                   /translation="MLPSFLYPGPLELLSALALALVLDIVYPYHSGFMLMVHPVHTSYF
FT                   MALRLYRPFSSRARGAMIWAAVMSSHLVAYAAALYLAYRLSPIAWIIVAGYITKTSASL
FT                   RLLIDEVNGAGRALEEGDLGRARALAQGLVRRDLSVEDAGHVASAAIESLAESLNDGFV
FT                   SPLFWYAVLGPLGALAQRLVNTLDGALGFKDPEHLKVGWASARADTIVNYIPARLTAAL
FT                   IVIASARSARRAAAAWASCSGLTESLNAGAPMSAMAGSLGVTLEKRGSYTLCPEFGRLP
FT                   GAQDIRGSVRVALAAASLMVGLEAIILALLRA"
FT   gene            155438..156460
FT                   /locus_tag="ASAC_0147"
FT   CDS_pept        155438..156460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0147"
FT                   /product="Putative asparagine synthetase"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18555"
FT                   /db_xref="GOA:D9PZR7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR7"
FT                   /protein_id="ADL18555.1"
FT                   /translation="MSCEALGLRLLSRVGDLLRRSSCDCVLFSGGIDTSFVTLAAVEAG
FT                   LRPKLITVLFQGSADEPYAEYVSKVLGLDLIKVRPTPEEALECIDVALRSMVTIDPIEA
FT                   VSGSAVCLGLRKARELGCRCVATGDGGDELFIGYDFLFGRDRNYLDGWLSRVASSAFFN
FT                   SVPISAQLGVTVLLPLYSDDAKAISREAFNEGCDVRDVNGTTYGKYLMRRVLELKGLSL
FT                   VAWRRKDPITRGSGSERLLGLMSSLVGDEEVRSLTSLTGVLVPSRPHAYLLGRRLSLRL
FT                   PMPGKATRNLCPICGSELRDGFCRFCGAYIDEAGSLSVYSDDASNISGASRLLSKGPKG
FT                   "
FT   gene            complement(156440..157150)
FT                   /locus_tag="ASAC_0148"
FT   CDS_pept        complement(156440..157150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0148"
FT                   /product="hypothetical protein"
FT                   /note="DUF72 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18556"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR8"
FT                   /protein_id="ADL18556.1"
FT                   /translation="MEAQGLEVYVGTSGWLYDWNEDGSLDWYVSKSGLNAVELNASFYR
FT                   FPFPSQVKGWARRGSGLRWSIKVSRLITHVHRLNERAQELWLKFRQLFSPMDNVIDFYL
FT                   FQLPPNFSFNEQNLGRLRDFLARAGLGPRAALEFRHSSWLSEEAIEEARGLGATFVSLD
FT                   SPLGVIIRSFNDIVYLRMHGRSAWYAYNYSERELMEDVSAIRSLSPRKVYVFFNNDHWM
FT                   LGNARFMLSALRAL"
FT   gene            157250..157867
FT                   /locus_tag="ASAC_0149"
FT   CDS_pept        157250..157867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18557"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZR9"
FT                   /protein_id="ADL18557.1"
FT                   /translation="MGSKLMSLSPLSLYILFHLKKANVDYAGSISKVIEVPIDKVVDEL
FT                   DRLEAAGLIQRRVGGSSIKRSEARFKLSDEVHKHHVYYELSREGEGLVRSLMRDPQELC
FT                   KYFEYLTGHKNVLKLLLFLFEVENEHAGTLAKVVGDTPCNTVDLLDRLETLGLVTKVKE
FT                   KVIKASHRKAKPKPETRTHHVYYKVSELTKMLIRYSGLRRAS"
FT   gene            complement(157862..158308)
FT                   /locus_tag="ASAC_0150"
FT   CDS_pept        complement(157862..158308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0150"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18558"
FT                   /db_xref="GOA:D9PZS0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS0"
FT                   /protein_id="ADL18558.1"
FT                   /translation="MIDTTFSRVDMGSVAEEVLREELPDYRVVRYTVPGIKDLPGAARR
FT                   LIDMGCDGIITLGWVGASQVDKYSYIAMSVGLVMLSVLTGKVIVDVTVHEDESQDPREL
FT                   KEIAINRARAHAENLVKLLTGGLDALRPWAGQGVRQGRPSVGPL"
FT   gene            complement(158301..158987)
FT                   /locus_tag="ASAC_0151"
FT   CDS_pept        complement(158301..158987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0151"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18559"
FT                   /db_xref="GOA:D9PZS1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS1"
FT                   /protein_id="ADL18559.1"
FT                   /translation="MGVDDAIKAFKDGRPVLIYDSDSRESEVDLVYHASSVTPDAIYTL
FT                   RTMAGGLICFATRWSIASYLGVPWGDDLIASVPALRPLTERKLFYGDRPAFTIWVNHMS
FT                   VRTGISDVDRSRTVRELYEVVKMFVSGDREGARRKFLGEFQAPGHVPLLASRGLRSRRG
FT                   HTELSIALATLAGLEPATTFAEMLDRGPSLSLEKARAIAEREGLALVSGREVMEACEGV
FT                   ELCWSD"
FT   gene            complement(158974..159660)
FT                   /locus_tag="ASAC_0152"
FT   CDS_pept        complement(158974..159660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18560"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS2"
FT                   /protein_id="ADL18560.1"
FT                   /translation="MLILIGNSSVAVQNSTITLASPQLAALRVNGVDVTYVSLPAGSSK
FT                   ITTYYQARGLVLITISNASLKLINVSPTYVQSLGGWTADVTLCVNSSNASLAGIWQGSS
FT                   YVNASGIPGLESIINGSEASCGHIVEFEGNLPEFQLVTYFTNSTWLSVLLRGDGWYANI
FT                   VLGGLTNGPSAHHTQPQGLPPPIYVSPGSGGGEALGKDLLEGPYVLLIISLLALTTSLV
FT                   VERGRR"
FT   gene            complement(159699..160322)
FT                   /locus_tag="ASAC_0153"
FT   CDS_pept        complement(159699..160322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18561"
FT                   /db_xref="GOA:D9PZS3"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS3"
FT                   /protein_id="ADL18561.1"
FT                   /translation="MGLLDDALDELAGDSTYRRAWYLFIIAFGVVAILVATFYKEIVSS
FT                   YVGQYLLNQTQSIRSIVSFVNTSSPYFYAALPGIIFAKNSLTDIMDFVLMITMVFPIFV
FT                   VVLNGGLVGFVSVYTLPIHGSSLAIFYFLAPHGVIEIPAFSLVASSMVLIFKRGLSKAY
FT                   SVAFSMLVLSVLLLVVAALMESSVTILTGSFVQALTNATVGAMP"
FT   gene            160631..161329
FT                   /locus_tag="ASAC_0154"
FT   CDS_pept        160631..161329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0154"
FT                   /product="hypothetical protein"
FT                   /note="DEF2192 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18562"
FT                   /db_xref="InterPro:IPR018693"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS4"
FT                   /protein_id="ADL18562.1"
FT                   /translation="MNVWNNIISVWDSGQQVDRQGAIELLRREYESLKITPIKGSADPS
FT                   DLYDKELTSLYVMGKYGMGLDEQYPEQFDSLFNLEIKLEQAASMLIAEGVNAKDKVLML
FT                   LGTVDGNTVARILRIGLTKVYFGFADDSHMKQLSDAISAAFPERADDVNRFLKFYSAFK
FT                   VALAIEQGSVRDRLTKEALKEAVAIQLGRGREAVPSDRYIVKIASEVFKVPGKVLRQIF
FT                   GGIKEGTGRP"
FT   gene            complement(161330..162529)
FT                   /locus_tag="ASAC_0155"
FT   CDS_pept        complement(161330..162529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0155"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18563"
FT                   /db_xref="GOA:D9PZS5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS5"
FT                   /protein_id="ADL18563.1"
FT                   /translation="MVFPFKSVEDFKIGLTEEHELFRKSVREFVEREVMPRWREIEESN
FT                   RIQPEIFKAMAEQGLTGVGIPEEYGGQGGGQLMTAIAMEEIARAVPSLAVAIGVNHLFA
FT                   VPVLEFGTEELKKKYVTPIARGERRGAHANTEPSGGSDVAGIQSRAVKENDHYIINGRK
FT                   VFISAAGEADYLLVSARTSPPQEGKRWWGITTFVVERDWPGVKIGQQFRVIGMRGEQPY
FT                   EVVLDNVKVPAENVVGKENEGFKVVVTTYDHTRIGIAAQAVGIAQAAFEKAVNYALQRE
FT                   LFGQRIVNFEMIVEKLADMYIRLEASRLLTYWAASLADQGRPEYTIAASLAKTFASESA
FT                   EWIARQAVQIHGGYGVDFETGLERYLRDAIITTIYEGTNEVQRLTIVKEMLRQAFGLRI
FT                   "
FT   gene            162884..164602
FT                   /locus_tag="ASAC_0156"
FT   CDS_pept        162884..164602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0156"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18564"
FT                   /db_xref="GOA:D9PZS6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS6"
FT                   /protein_id="ADL18564.1"
FT                   /translation="MIGSSWLFSVLGASGVMGPASLLSWILAGLFFALMVFGFAELGGL
FT                   FPFSGSLARYNHYTHGTISNYMLAWAYFVGAVTTVSSEAVAVVEYGSYYMPWAWNSKLG
FT                   LLTPAGVALAAALILLFFALQLVGVHVFGWFNRVITAWKLIIPTLTFLLLLALYFHPSN
FT                   VVSAPKGFFPFGTAAVFSGMITTGIVYAYEGFRQGLEYAGEAKNPQRDVPLGTLLALVV
FT                   TIAIYVLLQLAFLGGINWSAAGVPFGNWTALSQSSWGPHPFYSELVATGVPILVGFSVL
FT                   LLIDAVVSPAGTLAAYVGTSGRNLYGMSRVGYIPKFFADIHRGFRTPWIALIVSTIIAV
FT                   VFLLPFPTWYEIMSVSALATVYNYLTVGVTNHALRRLAPDLKRSYRPPLWYIVYPASFI
FT                   VAAMFVYWSGWSLVNVIIELVVVGLPLLVLGPYRSELRLSRSFAWSFAGVVWASSAAAI
FT                   AAYYLKLNNMGLVGFAIYWTVISLIQVGSLAALWTASRGHPDIKGAVWLVIFNIAMGII
FT                   SFIGSLGPLPEPIVPYPWDYLLAALVSLAVYFIGVYTAYETKDLKQVKERGLPIE"
FT   gene            complement(164666..165508)
FT                   /locus_tag="ASAC_0157"
FT   CDS_pept        complement(164666..165508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0157"
FT                   /product="Putative transporter"
FT                   /note="Related to glycerol transporter GlpF"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18565"
FT                   /db_xref="GOA:D9PZS7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS7"
FT                   /protein_id="ADL18565.1"
FT                   /translation="MGPRASRRLGYASLAVTVAVWGTAYPIIDVAERYVSPVALAALRT
FT                   LVGGAVLAAISRRLVANRRTLVAGFINIGAFLVLLNLSIVLSPNPSLAAVMIYAQPLFT
FT                   AIATPYVLHRKISGLQYAGVLIGMTGIGVLTAVDSRGLNTGLLLGLLGAVLWSAGTMYF
FT                   EKYVAGDAIDLVGATAFMSLASTPLVLAFWPLGMYIKLTLESIVMIIYITLVIQAVGWL
FT                   TWFYGVRSLGGVRAGAFSMVTPVIAIASTALLLGKVLAPTEVAASAAVILGATLVQLA"
FT   gene            165583..166050
FT                   /locus_tag="ASAC_0158"
FT   CDS_pept        165583..166050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0158"
FT                   /product="hypothetical protein"
FT                   /note="DUF2286 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18566"
FT                   /db_xref="InterPro:IPR017006"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS8"
FT                   /protein_id="ADL18566.1"
FT                   /translation="MKVLSIRAERGKVVRSEIVDGDLKEVVKRKALEAMNEWDPATSDF
FT                   IVLKDDRELEFPLPLKPEIVDLFRDLGELGGLGRTKDKAVAHFPVYTISFENHMVSEDK
FT                   YVEYKIYLLAPYINEDVRTELEAEAQDITTEKQGPEGIEEEGEGEEGEKEG"
FT   gene            166050..166637
FT                   /locus_tag="ASAC_0159"
FT   CDS_pept        166050..166637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0159"
FT                   /product="Neutral amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18567"
FT                   /db_xref="GOA:D9PZS9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZS9"
FT                   /protein_id="ADL18567.1"
FT                   /translation="MSLGRELFGLGEAVVTLFIVLDPFSVVPFYVSTVEKLPPEKRGGF
FT                   LRTLIYSAIFMLLAFIIIGVYMLELLGVTLNDFRIAAGIILLVYAISSLFDIEIGAPSS
FT                   PESIEKQAIVPLATPLLAGPGSISTALYFRYIYGYPVAIASVLINAALAYVILYFGERL
FT                   MRLLGKHGALLIDKFMSLILAGFAVSLIRASI"
FT   gene            166823..167263
FT                   /locus_tag="ASAC_0160"
FT   CDS_pept        166823..167263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0160"
FT                   /product="Stress response protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18568"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT0"
FT                   /protein_id="ADL18568.1"
FT                   /translation="MVGQVYKKILVGYDGSEGGEKALSRALELAKSFNSELCLLTVIPP
FT                   SSMAFGEIVVPDAVNLSLIIESSRKRLSDLAAKLSAEGYKVRFEVLTGDPGDTIVSYAE
FT                   VNGCDLIVLGRRRLSKLERLVLGSVTHKVAGKSTKADVLVVP"
FT   gene            complement(167235..168446)
FT                   /locus_tag="ASAC_0161"
FT   CDS_pept        complement(167235..168446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0161"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18569"
FT                   /db_xref="GOA:D9PZT1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT1"
FT                   /protein_id="ADL18569.1"
FT                   /translation="MNIRTRSLLFTSVAHFLNDSFLVTVSILITYYIDMHVSPAFLGGM
FT                   AALVNVLSGLASPLISNRADRAGSHVTLMTVGFILIGASMASFAGTFVYGGVARLALIG
FT                   LGSVLLGLGLSFYHPLGGSILQYSYEGQAGRALGINGSAGSVGRAIFPTVMTIAIAYLG
FT                   GSEALAIIAAYVFILTAIISLGLHGLRMPATKESAARSFSRLSQYSYLLVPLTAIVFIR
FT                   AIFMTGVMTYVPTYVEHLVRSRILMGVIVTTSYATAIVGQPLFGWMVSRYGGRSVIILT
FT                   TLASTALYIAFLFTRGPIMITTLLGLYSFFAMSGFPVLLGYVSEVVDRSVRAQANSIVW
FT                   GIGNTVGGSVGALLGGFILQGDGLLGMTPLEATMWAFAAFAVASSIMLVMLPRGPKAQQ
FT                   ARQP"
FT   gene            168567..169337
FT                   /locus_tag="ASAC_0162"
FT   CDS_pept        168567..169337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0162"
FT                   /product="Putative sugar-phosphate nucleotidyl transferase"
FT                   /EC_number="2.7.7.13"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18570"
FT                   /db_xref="GOA:D9PZT2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT2"
FT                   /protein_id="ADL18570.1"
FT                   /translation="MELTTETWGNRLSLTAAILAGGEGTRFRPYTDLIPKPMIPLGPDE
FT                   KPVADHIVNVLIKGGVSHIVFLVNYKWKYVRNYFGYGDRFGIKIDYSIDDDKYKNTGGS
FT                   LLKAYKHHLLDSDPIVVWYGDILAPINASGLVKEHVRQGVDALLVVANSYQVPVGVAEV
FT                   NEKNDVVSLKEKPWVDMKVTIGVLTIRPGLLEEYEGQLGTSFDIMGDLIPAMISSGRKV
FT                   KAYIYDGPWVDVGSLERYKKIDEDLLRKVTELPS"
FT   gene            complement(169318..169710)
FT                   /locus_tag="ASAC_0163"
FT   CDS_pept        complement(169318..169710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18571"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR012016"
FT                   /db_xref="InterPro:IPR020794"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT3"
FT                   /protein_id="ADL18571.1"
FT                   /translation="MTMELRGRQLVPGRAAGQAVVMDALSFYGDVDPHTGRTPDGRSVA
FT                   SRVIVARRPRGSTVGSYVIYALKANGAAPAAIVMSRVDPIIVAGCVLAGIPLVDSIPED
FT                   QLSKVRDGDLVELDGSGVVRVRRAAP"
FT   gene            complement(169707..170912)
FT                   /locus_tag="ASAC_0164"
FT   CDS_pept        complement(169707..170912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0164"
FT                   /product="putative aconitase, subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18572"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT4"
FT                   /protein_id="ADL18572.1"
FT                   /translation="MYLTAEEERVLRGEEGEARAKALEVIVKVGEALGAERLQPIVHAH
FT                   VSGVSYNNIGEPGRKFIEDLANMGARFSVPTTVNPIGFDLEAPEAFDLISADREVLEGQ
FT                   RAIVSALHRMGASLTLTCTPYYIPSVRGLRPGQSVAWGESNAVVYANSVLGLRTNREGG
FT                   PVALMAAIAGRTYYYGMHVPEFRRPRAAYRLEAPGGYRLDYARAAVLGRVLVRLHRGEG
FT                   PPLLDASVDRETFKELGAAVGAEGDIAMVFVPGLTPEEPPSRFEEVVTIDYRDVEAELE
FT                   SMRLDDVDLVYVGCPHASAEEVEALARELSRLKPKGNRPQLLITTSRDEERRISPEAMA
FT                   VLREYGAVVLRDTCLIVSKLRREGLRVATYSYKAMFYLSRHGLRVGLESMEELARRLGS
FT                   EA"
FT   gene            complement(170912..171910)
FT                   /locus_tag="ASAC_0165"
FT   CDS_pept        complement(170912..171910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18573"
FT                   /db_xref="GOA:D9PZT5"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT5"
FT                   /protein_id="ADL18573.1"
FT                   /translation="MKVEVNRDRAGELGRLIAKAVSRLRPDTFEDPRYYPPRGTPRRDV
FT                   MAYFLVMVAMDHRLSRGRRQYEAEVNGERFHGADLLYRLGSRLFADDPGFFTAERLAKV
FT                   TEEDVLRWLTVDRARPPDARVRAELLRDLGLKLKAIFDGDPYRLILDSGGYLRRGVAQG
FT                   FIDLLKVFKAYQDPVEKKAFLLAKFIERREVVIFQDPQNKEVPVDNHLTRIALRTGIVD
FT                   VDPNTLELIAAGHPFRPQEDVMLRLAVREAYRLVAQAAGVDPFIMDDFLWSFGRSCCTF
FT                   EGPSCASGCSAKCSSFGGCDSGECILAPACRARAERLYLVPEHSFMDTWWY"
FT   gene            171966..172268
FT                   /locus_tag="ASAC_0166"
FT   CDS_pept        171966..172268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18574"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT6"
FT                   /protein_id="ADL18574.1"
FT                   /translation="MSEDWEIRASQLLEVARSLKGELREAFIYLVDNVSVGDLRAAIDL
FT                   RRRGIRDPAAVLEELVNMGLAERGDECYNLPAPLRKLIAERGIGAIERVLGSGPG"
FT   gene            complement(172588..172785)
FT                   /locus_tag="ASAC_0167"
FT   CDS_pept        complement(172588..172785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18575"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT7"
FT                   /protein_id="ADL18575.1"
FT                   /translation="MEGGKAVHGDSVPAAKAADDPESPVKAVGSARANFCGTPDLREAE
FT                   SIAWLGRGPATQPSGRLEES"
FT   gene            complement(173010..176076)
FT                   /locus_tag="ASAC_R0004"
FT   rRNA            complement(173010..176076)
FT                   /locus_tag="ASAC_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(176279..177775)
FT                   /locus_tag="ASAC_R0005"
FT   rRNA            complement(176279..177775)
FT                   /locus_tag="ASAC_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(178191..178778)
FT                   /locus_tag="ASAC_0168"
FT   CDS_pept        complement(178191..178778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18576"
FT                   /db_xref="GOA:D9PZT8"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT8"
FT                   /protein_id="ADL18576.1"
FT                   /translation="MTHVSALAVIAASFSVALLFNLIPLGAPPYVTVVLLEIKYGGLGF
FT                   WPPVLAASLGAAIAKVVMYYLGVGLKGVLRRNRNVRFLARYSNSRWAYLLAFFAAVVPV
FT                   LPLDDFVYMVGGASGMRAKLMGLIAAAAKLLKTVAETSLLYFITGEVSMIFRLPEYVII
FT                   IFMAAAGLVAGLIVFSLDWELLARRLGLLREP"
FT   gene            complement(178775..179041)
FT                   /locus_tag="ASAC_0169"
FT   CDS_pept        complement(178775..179041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0169"
FT                   /product="Elongation factor 1-beta"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18577"
FT                   /db_xref="GOA:D9PZT9"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZT9"
FT                   /protein_id="ADL18577.1"
FT                   /translation="MAVLVTVTPSSVDVNLGDLLNRIKGSLPQGYEVLNSGEEPIAFGL
FT                   KALKLVIAMPEDVEGGTETLEDVLRSVPDVEDVQVEAVTRMSE"
FT   gene            complement(179062..179271)
FT                   /locus_tag="ASAC_0170"
FT   CDS_pept        complement(179062..179271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0170"
FT                   /product="predicted Zn-ribbon RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18578"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU0"
FT                   /protein_id="ADL18578.1"
FT                   /translation="MSVAAVRKIDMLDMVQPPVCTSCGRIIHPKEKAVAFYCPNCGKVL
FT                   IWRCAKCRKQGTPYRCPNCGFVGP"
FT   gene            complement(179316..181259)
FT                   /locus_tag="ASAC_0171"
FT   CDS_pept        complement(179316..181259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0171"
FT                   /product="Predicted fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18579"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU1"
FT                   /protein_id="ADL18579.1"
FT                   /translation="MARKSMSSLDVMAWVAQQASQLRGQRLDNIYQDGDLLAIRMRLRY
FT                   GDFLVAQPGVRLHASARYQPGRELGPLAKAMRDAVRDLRVSEVKQVGFDRLVEITLEDG
FT                   HRLVFELLPRGVIALVSPDGRLVAASSYFDAKDRRVRRGLQYSYPPLRLESPFALDGAG
FT                   LASRLRGSQAKDIVRALVMNLGVPGEAAEEAAFRAGLKGNEQPQAVSEADLAKVADALR
FT                   SIAEESLRGQGYVYVGQDGSPVQATPFRATSAAGLRELSFSTFDEALDLYFSSFTPRRQ
FT                   SPLDAERQRLLKSLEAAKAEAEEYLRQASALEAQANAVASSYYQALEALQCVKEGREGC
FT                   GAKEVNRRQGYMIVNLSGVDVKLYLYETVDDAIKRLYRQAGELRAKAERASRTQLDIEA
FT                   KLKQLEEQLELQELREKVSHRRRAWYERYHWLVTSSGVLAVGGRDADQNESLVRKMLGP
FT                   NDVFLHADIHGAPAVILMAAAAGGFTETDVSEAAVLTAAYSRAWKEGMASVSVYWAYGS
FT                   QVSKSPPSGEYLTKGSFMVYGKKNYLRPLRLELYLGIALDEEGLPVVVVGPESVVLPQS
FT                   IAYLRVTPGDMKVEEAAEEIISSLSRAAPEAKVIRALDPSEVATRLPGRASISQARRGQ
FT                   AGGLRRPRGVAD"
FT   gene            complement(181260..181619)
FT                   /locus_tag="ASAC_0172"
FT   CDS_pept        complement(181260..181619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18580"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU2"
FT                   /protein_id="ADL18580.1"
FT                   /translation="MYGGYSAIYSVLSEVKEKLYVYNELASRRGYYLKPVHKVYKRVNG
FT                   VTRVYEYYGRYWWRKGERKLIYAGSVKPKGLPEPPENPLEGLSIIREGDDIIVDCSLYD
FT                   KYSWLFRGLRSERVA"
FT   gene            complement(181730..182446)
FT                   /locus_tag="ASAC_0173"
FT   CDS_pept        complement(181730..182446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0173"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18581"
FT                   /db_xref="GOA:D9PZU3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU3"
FT                   /protein_id="ADL18581.1"
FT                   /translation="MSLQLLASSDIHSPEYLNDFIRSLASVTGRPCLFLLAGDIVDRGN
FT                   VAMAEPVMKVIEERFGSKIVATFGNDEFQDRWDELRRRYPQVDWLADELKVYDCGGLRV
FT                   AVVGTPGALDRPTRWQEAHIKGIEEIYMKRVEVVRELLARAKSEADRVVLLSHYALARA
FT                   NLKGEDPRFYSNLYSSRMERLIAELRPTVAVHGHAHKGSRFTTVGGVPVYNVAFPLNRS
FT                   PVWVKEVRAGLEAFFS"
FT   gene            182624..183826
FT                   /locus_tag="ASAC_0174"
FT   CDS_pept        182624..183826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0174"
FT                   /product="predicted pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18582"
FT                   /db_xref="GOA:D9PZU4"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="UniProtKB/Swiss-Prot:D9PZU4"
FT                   /protein_id="ADL18582.1"
FT                   /translation="MNEDPAQQAMKVLAKYPLCDRCLGRLFAGLGRGLSNAERGRALKL
FT                   SVVMSLHAMSLSGRLPENARDVLANAGGAAAQVYVELFGSPPEHRSCYICNDALDKFLD
FT                   EMPQRVADAVKEWGGSTFLVGAKVDPGVIAREERIKAEFGLAFGESIKSEIKRELGKRA
FT                   QQLGPKVSFDRPDVVVMVSFPDGSVSVQPRRLVVKGLYRRLRRDLQLRPREALSHPLVA
FT                   RLINDTRSSRVGIVGLVRDEKEVRALGLGIPVEFHLGGPRVRLVPPDGSIIEAEGASLE
FT                   VNSSVEASGPEDLSRRVRVYRCVLYVEGGAFESLQLAAASLRGKEVRQKFMGKEVSGVV
FT                   RGAECVDMGGGLAECIIALDERLHVMELVSGSGTEPSLSGLLGTAAECVVADLLGVIPL
FT                   R"
FT   gene            183823..185139
FT                   /locus_tag="ASAC_0175"
FT   CDS_pept        183823..185139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0175"
FT                   /product="citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18583"
FT                   /db_xref="GOA:D9PZU5"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU5"
FT                   /protein_id="ADL18583.1"
FT                   /translation="MRGLILYGHVKELAGGAIIALILGGLMFRSRYFHNLPIWTFMSFA
FT                   AFIAIVSGLVKPNDVEDYVNWNVILFLIGMFNIGALAEESGLLEYVTYYIVYKVRDRVR
FT                   LIIVLTIALGVMAAIVVNDAVAAMGSLIIVPLAKVIGVDPELAILMLAFAVTIGSTMTP
FT                   LGNPQNMLIAVSSGVQAPLSTFVIYLAVPTMVNLAVTGYILAKIYGVKGGPVKLPYRIP
FT                   EEAIRNRRDAMLAALSLVVIIVALTVNDMLELMRRPAITEIGIIPFTVAAATFILSSDP
FT                   RETIRRVNWGTILFFIVMFIAMAGVWNSGILTSLFRYLLPGVGSPLNDFIRITASSLLF
FT                   SQLLSNVPFVELFIIYMQSIGFSGANYMAWLTLAMASTIAGNLTILGAASNVIILESTE
FT                   ARHGVSVSYWKFMIVGALVTLVNVAIYAAYMIPLSMLRI"
FT   gene            complement(185136..185921)
FT                   /locus_tag="ASAC_0176"
FT   CDS_pept        complement(185136..185921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0176"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18584"
FT                   /db_xref="GOA:D9PZU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU6"
FT                   /protein_id="ADL18584.1"
FT                   /translation="MSTYVYGENYKNMAYRITINRPEKLNAINGEMWDSLARELEKGCA
FT                   TDLRSILLTGSEVAFSAGDDIDAMSRLSTQRESEEFFNRILDVVTTMIKCNKPIVCAVK
FT                   GLAAGGGAELLLACDVVVAAENAWISFPEVALGLLPPFLLSLGVTALGHRKARYLAMTG
FT                   QRLSATEASLLGIVDEVVPQADVDQTVDDILSTLMSFPPQALQAIKRLALSDVDLSRMK
FT                   EATGQLASLAMTDEAKERMRLFKEHKLKPAAVRKLERRA"
FT   gene            complement(186017..186102)
FT                   /locus_tag="ASAC_R0006"
FT   tRNA            complement(186017..186102)
FT                   /locus_tag="ASAC_R0006"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            complement(186138..187174)
FT                   /pseudo
FT                   /locus_tag="ASAC_0177"
FT   gene            complement(187226..187516)
FT                   /locus_tag="ASAC_0178"
FT   CDS_pept        complement(187226..187516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0178"
FT                   /product="50S ribosomal protein L14e"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18585"
FT                   /db_xref="GOA:D9PZU7"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR023651"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU7"
FT                   /protein_id="ADL18585.1"
FT                   /translation="MPAIEVGRICYKLRGREAGRKCVIVDIVDENNVLVTGPKTLTGVR
FT                   RRRVNISHIMPLDKVVQINKGASDEEVLKAIEAAGLADFMRERVKLQQALA"
FT   gene            complement(187572..188291)
FT                   /locus_tag="ASAC_0179"
FT   CDS_pept        complement(187572..188291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0179"
FT                   /product="Molybdopterin converting factor"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18586"
FT                   /db_xref="GOA:D9PZU8"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU8"
FT                   /protein_id="ADL18586.1"
FT                   /translation="MKVKVRLYSVLREAAGKGELELELGDGITVSGLLEKLSSMGLGKV
FT                   LEELKGEVQVIVNGKSLAPSQLIPQDAKVIHVLPPSSGGSERVLVKVARDDEPVDLASL
FT                   TSFLYGDNPRVGAVAFFIGIVRGINNGEQVKELDYEHSEELMEPKLRELASEAITKFSL
FT                   AGACVIHFVGPRKPGQLTMVVGVSGESRKNVFPALEWLVDHVKHEAPVWKTEVRESGVY
FT                   YMVGDREIKETELKRGS"
FT   gene            complement(188288..188536)
FT                   /locus_tag="ASAC_0180"
FT   CDS_pept        complement(188288..188536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18587"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZU9"
FT                   /protein_id="ADL18587.1"
FT                   /translation="MAAGELHRCMVCGRPFHEGQGIIIRRGELLLEFHSAKCAAKFLRL
FT                   LMERPEASCVEGPIKQISKELRDSLEKRRQGSSKVIA"
FT   gene            188636..191452
FT                   /locus_tag="ASAC_0181"
FT   CDS_pept        188636..191452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0181"
FT                   /product="Putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18588"
FT                   /db_xref="GOA:D9PZV0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV0"
FT                   /protein_id="ADL18588.1"
FT                   /translation="MTEALLRPELIGLMKRRGWKGLTELQERAARAILAGKNVLIMAPT
FT                   GEGKTEAALLPLLTRLTNEGNVMPVSILYVTPMRALINDLHRRISYWAEPLGLRVAKKH
FT                   GDVPSSERYLRLRNPPHVLLTTPESLEIDLDWAPKFREYYRNVKAVIVDEVHELLSSKR
FT                   GAQLLLLLERLARLAGDFQRIGLSATIGNPGKALALLRGSSRRESELVSGGGNRGFLFE
FT                   VRYIDGAKDPWPKVAEIASSESSGPTLIFTNSRYVAEKLSHELQKGKLENVYVHHSSVS
FT                   AEVREMVEEKLRRGEGCLVVCTKTLELGIDVGSIRKVIQVRAPGSVAALIQRTGRSFHR
FT                   LGGTSMGLIITTDPVDLAEALAETRLATSGYVEDEILDVAPADVIAKEVVGSALSKDPG
FT                   LTVEELYKTLKGSPIFKLSHEEFLSLIKYMKVNGVIDVDDKGSIRVGGTFYRIWRLRNG
FT                   SDRPWSPRDFSDFFSTIPKRDMFAVRSPDSVIGYIDAYFVYRNLRVGDVIRLAGSAWEV
FT                   SRIDEVNERVDVIPAKGSGEIPLWKGEGLTRSKEVSEEFYRVILDDGWRGYESGRVLEA
FT                   IGSWYKSRGITIGPHDIAYERVENEQVLLGPFGSKLAETLGVLLVFLAAKSKGLDAYYR
FT                   PSFFGVSVNMGDRDALSALMELGPEEVREAIYEALDYLPIFHERLAEAKYDLGKLGEVN
FT                   KERDSTLIDEVKKFIINKELDVEGAIKFVEGLRKRYIKVHVIKDGPSPLSQELLSLPPV
FT                   RLWVQDLAKRIAELLKDWAFTSIEIAEELKLSEKTVLNKLKDMRRPEYNDLRVIAFLDV
FT                   NSDEWRWTLASSFNDIASSEDFAESFTPLDLNAELKVTAKKGYTWEPRETIVKPKDVVD
FT                   RWNLILPYVAGTDEIYELKVSMAGYYGADYESSVTYHYVNANHAKLLILNAAAYLQRHS
FT                   SSVGKVSV"
FT   gene            191452..192039
FT                   /locus_tag="ASAC_0182"
FT   CDS_pept        191452..192039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18589"
FT                   /db_xref="GOA:D9PZV1"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV1"
FT                   /protein_id="ADL18589.1"
FT                   /translation="MSICDEVNYIRIIGAKASKSENMDIRLLAASIYSVADMLNSVCEY
FT                   LDAREVKPLVNELAAAVDSGNVPNVSSALSAIKAKAQSYGRLLQFRLASLATRILASLS
FT                   LATFSFLLILVAVTPLEFEVAPIILGLSISAGALYARPAADALLIVASAILMVTGAGSS
FT                   LIVALITMAASVGNLLITIMASSGGLTIKAFK"
FT   gene            complement(192099..192323)
FT                   /locus_tag="ASAC_0183"
FT   CDS_pept        complement(192099..192323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18590"
FT                   /db_xref="GOA:D9PZV2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV2"
FT                   /protein_id="ADL18590.1"
FT                   /translation="MVISFYAVMCVKLVTVKMPELYVKAIDELVKEEKFTNRSEVIRVA
FT                   VRELLKRELWGESLLNEGELSTSAEVAEV"
FT   gene            192475..193407
FT                   /locus_tag="ASAC_0184"
FT   CDS_pept        192475..193407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18591"
FT                   /db_xref="GOA:D9PZV3"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV3"
FT                   /protein_id="ADL18591.1"
FT                   /translation="MRAEVETGSRLHGGFYYAAGDWNVRWGSIGFYVDNPKFRAAVELS
FT                   DREQYRGPQELLEYVKKAAKVAGVQGFNVEVHESPPIHRGFGTGTQVLLSLYMAFKALK
FT                   GEQPEAVEEAALKLGRSRHSGAGTLAFKYGGFVMDAGLPGRPTPLVTLKMPSEWRFVII
FT                   IPKIERGLTDEEEESIMEKRQWGNSESNIAFMTSGALRLAAGIARGDLDDALEGLRFVQ
FT                   RGTGILFASVQGGEYRGKLNDLAAEAWRSRVILAQSSWGPAMYTIVENEYEAQGDVMLM
FT                   KEIMSNVGLSGEVIISPPRNYGASIKIVG"
FT   gene            complement(193391..194152)
FT                   /locus_tag="ASAC_0185"
FT   CDS_pept        complement(193391..194152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0185"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18592"
FT                   /db_xref="GOA:D9PZV4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV4"
FT                   /protein_id="ADL18592.1"
FT                   /translation="MAFKDGDFVLINYVISVKDGDREIVEDTNKEDVAKSAGIYDSNRR
FT                   YEPYLVVVGRSQVIKAIDEQLRDMDVGQRKEFIATPDKAYGPYRNDLIIRLPIKQLNRY
FT                   GIPPVVGRRVEVGGRIGVIRSVTERFAYIDFNHPLAGRDLKVELEVVGKLETLDDKVKY
FT                   LVTRYMPLDRNSISVSQQGEGSIELQLPQEVLGLSDLESRLQLLLGDLSSLLGIKGVKL
FT                   VVNVTLSQQGASASGQQASQQQQEAQATPQS"
FT   gene            complement(194153..194653)
FT                   /locus_tag="ASAC_0186"
FT   CDS_pept        complement(194153..194653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18593"
FT                   /db_xref="GOA:D9PZV5"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV5"
FT                   /protein_id="ADL18593.1"
FT                   /translation="MGLTDDMLKKLKEFAEALGLPMSAIATRPYYLEVPDGNYYDIFDV
FT                   TSRVEEAVSRLPSLYSVGLYLGYIDKEGFHPGLPLAQRLASKCFVSTDCTVLDEYGAKV
FT                   FLYGKEVTEEHIVKFKEGVSVVLDTSLEPLGWGFGSYIRLKSRRVTRVEPVKDLGWYLR
FT                   RGG"
FT   gene            complement(194653..195660)
FT                   /locus_tag="ASAC_0187"
FT   CDS_pept        complement(194653..195660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0187"
FT                   /product="RNA (Cytosine-C(5)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18594"
FT                   /db_xref="GOA:D9PZV6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV6"
FT                   /protein_id="ADL18594.1"
FT                   /translation="MPKQSERWDRSDEVIFSDRSTPEARRLAQKYGYLPYIVERYLELL
FT                   GDEAEDLLEANEVPMPETLRCNDFKISCGELESRLGEAGFELERVPFLPHGYHVISSPI
FT                   SPGATHEYLKGYYYLQDPGSMLIVYVMNPRPSATILDMAAAPGGKSTQILQLTRDSSLL
FT                   IAVEPKRERIKALRSNLQRMGFSNYILIRSDARFLSLDTKPAQVLLDAPSSGEGIIRKD
FT                   KNRKTKTSISDLRRIHELQVELLNRALSIVSPGGTVTYAACSTAVEEGEYTVHKVLADK
FT                   DYVTTERPFGFPLSKPFEEYRGVIFDDRVKGCGRLFPHKQGTEGFFICKLRRLD"
FT   gene            195716..196249
FT                   /locus_tag="ASAC_0188"
FT   CDS_pept        195716..196249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0188"
FT                   /product="Nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18595"
FT                   /db_xref="GOA:D9PZV7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV7"
FT                   /protein_id="ADL18595.1"
FT                   /translation="MKQFKRLVFPGRFQPPHLGHISAIKYALELADELIVIIGSAQDSF
FT                   SLKNPLTAGERLQLLRTVLAHELGDDYCKRVSIIPVTDIEMNKVWVQYLRMLLGEFDGV
FT                   VSGNPLVLQLFRDAGLAAVEQPMFNRSECSGTRIRELILQGSSTWASCVPPYLLPELER
FT                   LNFVGRLRSLASEG"
FT   gene            196353..196844
FT                   /locus_tag="ASAC_0189"
FT   CDS_pept        196353..196844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18596"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV8"
FT                   /protein_id="ADL18596.1"
FT                   /translation="MNGVELEVIDIPIPEGANVIIGRSHFIKTTEDLYEALVTSSPGIK
FT                   FGLAFCEASGKRLVRREGNDEELVKTATEACLKIGAGHVFVIYIRNAYPINVLNAIKQV
FT                   QEVVSIDVATANPVKVVVADLGESRALLGVSDGFKPLGVESEEDVKERREFLRKIGYKL
FT                   "
FT   gene            196870..197442
FT                   /locus_tag="ASAC_0190"
FT   CDS_pept        196870..197442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18597"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZV9"
FT                   /protein_id="ADL18597.1"
FT                   /translation="MLIVAVTGMPGSGKSCFARVLSEELNAKLIVMGDVVREEVKKRGL
FT                   PLTVTNIESVATELRKIYGRGAVGLKVAETLKELQGQYEYVVVDGVRSPEEITYLRAAG
FT                   DLCVVAVHAAPAIRFERELRRAREGASTLDELKFRDSKNLEYGIGDVIAMADYMIINES
FT                   DVQELVGQASRLAKVIRDGLWRDRCRG"
FT   gene            197411..197851
FT                   /locus_tag="ASAC_0191"
FT   CDS_pept        197411..197851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0191"
FT                   /product="hypothetical protein"
FT                   /note="DUF54 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18598"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW0"
FT                   /protein_id="ADL18598.1"
FT                   /translation="MGSGEIVAEVELRPTESEEKVMKALTNIFDPERVEKVQAGDYEII
FT                   RAYASSLASLQKLHRLLRTQEILEATRSYMLKELKGDAVTLLFHKQAAYEGKVSLLTWG
FT                   EESPLGPIKITIRHPSIRDVIDWLAPQTSRGRPLWERSMPDP"
FT   gene            complement(197848..198729)
FT                   /locus_tag="ASAC_0192"
FT   CDS_pept        complement(197848..198729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0192"
FT                   /product="Ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18599"
FT                   /db_xref="GOA:D9PZW1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW1"
FT                   /protein_id="ADL18599.1"
FT                   /translation="MARQVEVITLGTGAALPSLERFTAAYVVRDWAGNVILMDSGEGAQ
FT                   QRLRQAGISPTKVDFIVLTHGHGDHINGLPGLLGTMQLSGRKSRLTIIAPKYLAEPIRE
FT                   LINANKFEDQFPVNVIDVTGDEGSLTLSSWGRDRLVLSWFRACHSIEAYGYSLTWELGP
FT                   RIAEPVEPSQARKLLEEGGSGLTSPRSFKLSYTGDTSPCDSVVKGASGANVLIHESTFD
FT                   SSMKDEASKYGHSTSVGAAEDAVKANVGKLILSHISTRYEGYEALQLEQEARSVFPNSV
FT                   LAWDLARFVANV"
FT   gene            complement(198754..199764)
FT                   /locus_tag="ASAC_0193"
FT   CDS_pept        complement(198754..199764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0193"
FT                   /product="Putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18600"
FT                   /db_xref="GOA:D9PZW2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW2"
FT                   /protein_id="ADL18600.1"
FT                   /translation="MLYAYLSGRHPRLPEEELKALVELSGSAYKPLLRLDQVVLFNADV
FT                   VNVSAYAKRAAYVKEVGEVLAYGERCEVEELLAKALRSLELRGLKSFKLELTSIKVEPC
FT                   CSPTELLRGLTKLSIRPSLSSENTVRILISEGVAIVGLAVGRRDLGNVKLRSPPNRPFW
FT                   RSGELDIRLSRAMVNLSRLPYGGTFLDAFCGTGTLALEAVLAGGSKALCVDIDGSMAYG
FT                   SKTNFSWAGLDSLSLIANARRLPLKEGSVDSIASDPPYGRSTRVVGESYGDLVEGFLQE
FT                   SARVLKPGGYVAYAGPVDLAPYKYAVEQGFDLIARIDQYVHSGLTRQIVVAKKAT"
FT   gene            199859..199951
FT                   /locus_tag="ASAC_R0007"
FT   tRNA            199859..199951
FT                   /locus_tag="ASAC_R0007"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            complement(199970..200290)
FT                   /locus_tag="ASAC_0194"
FT   CDS_pept        complement(199970..200290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18601"
FT                   /db_xref="GOA:D9PZW3"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW3"
FT                   /protein_id="ADL18601.1"
FT                   /translation="MNVTPPHSYFMMGYMMYYFSLIPLLAPHMAVGVIIGLLFIVILVL
FT                   SLLSRNVVKATLSVIGGIMTLMAGIAGMAFVAGGLSNNALSMIMSVGFAGDIAVVILLL
FT                   YL"
FT   gene            complement(200677..201768)
FT                   /locus_tag="ASAC_0195"
FT   CDS_pept        complement(200677..201768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0195"
FT                   /product="Dolichol-phosphate mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18602"
FT                   /db_xref="GOA:D9PZW4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW4"
FT                   /protein_id="ADL18602.1"
FT                   /translation="MAAAINSKVNRLSETILSVVVPTYNERENVVPLAKRLNEALAKIN
FT                   QYEIIFVDDNSPDGTAEAIMEISKVDPRVKLILRKNRRGLATAIIDGIRASKGRYVVVM
FT                   DADLQHPPEVIPLMLKAAEEKGADIVVASRYTKGGGTEGWSPIRRLISWGATVIARLLV
FT                   PESRRTTDPMSGFFMIRRGAISIEEANPTGYKALLEILYRNPQARVVDVPYVFSRRLSG
FT                   KSKLGAKTILDYLWHVIKISRPIKFAVVGAIGTGVNEGVAAALLLVTNYTFSYVGGIEV
FT                   SILSNFMLNDLWTFRDRRPGRWYSRLVRYHLMVAPAGLTIFFVAELVTRLTHVNPLLGL
FT                   FVGILAGFVVNYTLSSRKVWKRY"
FT   gene            201916..202602
FT                   /locus_tag="ASAC_0196"
FT   CDS_pept        201916..202602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0196"
FT                   /product="phosphoesterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18603"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW5"
FT                   /protein_id="ADL18603.1"
FT                   /translation="MALIISDVHLGYEDSMATQGVFLPRLQLKKAESIIDEGVRAGAKR
FT                   LLIDGDLKHVFEKLTKGERLEVTELIRHALEADIKEIVLVRGNHDTFVAPLLKDFGVEV
FT                   VDDYMDLGDGIIVTHGHKLVDAVKSSSTVIIGHEHPSLEISLAGAKVKLQALLKSPLKG
FT                   GGELLVLPAISLYQTGTAITPSPETYLSPIVKELAELQEAVPIIVDREIGVVELPTLKE
FT                   LFAGII"
FT   gene            complement(202595..203218)
FT                   /locus_tag="ASAC_0197"
FT   CDS_pept        complement(202595..203218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0197"
FT                   /product="TATA-box-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18604"
FT                   /db_xref="GOA:D9PZW6"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW6"
FT                   /protein_id="ADL18604.1"
FT                   /translation="MSKEDDIAPPEPEEASEVNVTGVPGERKPVVNIENIVATVILENT
FT                   LDLNLIEARIPDVDYNPDQFPGLVYRLQSPKITALVFKSGKMVVTGAKSVKQLVWAVKA
FT                   ILKKFITKGIVIQGRPQIQIQNIVASANLNVVVDLEKAAFVLPHSMYEPEQFPGLIFRM
FT                   DKPRVVLLIFSSGKMVITGAKRENEVYEAVNNIYKILDENKCIK"
FT   gene            complement(203275..203613)
FT                   /locus_tag="ASAC_0198"
FT   CDS_pept        complement(203275..203613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18605"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW7"
FT                   /protein_id="ADL18605.1"
FT                   /translation="MESSRLIAKARLEDLGTDYNGADSGVIRFFNRFSELYGSYLGGAM
FT                   VAKGEKVLVLMRTDIVTPDGLTLRNGDTVFIDVGTALGLISLGFAEPALTWSLNLDSWL
FT                   KSLRKSTK"
FT   gene            complement(203711..204784)
FT                   /locus_tag="ASAC_0199"
FT   CDS_pept        complement(203711..204784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0199"
FT                   /product="Probable DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18606"
FT                   /db_xref="GOA:D9PZW8"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="InterPro:IPR023639"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW8"
FT                   /protein_id="ADL18606.1"
FT                   /translation="MEDLSSTYRQGSSEGDQQEVIIRKWSEADSLKSLFAIYYRMDPPF
FT                   ILPHDMAKREFALQPFDIESYIRHLAFKDETSLRKYIRSRTPRHLYHSVGIYELPSAPN
FT                   MEEKGWQGSELLFDIDLDHPGACEGQIVDDECLVKGFDSARLVSRIVRDLLGGKPLIYF
FT                   TGHRGFHIRGICEQCMQLGRDERREIAKLVRAEGLDASLLFPNKRGVRPAPATPEDPGW
FT                   RGLAASLGVDLRASGPHVGVDIDSMVTEDPSRLTRIPGSLNAKGGLIVTPLCDSFAPGP
FT                   QISPFRGTLDAKATKDLDPTRILGFEVSLTEGEELSLPASVALYLYLSGYVSIIGGEVL
FT                   VRRNPGWWPVQGCDWSP"
FT   gene            complement(204744..205484)
FT                   /locus_tag="ASAC_0200"
FT   CDS_pept        complement(204744..205484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0200"
FT                   /product="DNA polymerase sliding clamp B2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18607"
FT                   /db_xref="GOA:D9PZW9"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZW9"
FT                   /protein_id="ADL18607.1"
FT                   /translation="MKLKFRNARTWVYIVGSIKNIIDEGVFLATSEGLSLRALDSSRVV
FT                   MVDLFYPKEAFDEYSVSGDEMFGVSFDAFNKVLARGQRDESLELEASGDSLIVAFEGHG
FT                   RREFKIPQISLSVEKLPEPRISFSVMAKLMNTAFVDVINAVEEVADAITIAATSDDKLH
FT                   FIGAGDVEKVEIELSKEDQNLVDIRVDSPDKATYSVEYFDDMIKAARGADQVTIQYAQD
FT                   APARVQFDYEGGGRLVFYVSPRIE"
FT   gene            205696..205771
FT                   /locus_tag="ASAC_R0008"
FT   tRNA            205696..205771
FT                   /locus_tag="ASAC_R0008"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            205863..206150
FT                   /locus_tag="ASAC_0201"
FT   CDS_pept        205863..206150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0201"
FT                   /product="50S ribosomal protein L44E"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18608"
FT                   /db_xref="GOA:D9PZX0"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX0"
FT                   /protein_id="ADL18608.1"
FT                   /translation="MKFPKTIRTYCPRCKTHTEHTVAIYKAGKRRTLSEGQRRYLRKNE
FT                   GYGSKRKPEQKRFAKTTKKVVLLITCTKCGYKRHILGIRLKKIELTEVMR"
FT   gene            complement(206422..206595)
FT                   /locus_tag="ASAC_0202"
FT   CDS_pept        complement(206422..206595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0202"
FT                   /product="Nucleolar RNA-binding protein Nop10p"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18609"
FT                   /db_xref="GOA:D9PZX1"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX1"
FT                   /protein_id="ADL18609.1"
FT                   /translation="MRWLLRRCSVCGRYTLSTDRCPYCGGALRVPHPPRFSPDDKYVKY
FT                   RYMLRTMSNSGE"
FT   gene            complement(206607..207416)
FT                   /locus_tag="ASAC_0203"
FT   CDS_pept        complement(206607..207416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0203"
FT                   /product="Translation initiation factor 2 subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18610"
FT                   /db_xref="GOA:D9PZX2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX2"
FT                   /protein_id="ADL18610.1"
FT                   /translation="MPLLNRRQLPDVGEVVVGTVKELHDYGAYLELDEFNGLRAFLPWV
FT                   EVSSRSFKSIDDVIKVNERVAVKVIRVNRAKGQVDVSLKKVTDDERRKKMTWWKRTQKA
FT                   VNIILMIAKELKKAEKQAYAEVIWRLEDKYGDVMTALEMAATEGEQPLAAAGVPEEWLK
FT                   PLAEAAKKYVEVKKVKVSLLATVKSLSPDGIEKIKAVLKSAEEAVASKGDSSVSVKIYA
FT                   IGAPRYRIDLMGVDYKELEQLAQGLEEVMSRAAKELGVEFSLERLRE"
FT   gene            complement(207493..207753)
FT                   /locus_tag="ASAC_0204"
FT   CDS_pept        complement(207493..207753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18611"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX3"
FT                   /protein_id="ADL18611.1"
FT                   /translation="MLRLVESLCSDSKFRKRLTSSGALESLLLLIYAMSEGLPPYRAAK
FT                   RLGVSHERLYRLRRGLEKDGLYAQVKAFIEINANARKRESA"
FT   gene            207993..208235
FT                   /locus_tag="ASAC_0205"
FT   CDS_pept        207993..208235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18612"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX4"
FT                   /protein_id="ADL18612.1"
FT                   /translation="MPPASPDAIARKLIEMLKRRRPELEAVLDEMSKNREGQRELARAF
FT                   SQAYEVYLKSLRLEEAFDFLVKYLETAYDDYSELD"
FT   gene            complement(208279..208908)
FT                   /locus_tag="ASAC_0206"
FT   CDS_pept        complement(208279..208908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0206"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18613"
FT                   /db_xref="GOA:D9PZX5"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX5"
FT                   /protein_id="ADL18613.1"
FT                   /translation="MMPASGVKRNPFKVIVVTGVPGVGKTTVLSLLQEKAKERGLRLRV
FT                   LNFGDFMLDNAVRKGLIKNRDQIRYLSFREQLELQDIAASSIIEEAGSDLKEGDYLIVD
FT                   THAIIKTPLGYLPGLPSNVINSLRPDMIVVIEADPKEIVARQQRDATRYRSDFGGEEGV
FT                   RQLMDIARSAAMASAVQAGSLLTIIINREGRASEAAEQLLNAISKL"
FT   gene            complement(208905..210266)
FT                   /locus_tag="ASAC_0207"
FT   CDS_pept        complement(208905..210266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0207"
FT                   /product="Preprotein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18614"
FT                   /db_xref="GOA:D9PZX6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX6"
FT                   /protein_id="ADL18614.1"
FT                   /translation="MLDALSNISEYLPTVSKPSQKLSLTRRLAWTGIVLVLYLIMSNIP
FT                   LYGVPVSPTAATTITLENIIFASSVGTLMQLGIGPIVTAGLILEVLAGAKLIDIDLTNP
FT                   DDQVKFTGAMKTLAVLFAVAEALVVTLSGMFWPAGTPVSPVVKALVVVQLVAASYIVIL
FT                   MDEALQKGWGLGSAISLFILAMVAQTVVWDIFGFVPRLALDFGVVPALIYDRDPFIVLT
FT                   RANGFPDVTGLLATFAIVILLVYLQAMMVEIPVTSSQLRGIRTKVPLQFIYVTNIPVLL
FT                   LAILVADLQLFEAPLARFFGISSLVYKVYSGIVFYLSPPNGLVETVLDPLRSVVFAISW
FT                   MLLSVAFGYVWVEVAGLNPSSQAESLIKGGLEIPGMRRNPRVLESVLARYIYPLTSLSS
FT                   LIVGAIAVVAAFFGAYGGGVGLLLAVGIVYQYYSIITYERALEAYPLIRKLVGE"
FT   gene            210406..210493
FT                   /locus_tag="ASAC_R0009"
FT   tRNA            210406..210493
FT                   /locus_tag="ASAC_R0009"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUG"
FT   gene            210585..211763
FT                   /locus_tag="ASAC_0208"
FT   CDS_pept        210585..211763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18615"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX7"
FT                   /protein_id="ADL18615.1"
FT                   /translation="MHEGFDPLGWLELSTQFRDKKFINYDDLRIPSLPAILNNAGIKSV
FT                   EGPRGLNLRWSCCGLYEVIVNRGSLESELPASPKPLSFYMRPLVLHKLERDNIYMNPFS
FT                   WDVKDVVPLYGSDLSPVALAAINGARWSRLKVLEVLDLESLRSKEGPATEPKVSLQPFS
FT                   LVLPSKAEVLGIDVIRVLKASDFLLARLTDNVLVLPLAHSSKLALRVDTSRYDIKASVL
FT                   YPFAYFEDVYRPGDAIEANSVVLRQPRPLSISSSSPIRVEFREGYVNLELQGVTYIGEG
FT                   DEPQAIRQLLQLTVGYLQWSASPGFVSSGSSSAVIYDLAPDSKKMGFVVINPTRYDSEL
FT                   EARLNREVVEGSVCSSIGCYPLEKSPAGLLRVPAPRGCYCFVTLTLGVPSHP"
FT   gene            complement(211752..212495)
FT                   /locus_tag="ASAC_0209"
FT   CDS_pept        complement(211752..212495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0209"
FT                   /product="Protein-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18616"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX8"
FT                   /protein_id="ADL18616.1"
FT                   /translation="MAGRYFDVELDEELIKELKDTLAYMVSPVTVDLFIDDASRCETCE
FT                   DAYKLVKTIADASPVRDGKKMLQLRVFSKSKPEDLEEFKRQNVERVPTVTLLGGVIRYT
FT                   GTPAGEEIRGFIETIMRISEGESGLDPETKKQLASLKGSVHIETVVTPSCPYCPYAALL
FT                   ANMFAYESWKQNNPKVISDTVEAYENMDIAEKYGVMSVPAIALNGVMSFIGVPYEEDFI
FT                   NYVVAAAENRLDQLVPKTEGEASGM"
FT   gene            212687..213100
FT                   /locus_tag="ASAC_0210"
FT   CDS_pept        212687..213100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18617"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZX9"
FT                   /protein_id="ADL18617.1"
FT                   /translation="MKVKQHLQQPLPIRQPCEVAAKEVMPSIRASIAYVLVNEFKLSKY
FT                   EAARLLGLTPAAVSNYIEGRRGEKYMAKILNDKAKAEKIREAAMIILAYSSDAKSSERF
FT                   QNITCAICSSVNEVAQMYGCHYLTMKKPEQLHA"
FT   gene            213304..214329
FT                   /locus_tag="ASAC_0211"
FT   CDS_pept        213304..214329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0211"
FT                   /product="Putative HTH-type transcriptional regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18618"
FT                   /db_xref="GOA:D9PZY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY0"
FT                   /protein_id="ADL18618.1"
FT                   /translation="MYEASREFVNRSLYLLAEVGDVIALNYPRNQLKRTVDLALKNKES
FT                   RVILVKLAYSTSLIGKSEREELKGLSSTLKVNSFIVAERKGDIKLVDGVVYDYEGSKVI
FT                   SVETLINSLEGDLPVIYEDRDNFKVKVNGEKLRQKRELKGYSLGTMARLAKVSRKAIYD
FT                   YERGSIKPTLDVAERLINELGEDIVASIDIFDPSEEILSGSKPSHGTDFDDQMEVEMVR
FT                   RLRGLMLDVCHARRAPLDICLSGSNLRALVTISHGGEKPKDFNDKVTNMLRMAKSIKGE
FT                   GFVVVEPSLRELAKELNEPEKVFTLEEFIDFIGGKVAEKTDSHNWKARNRKDNTGSDNS
FT                   K"
FT   gene            214244..214843
FT                   /locus_tag="ASAC_0212"
FT   CDS_pept        214244..214843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18619"
FT                   /db_xref="GOA:D9PZY1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY1"
FT                   /protein_id="ADL18619.1"
FT                   /translation="MGRLQKKLIAITGRPGIGKTTLAQTIASELVSMGCSLGGFTTPEL
FT                   REGGIRRGFLVKSVDGSRSVLLASVTPAPQGLRVGRYYVDPAAEGKVLSILEDSIKSSD
FT                   IIIIDEVGPMELSLRSLSQALTKLIMQPPKPLIVTFHYRLRDRFPELFSALTQGILIRL
FT                   DENNRNEYIRRAPELARWLANEACSDKGRKGAAVHT"
FT   gene            214794..215960
FT                   /locus_tag="ASAC_0213"
FT   CDS_pept        214794..215960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0213"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18620"
FT                   /db_xref="GOA:D9PZY2"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY2"
FT                   /protein_id="ADL18620.1"
FT                   /translation="MKLAVIREGKALLYIPDTRPAVDPLRGSLEPAWLQVFYNPSMELN
FT                   RDLSVQFLNAYAAERSPLRSAIDVLAGTGVRGLRYLLEVGGLERAVLNDIDEEALKLIK
FT                   ANINLNSLGDRAVASNRDANALLYTISHELGGAYDIVDLDPFGSPAPFISAAISVASRG
FT                   GVLAATATDLAVLGGSKRLAAKRKYWLDNPPGPTRGYREVALRVLLGFIAREAASHDKA
FT                   VRPLFSVSVGHYARVFVTFDKGSQKAYRSLENNMGCIRVQNGVALMQNGLPSDSCYGPI
FT                   WTGPLWDKEIVDRMLNDAKARKYEYQGCYADAFKVLSLIEEELSLQEFPHQRLDELCSE
FT                   AKHNMPALSVIRARLTSQGYRFSRTHLSPIGFRTDAPPDAILEACKSS"
FT   gene            216314..217435
FT                   /locus_tag="ASAC_0214"
FT   CDS_pept        216314..217435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0214"
FT                   /product="hypothetical protein"
FT                   /note="DUF373 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18621"
FT                   /db_xref="GOA:D9PZY3"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY3"
FT                   /protein_id="ADL18621.1"
FT                   /translation="MDLKSDARRPLIVVIDEDDDIGATLGRSLVMGYKDVVDAATQFAI
FT                   LRPEDPDSNAMFVGLNLYKEMEADGRNPEIIVVGGHPKNALLAQSLIKARVQQAISKSP
FT                   GNYELYVVGDGLDELFMAQILRDVGPIAGVKQVIVEQSLGVEGSYILLARYIRKALNDP
FT                   RYSKYFLGLPGLLLLVFGLLTIFGYLLLSLKIMAALLGFFMVVKGFNLESQLWEYLKTT
FT                   AARVREGSVFQLAGLGTLAISVVISAYGAYILSRSAAPLTDKVGYVVSYEVTTLIIGMV
FT                   IYVIIASVFFKVSRRNFRLYREAQVISVLIMLAAGLYYMGLSIASTPLPSTLNGSYVYS
FT                   ILIGSGFLVYALTGAAIAALIEIGVRVKSHEPS"
FT   gene            217452..217793
FT                   /locus_tag="ASAC_0215"
FT   CDS_pept        217452..217793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18622"
FT                   /db_xref="GOA:D9PZY4"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY4"
FT                   /protein_id="ADL18622.1"
FT                   /translation="MYQVIVNDKDWQKAIKMIEDLHLDLETFIVYFDLRRRGKKVTVGP
FT                   RPRTLLYNMTDNRIAEVLILSEGNYVKLMDIVRWSQRAAADAHEPILAIVDESGGVTYY
FT                   EARVVRQLS"
FT   gene            complement(217790..219184)
FT                   /locus_tag="ASAC_0216"
FT   CDS_pept        complement(217790..219184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18623"
FT                   /db_xref="GOA:D9PZY5"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY5"
FT                   /protein_id="ADL18623.1"
FT                   /translation="MMGRRPNDPRIYGPLVTTLNTIDAVSPILAVVFFIAAGASYVALH
FT                   AHYLLILVLASLGVIVFFLPELSRRLLASLLGSGINDEMPSLLAVMIPYVASSRDLSAV
FT                   LVTASESLGLKFSRVETRRLSYLLAAGYDERRALRILADTTPSSRLREVIRELLTVEEM
FT                   GLSRLRAAVNLYARTMDAVKSTWQSYAKLGETITEAMTTLIVSAAVLLPLSLFGSSNLL
FT                   IPLAVLMMVLSPSLAILLALLRPKLGEPEGGWWVAGLTIGSAVAASLIMFLGRYLAALI
FT                   ILTLATIVSEASWARLSKRFAESLRLLREASERARLGLPFADVLSRASMLGKSIINAIV
FT                   SSDKVAGRVGIGPALQSFVDIFYESLRSLKSLQVEAYILMGISAVAPAISLVGVYALVN
FT                   YIASSSLSSMLTNTLSVQYAARLLMAMSPLSTLPAASLHRGRRMSPAASLVSATLSLLV
FT                   VRFITL"
FT   gene            complement(219181..220593)
FT                   /locus_tag="ASAC_0217"
FT   CDS_pept        complement(219181..220593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0217"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18624"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY6"
FT                   /protein_id="ADL18624.1"
FT                   /translation="MMGLLSRLRGALHRPSYYSHEEELQAVADHDGEGKSPPSWSVVSH
FT                   YRIGPVEYFLYRGGDGVPRLMVREPEPIDHDRLVYVATGLTKPRDDRESYLAEKYRSGY
FT                   GKIYPLMLDPHIEEISYTGSTKNVIVIHKEVPSRWVLTDIKLTDEEANGIVVELARKAG
FT                   KSVSIVSPYAEGLTVEGHRISVSFMNEMSRFGSSFVIRKYPQKPFTIADLLANKTIDPV
FT                   AAAYLWLIAEAQGFIIVSGAMGAGKTTVLQSIISTLPPYSKVVTIEDTPELVVTGPLWD
FT                   SLVTRPRTPGEEVEEITLEDLLKFALRRRADYVVVGEVRGREGKLLAQAAASGYGAMTT
FT                   LHSDSPQGVIMRLSMEPIALPPLFLSSIKSIVQVKRLQATGGRAVRRVTEIAEVENGNS
FT                   VIIYRYGETGISDLIERSRELEWAAERLGIGDIREEMEARTKFLESVAGRSPEELRAEL
FT                   AKFYISRYGDMI"
FT   gene            complement(220600..221079)
FT                   /locus_tag="ASAC_0218"
FT   CDS_pept        complement(220600..221079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18625"
FT                   /db_xref="GOA:D9PZY7"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY7"
FT                   /protein_id="ADL18625.1"
FT                   /translation="MMLVSRQRRSLSNIIGAVILIAATIVGGLMVYSYFQRSMNAFMSM
FT                   GSGVTVEASATPTGSGALLYVKIINNEPLQITIKNLVLVLSNGNQEDVYIEGSPSSGYS
FT                   ISTSASASQGATINPGSEIIAVGNVNLTSTVESVYLLYEMNNQVYYTSPVSVTAG"
FT   gene            221261..222220
FT                   /locus_tag="ASAC_0219"
FT   CDS_pept        221261..222220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0219"
FT                   /product="Probable deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18626"
FT                   /db_xref="GOA:D9PZY8"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY8"
FT                   /protein_id="ADL18626.1"
FT                   /translation="MKLEPVKDIRVDPNMPLKDLIDLYGEEYGFMAGHVWRAAQILAKG
FT                   LSESNLRVISFTGNLVSTGLRGIITQLIRARLFNVIMTTCGALDHDIARAMGGAYSKGY
FT                   FEGDDVDLARHGIHRLGNIYIKVDDYGPKVEQFVRSLAARASALKEEWGMYELLKLAGD
FT                   MINDESSFLKAAHDTGADVFVPGWPDGAFGTDLFFESQRGVKIKINYFRDMQRLSDLFF
FT                   GTHGKASALIIGGGISKHHTIWWSQFREGLDYVVYITTAVEWDGSLSGAMPREAITWGK
FT                   VKPEADKVIVYADATIALPLLAAYLLANAKPPETSGQE"
FT   gene            222374..224044
FT                   /locus_tag="ASAC_0220"
FT   CDS_pept        222374..224044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0220"
FT                   /product="Type 2 DNA topoisomerase 6 subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18627"
FT                   /db_xref="GOA:D9PZY9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZY9"
FT                   /protein_id="ADL18627.1"
FT                   /translation="MAEENAIDNAKEKFSEISVAEFFSKNKELAGFSNPTRALYQTVRE
FT                   LVENALDATDSHGILPEVKIYIKEVEPENEERPARYEVSVEDNGIGVPKTVMAQAFGKV
FT                   LFSSKYVIRQTRGMYGLGVKAVVLYSQTTTGRPITVVSSQEDSNFVYYQNIKIDIKKNE
FT                   PMVVEDGQLDKRSSWHGTIASAIVEGDWTRAKPKIIEYVRRTAIIAPYAELWLVTPEGE
FT                   IYFFPRATKKMPKPPREAKPHPHGVDLEQVRSMLMSTQAETLLDFLKEEFQGIGDKTAT
FT                   EFLRHVGLKPDINPKTLLKKEKLKDLEALVTALRNYRGFKGPRSDYLSPIGEELIELGL
FT                   TRMFKPEWVKAVTRPARAYQGHPFIVEVGIAYGGAIQPQEEPILLRFANKIPLLYEEKE
FT                   DVSYKVLTNIDWGRYGVQEPYQLAVLVHVASTKVPYKGVGKESISEIPELESEIRNGIH
FT                   EVARSLRIYISRKAREELAKEKIVSIAKYIPEVARSLAILSSPPEDPNRYRELEPKVME
FT                   LLISKVAASIEMPKIDGRQEDPRLIVERVIKGVSIQEVS"
FT   gene            224046..225209
FT                   /locus_tag="ASAC_0221"
FT   CDS_pept        224046..225209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0221"
FT                   /product="Type II DNA topoisomerase VI subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18628"
FT                   /db_xref="GOA:D9PZZ0"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ0"
FT                   /protein_id="ADL18628.1"
FT                   /translation="MSAPTQDRIDIEARKKGAEIIYKTFLNLLSSLEKGADPKLVIPKR
FT                   TLANTVFDVEKGILKLGVSKLERKFLDMNESRRFMQTLVMAANIYRALIENEYPTIRDL
FT                   YYRGKHTIVFHDLDGRHREENTWDEQAESDAALRDLEVMLGLLREDLMILSKEKGKVVG
FT                   NMRIRSGNDIIDLSKLGHGAYAIESTPDLIEFLDVDAEFVLVVEKDAVFQQLHRVGFWQ
FT                   KYKSILVTGAGQPDRATRRFVRRLNEELGLPVYVLTDSDPYGWYIYSVFKVGSIQLSYE
FT                   SERLATPKAKFLGVSMSDIFGYGRKKPYLTEEERRNYIIKAKDLDIRRAKELMNYSWFR
FT                   TPLWKREIDMFLDKKAKLEIEAMASKGLKFLAFQYLPEKIQTHDWIE"
FT   gene            complement(225279..226040)
FT                   /locus_tag="ASAC_0222"
FT   CDS_pept        complement(225279..226040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0222"
FT                   /product="DNA polymerase sliding clamp B1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18629"
FT                   /db_xref="GOA:D9PZZ1"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ1"
FT                   /protein_id="ADL18629.1"
FT                   /translation="MASLRAVYPEGNRLKRIVSAMAKVSDEATFDFAQNEVVFWLFSPD
FT                   KTVLAVAKLEPSAFEEYSLDSEVKLSVNVSEMNRVVRRATRNDAVAMQYETGAPGLTVE
FT                   LQDRKTSFSRSFLITASESTEESLREINMSPTARVVMSADDLETLVTDAKSVGDVVELH
FT                   ASDGKLEVTASAEGKSYRWLMSQGAPLQELSAEAETKASYSAKSLYSSLRPIMSIAESV
FT                   QLEFSTDYPLKVTINLSGPEQMIIYIAPVQG"
FT   gene            complement(226110..226508)
FT                   /locus_tag="ASAC_0223"
FT   CDS_pept        complement(226110..226508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0223"
FT                   /product="30S ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18630"
FT                   /db_xref="GOA:D9PZZ2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ2"
FT                   /protein_id="ADL18630.1"
FT                   /translation="MVHDTLSAHLSAIYNAELRGQREVILMPASKLTVSVLKVLQKEGY
FT                   IGDFEYIDDGRWGKFRVTLLGHINKIGTIRPRMPVTYRELLRLPEHLRRYLASRDLGYL
FT                   IISTSQGVMTHKDAMQKHLGGILIAYVY"
FT   gene            complement(226520..226690)
FT                   /locus_tag="ASAC_0224"
FT   CDS_pept        complement(226520..226690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0224"
FT                   /product="30S ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18631"
FT                   /db_xref="GOA:D9PZZ3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ3"
FT                   /protein_id="ADL18631.1"
FT                   /translation="MVMGKIKPPKAKVMGRGAQKCQRCGTRDAVIQKYGLYLCRQCFRE
FT                   IAVELGFNKYS"
FT   gene            complement(226695..227261)
FT                   /locus_tag="ASAC_0225"
FT   CDS_pept        complement(226695..227261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0225"
FT                   /product="50S ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18632"
FT                   /db_xref="GOA:D9PZZ4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ4"
FT                   /protein_id="ADL18632.1"
FT                   /translation="MSQQTALTDDVVNKVLSEWQKNPMRKPRIAKVTVNIALGSSGEKL
FT                   VKVQGLLEQLTGQKPTLRKAKKTIRAFGIHRGENIAVAVTLRGQKAMDFLKRALEATGH
FT                   RIKASSVDKFGNVCFGIPEYILLPGAKYDPEIGIVGMDVCLTIERPGFRVERRRRARSS
FT                   IPLKHRVRPEETMVLLNKELGVTFV"
FT   gene            complement(227266..228018)
FT                   /locus_tag="ASAC_0226"
FT   CDS_pept        complement(227266..228018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0226"
FT                   /product="30S ribosomal protein S4e"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18633"
FT                   /db_xref="GOA:D9PZZ5"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ5"
FT                   /protein_id="ADL18633.1"
FT                   /translation="MARMGGSRHLKALSAPSVQRIPRKVRPWTVKPSPGPHPADRSLPL
FT                   LIVIRDLLKYAETAREATKIISSGQVKVDGKVVRDYKFPIGVMDIVELPSLNLYYRVVP
FT                   DPTGTLRLVPISKEEASLKLLRIEGVTTLKGGHFQVHLSDGRNVLVRVEDSRKPGQLPY
FT                   KPLDSLVLNVPEGTVKDHIEFKEGSLALVVWGRNMGKLGKIVSVTRGWGWDRSVASLQD
FT                   SAGNSFETSLSNIYVVGRDKPVVTVTQG"
FT   gene            complement(228018..228428)
FT                   /locus_tag="ASAC_0227"
FT   CDS_pept        complement(228018..228428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0227"
FT                   /product="50S ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18634"
FT                   /db_xref="GOA:D9PZZ6"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ6"
FT                   /protein_id="ADL18634.1"
FT                   /translation="MASQQPREQRKAFYNATLHLRHKLVSAHLSKELRDKLGIRSLPLR
FT                   VGDKVIVIKGDHKGKSGKVAEVDLKGLWVKVEGITRKKADGTEILVKLRPWNLVITDLN
FT                   LKDDWRKKIIERKGGNVQAAAQQEAQQAGGAK"
FT   gene            complement(228441..228863)
FT                   /locus_tag="ASAC_0228"
FT   CDS_pept        complement(228441..228863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0228"
FT                   /product="50S ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18635"
FT                   /db_xref="GOA:D9PZZ7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ7"
FT                   /protein_id="ADL18635.1"
FT                   /translation="MVRRQKFTAILSRFGYSAGLQVGTYAVVADNSGAKEAMIVDVPGV
FT                   KTRVRRLAAAGPGDMVIVTIKKGTPQVRKQISYAVVIRQKRPYRRPDGTWISFSDNAIV
FT                   LINQDGTPKGSEVRGPVAREAAERWPSIAKLATTII"
FT   gene            complement(228869..229213)
FT                   /locus_tag="ASAC_0229"
FT   CDS_pept        complement(228869..229213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0229"
FT                   /product="30S ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18636"
FT                   /db_xref="GOA:D9PZZ8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ8"
FT                   /protein_id="ADL18636.1"
FT                   /translation="MPAQKALKALSVPGVKPPSVSCTDPNCPWHGSLRVRGVLLEGTVE
FT                   KLKTKTTVVVRHDYLYYDSKFKRYEWRRTKKHAHVPPCVDVKPGDKVLIGETRPLSKTV
FT                   KFVVLGKLER"
FT   gene            complement(229352..229639)
FT                   /locus_tag="ASAC_0230"
FT   CDS_pept        complement(229352..229639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0230"
FT                   /product="Ribonuclease P protein component 1, Rpp29"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18637"
FT                   /db_xref="GOA:D9PZZ9"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:D9PZZ9"
FT                   /protein_id="ADL18637.1"
FT                   /translation="MKFTSSNIRFRPLIGLKLKVISSTDPSLLGVSGTVVGDSKNALRL
FT                   RVERGDRKKEITIIKLHSTFSITTPDGDFIVRGLDIIGRPEERLKKAIRG"
FT   gene            complement(229636..229896)
FT                   /locus_tag="ASAC_0231"
FT   CDS_pept        complement(229636..229896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0231"
FT                   /product="50S ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18638"
FT                   /db_xref="GOA:D9Q000"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q000"
FT                   /protein_id="ADL18638.1"
FT                   /translation="MAKYRLSPDDLRKRSLEELTKLLQEQRSELTSLRQKALSGSIDSP
FT                   AKIREIRKNIARILTVMNELSRKSQQTKTVAGTANSQQGQG"
FT   gene            complement(229871..230587)
FT                   /locus_tag="ASAC_0232"
FT   CDS_pept        complement(229871..230587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0232"
FT                   /product="30S ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18639"
FT                   /db_xref="GOA:D9Q001"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q001"
FT                   /protein_id="ADL18639.1"
FT                   /translation="MSKIKSYFLRQGLTRVKVDEYLAQNFYTAGYAGVQIVQSGLGTRV
FT                   HIFAERPALVIGRRGATIRKLQAVLEKVFGLEGVQVTVSQPDNMELNARVQAFRIARAL
FT                   EMGYHFRRVAMATMRRIMEAGAVGVEIVISGKLSRERARFEKLQAGKVIKTGNVVDVYT
FT                   DRAIAYAKLPLGIIGVEVRIIRPEAARPDILLRPDSEAAAIAAQLSEEAPEGQGEQRVK
FT                   EIIEGGEEGGEVQAKS"
FT   gene            complement(230589..231068)
FT                   /locus_tag="ASAC_0233"
FT   CDS_pept        complement(230589..231068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0233"
FT                   /product="50S ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18640"
FT                   /db_xref="GOA:D9Q002"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q002"
FT                   /protein_id="ADL18640.1"
FT                   /translation="MPEWSYSFKPANEGLSAKAMMWDVPVHPKVMVEVARAIKGMKLSD
FT                   AEEYLRRVIELKEPVPYRSASKKIPHKRGLADRWGIPMGKYPVKAARYMLKLLENVSNN
FT                   AENKNLDVDNLYVVHVGVYKGITLKRVYPRAFGRADIIRKVHSHVEVIVEERGGS"
FT   gene            complement(231075..231500)
FT                   /locus_tag="ASAC_0234"
FT   CDS_pept        complement(231075..231500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0234"
FT                   /product="30S ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18641"
FT                   /db_xref="GOA:D9Q003"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q003"
FT                   /protein_id="ADL18641.1"
FT                   /translation="MMSIELRPEWRRFKYRGRSLEELLNMSLDEFISLLPARQRRSLQR
FT                   GLTPAQKKLLAKIRALRRSGKTDVMIKTHVRNLVVLPEMVGLTIAVYNGKEYVPVRVVP
FT                   EMIGHRLGEFSHTTKIVHHGEPGLKASKSSLHIAAKG"
FT   gene            complement(231617..232042)
FT                   /locus_tag="ASAC_0235"
FT   CDS_pept        complement(231617..232042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18642"
FT                   /db_xref="GOA:D9Q004"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q004"
FT                   /protein_id="ADL18642.1"
FT                   /translation="MSTRLTGLVKVDSKGRITIPQTIRESLGIEAGMLVAMLADTDKKE
FT                   IIVSPILAENAKVIEIDVSVLDKVGALAKVADKLSELKVDIVASRCASITRGEEGECVF
FT                   IADMSQSNADVETIRKALENLDIVTQVMIRQFEAPSF"
FT   gene            complement(232297..234027)
FT                   /locus_tag="ASAC_0236"
FT   CDS_pept        complement(232297..234027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0236"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18643"
FT                   /db_xref="GOA:D9Q005"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q005"
FT                   /protein_id="ADL18643.1"
FT                   /translation="MGKYIVASAWPYSNFIPHLGTVLHLLSADVYARYLKLMGHDVVFV
FT                   TGSDEHGTPIELEARKRGIKPKELTDQVHAYDVELFKKFEFDFSLYSRTESPIHKEFVR
FT                   EFFLNLQRRGYVFPQDEEMPYCPNDKMFLPDRFIEGTCPYCGYEHARGDQCDNCGRLLT
FT                   PRDLINPRCAICGATPIWLKTTNYYIDLGKVQEKLLSWLQSSELQDSVKNYSIEWVKQG
FT                   LKPRALTRDIEWGIQAPFEGAENKTIYVWFDALLGYVSATKEYLMSKGGDENSWKQWWF
FT                   DPSTRSVYFIGKDNIPFHSIILPSLFMASGDPYVLPWRISATDYLLYEGRHFSKSRRVG
FT                   VWIDEALEIAPADYWRWALIRMRPESGDVSFQWKEFYRIVNSELNDDIGNLAYRVLSFV
FT                   KSRFDGVMPPATAPDTRDKETLEEATSLASKVIEHMDNVELKRASEFVLEVARLGNRYL
FT                   NESAPWDLIKRDRERAGTVINVAASIVKTVAHLITPFMPSIAEDLWHQLGFTGSVMDAK
FT                   WPENLGKPISGGSRIGEIHPLFRKLPEDFLNNIERIIEESRAKANSKRPPLLKDYGIAG
FT                   "
FT   gene            complement(234089..234916)
FT                   /locus_tag="ASAC_0237"
FT   CDS_pept        complement(234089..234916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18644"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q006"
FT                   /protein_id="ADL18644.1"
FT                   /translation="MPCDHGKWGRPGAKLCRVIESYGPGGVAKAFEGAGLKLLYDPAYS
FT                   SYMPYIPMSGVLVYISPKEALRRALSGGSPLVVELARAAHALSRAVGSADSLGLTGSFA
FT                   MEIEQSFSDIDFVVYGAYEAAAAFEFFTKSLREGECKEDFGGVRLRGFACLEWRRGLLD
FT                   GVNVPISWVGVPEGPASACRPLSEYNHIEPPARSYANVLTIQPYQESALLYPPCVSTEE
FT                   GVTIVSFEYNLGGYLYMGGEVFVDGLATSDGKVVYVGTRERPGGLTLIRQFKP"
FT   gene            complement(234987..235571)
FT                   /locus_tag="ASAC_0238"
FT   CDS_pept        complement(234987..235571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18645"
FT                   /db_xref="GOA:D9Q007"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q007"
FT                   /protein_id="ADL18645.1"
FT                   /translation="MLSPEWAGITGSRALGTAKPSSDYDLLLYSNKPSELYNSLKDLAQ
FT                   EGLIAECEHETRYSKVKDTWSLDDFNALHAFKLLDSCYKGVAYTLRLLRQVEERGCTSF
FT                   YRSLGWFEGAVYINDIGEGFLVPARYRVRLGFMELTAYMLTWRTRYQELPPGRYLARGL
FT                   LQASGSDLYLIPDVWGYVKPLQVWTWKRDNN"
FT   gene            236021..236554
FT                   /locus_tag="ASAC_0239"
FT   CDS_pept        236021..236554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0239"
FT                   /product="Small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18646"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q008"
FT                   /protein_id="ADL18646.1"
FT                   /translation="MSDDRKKKRRSFDDLFDEIDDLMKRFEEEFEDMERDFEDLLKNAP
FT                   AKEGPYYYGVRVYVGPDGVPHIEQFGNIKKEGRGKVIISDETEPMVDVMERDDEVWVVA
FT                   DLPGVDKDQIKVSATERTVSIRAEGDKRKYSKEVELPAVVDPSSAKATFKNGVLEIKFK
FT                   KLQGSKGSVNIKIE"
FT   gene            236636..238051
FT                   /locus_tag="ASAC_0240"
FT   CDS_pept        236636..238051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0240"
FT                   /product="predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18647"
FT                   /db_xref="GOA:D9Q009"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q009"
FT                   /protein_id="ADL18647.1"
FT                   /translation="MFLNPAQSSSSRRFVLTKELTYDVVIVGLGPAGSSLAYLLRKSGL
FT                   EVAGIEMNGPEGAWGKPCGDAIGKHHFDETGLPYPTGESLKQKIDGIDIISPYGGVKLR
FT                   VNGEGFIIDRNKYGLTLINESAKGGVDIYMRTRVTSPKLEEGKLVGVYAKGENGEDLLF
FT                   RGKIIVDATGNSGLLRRQLPTSWPVNEPLDPKDANIAYREIRELNYTVEEPSYLKIYVN
FT                   QEISPGGYWWYFPEGKESANIGLGVQGGMGYPTPNTIFKQRLEKLDEVKNYRRVINAAG
FT                   SKVPTRRPANTLVWDNFIGIGDNGYTVNPVHGGGMGYAMVAAYYASKSIIKAFTENDFS
FT                   AKALWDLNINYIKSIGKRQASLDIFRIFLQRLSNDDIEYGLKHGIMNADQVYETSVSGE
FT                   LKANLGLLDKVSIALRMLGRPSLLPKLATVATYMKRVQQLYDAYPTSPEGLDTWVSAIN
FT                   ALYSEYKSKIGVA"
FT   gene            complement(238067..239497)
FT                   /locus_tag="ASAC_0241"
FT   CDS_pept        complement(238067..239497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0241"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18648"
FT                   /db_xref="GOA:D9Q010"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q010"
FT                   /protein_id="ADL18648.1"
FT                   /translation="MTLTVTNTLGRREEVFRPWSPPLVTMYVCGPTVYDYVHIGHAKTF
FT                   VAFDGIKRYLSLIGYSVYHVQNITDIDDKIIKRASDRGVSWKEVADSYAQDYLESLSRL
FT                   NIRVDLHPRVTSHINEIIDFIGKLIEKGYAYVAPSGSVYFDVDAYPDYGRLSGNFNKAL
FT                   WDQGEGVVSEKRHPYDFALWKAAKPGEPWWESPWGRGRPGWHIECSVMSSRYLGSRIDI
FT                   HGGGSDLIFPHHENERAQSESLFGGPWVKYWLHTGMLTIRGEKMSKSLGNIVSLRDAIN
FT                   EWGPNVIRMWVLTSHYRGSLEYSEQSLGQAKKLVERLRDIASDVVKRLSKEEYVNYMKA
FT                   ADVDELFKLRSLYLNWHAAMQRDFNMGEAAGSVWALTSEYYKYIASSESRALIAFTYKM
FT                   LVDFNRVYAVLDDIFERAPMAPVASLEDQLIDLLVEVRSQLRKNKMYDLADYIRSKLAS
FT                   YGITLVDKGEETTWKRAG"
FT   gene            239686..240519
FT                   /locus_tag="ASAC_0242"
FT   CDS_pept        239686..240519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0242"
FT                   /product="predicted 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18649"
FT                   /db_xref="GOA:D9Q011"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q011"
FT                   /protein_id="ADL18649.1"
FT                   /translation="MFIVVLMIGFLSFNKAEFSLPVMLILMLAIVGELLMHSATNILND
FT                   VYDFYKGIDSPDLATLRYNFVFDKEVGPRRAQSISLVFFLSSAALGVAVAVLGRPLAIL
FT                   LGLLGIFFGYFYSAPPLELKYRALGDLAVIVSMLLLTLTGYYLASGSLSLKGLAVGIPM
FT                   AFIIDDVLMANNIRDLGRDSKRAKTLATVLGPELSKAIYYVFMSVAYVVQAALVVLGIL
FT                   PPETLLSLLSLPLLFSIARKVKSTKSWLQIDMMTANLAIVFGLFEIMGLILHMTL"
FT   gene            complement(240539..241126)
FT                   /locus_tag="ASAC_0243"
FT   CDS_pept        complement(240539..241126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18650"
FT                   /db_xref="GOA:D9Q012"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q012"
FT                   /protein_id="ADL18650.1"
FT                   /translation="MLVTSIKTLTLVLVGADLLVTSSITYAVHLMTGISWYISIIVYTV
FT                   LWLSAMLFIAWLLRNELRVSLAEMSILQAAACRECSYMFLRDVLTCNLDGSGAISAAVC
FT                   ISFQDNRLYFYRYYDATPTKDPRDFPCVRFEAGLFDSAGPVSVFKGKGMFLLPSGNVQR
FT                   GDIEVYYTNYNDLNKIGESLKIILKTVEVSGL"
FT   gene            complement(241220..241729)
FT                   /locus_tag="ASAC_0244"
FT   CDS_pept        complement(241220..241729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0244"
FT                   /product="50S ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18651"
FT                   /db_xref="GOA:D9Q013"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q013"
FT                   /protein_id="ADL18651.1"
FT                   /translation="MPQEKIINIQIEGGNAKPGPPLGPTLSSLGLNVKQVIDEINNKTK
FT                   DFKGMTVPVKITVDMTTKSYRIEVGIPTVTALLLKEAGVDAPSGDPAHKKIGNVSFESI
FT                   VKVSLMVKPKITAKTLKSAVKSVLGTAKSIGLTVDNKDPKEVIKDVDAGAYDEIISKYE
FT                   PEWASR"
FT   gene            241913..243865
FT                   /locus_tag="ASAC_0245"
FT   CDS_pept        241913..243865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0245"
FT                   /product="Glyceraldehyde-3-phosphate:ferredoxin
FT                   oxidoreductase (GAPOR)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18652"
FT                   /db_xref="GOA:D9Q014"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q014"
FT                   /protein_id="ADL18652.1"
FT                   /translation="MGFKVLYVDATKRSYKIESINDPELFGIVDLGLQIHLDMKSYNVD
FT                   PLDPANPLVLGIGPFAGGAVVGSHRIVAIFKSPESRGLHVSEMGGAGYSFFRTGLDAIV
FT                   ITGRSERPLLIRVIGGSNGEVSVDFSDISFDELNRIYSNYSGLSGTKALTKYVVDMDRD
FT                   LIVKNHARVAVVGPGAYKTLFAGIFSYVLDDKGNLTEVSDSASRGGGGSVMAQAHNVVA
FT                   ITFGGTYKRPNPNLSNVQILNKITQEVYKKPFSQALLDKTTKYRFDPASKTGGTFGENY
FT                   PHYKELVPVLNYNHVYLSRGLRLELHGKIMDYFWRPFQDEVFDGGKLTPASKNCGEPCP
FT                   VVCKKIFNKVKIDYEPAHGVGPISGIFDIKKSAELVDLVDNLGLDAIEAGHFVGWIFDL
FT                   IDKGLLNPEDVGLDKRPVMDPKLQGLEASKVNAELARKLLINLVSDDTTKVLKIVGSMG
FT                   LRAAAKELDNLYSDRVAKSGVKFEDLLVYAAFGKSGYFTPNFYWSPGVLAPLFVLGKYW
FT                   TDYSPAFREPEDYASAALRRAVMELLIANAGFCRFHRGWAEEALAGLYKEMLGVDLDVY
FT                   KHGLLTYKRIAEYQAKSEATPEPWESRKVMDAIASLAAETGVHGWEDSMYHTEKMAEWW
FT                   NRFYKKLQEELNKVS"
FT   gene            complement(243930..246671)
FT                   /locus_tag="ASAC_0246"
FT   CDS_pept        complement(243930..246671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0246"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18653"
FT                   /db_xref="GOA:D9Q015"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q015"
FT                   /protein_id="ADL18653.1"
FT                   /translation="MNPSEYRLPFFKEQGYQRKQCRVGGDFFWTLNASFDTCQDVPDTD
FT                   YWFDRIPSVPGLTVAEARRKFIDFFARHGHTPIQPRPVVARWREDLYLTIASIVDFQPH
FT                   VTSGLVPPPANPLVISQPCIRLEDIDNVGLTIGRHLTTFEMAAHHAFNYPDKQVYWKDE
FT                   TVRYAYEFFTKELGIPGDLIVFKESWWEGGGNAGPSFEVTVGGLELATLVFMQYKIDEN
FT                   GNYVELPLKIVDTGYGVERMAWFTQKTPTAFHAIYGQLLDKARSELGLPRPPEEYLWAA
FT                   FRAAAKFNPDVEGSLDAFYQQVSKTTGAPLSEVRQVLEREARLYSVLDHSKTIAMMLGD
FT                   GVVPSNSGEGYLARLVIRRALRQLRLLNENYDLAKIVDMQIDLWGSDFPQLKENRSYII
FT                   EAVGLEEDRYKDLLRRGEKLVLRELSQGASLETLIKLYDSYGIPPEVAAEAAAKKGITV
FT                   LVPRNFYSLVAARHRAPAKVRSIEEKSSLPEDVVSWARQFKPTELLFHKDPYARSFTAK
FT                   ILGVKGEYVVLDSTIFYATGGGQLNDVGVMEICGERYNVVDVQKAGDVIVHKLDRAVDN
FT                   ASCGEARGEIDWVRRFRLMRHHTATHIILGAARRVLGNHVWQAGAEKTPEKARLDITHH
FT                   KPLTREEVRRIEELANRVIDERRPVLQAYMDRNEAESKYGFVLYEGGVPMERKIRVVEV
FT                   QGWDVEACFGTHVTNTGDIGGIKIINVEKIQDGVVRLEFVAGTRVPEEMAALEDRMTQL
FT                   SSELGSQGGEELNKVKELKDELMKLKESVKAYRSLWLSTAKGLIVSSKVNGLIVATLEY
FT                   PEPDVKSARDALKELTDEFINSVITVAVKEDKGYRYELGIGREASRILSAEAILAAISS
FT                   ELKVTGGGRGTYGSFFTSEVPEKVDAIIKRSVSRIVSQNAQS"
FT   gene            complement(246776..247120)
FT                   /locus_tag="ASAC_0247"
FT   CDS_pept        complement(246776..247120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18654"
FT                   /db_xref="GOA:D9Q016"
FT                   /db_xref="InterPro:IPR022295"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q016"
FT                   /protein_id="ADL18654.1"
FT                   /translation="MAQEGKAYVHAALALYYAGAQINEDNLKKVVEALGLQVDDAKVKM
FT                   LVASLSQLNLEDVLKNATAVSVAAPAAAPAAAPAQAPAQQGGEQKKEEEKKSEASEADI
FT                   SAGLSGLFGM"
FT   gene            complement(247458..248492)
FT                   /locus_tag="ASAC_0248"
FT   CDS_pept        complement(247458..248492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0248"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18655"
FT                   /db_xref="GOA:D9Q017"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q017"
FT                   /protein_id="ADL18655.1"
FT                   /translation="MAIMIQKKGRPEPPEYKKQRVAELEKIFAENKYVLFADLEGLPAK
FT                   QLQMIRKELRGKAIMTVAKKNLVYLALERRGLKKEKIEPYLKHGVLVIATNENPFLLTL
FT                   TIDKLKMPAPAKPGQVATKDIVVPEGDTGIRPGPMVSVFGKLKIPYEVRKGTIYIKSDT
FT                   VVAKKGDVISPDLASLLQQLGIQPMEIGLDIVAAWDGETVIPGDVLHIDLEATKNDIIR
FT                   SEQESTYLAKTIGFFEVPEVVQMLAVETELEALSVIRAGELALDADTAKAAIEQAVAEE
FT                   TSIIAALGDKAKELGLEVVQAAPAAAPAQAPAQQGGEQKKEEEKKSEASEADISAGLSG
FT                   LFGS"
FT   gene            complement(248500..249144)
FT                   /locus_tag="ASAC_0249"
FT   CDS_pept        complement(248500..249144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0249"
FT                   /product="50S ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18656"
FT                   /db_xref="GOA:D9Q018"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023669"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q018"
FT                   /protein_id="ADL18656.1"
FT                   /translation="MPLQQEALIEYINRALSLSKKTKFEQAVELIVTLKDFDVKSPEGR
FT                   LREVVFLPHKPAKEPNVCVVAAGDLLLEAKKLGVTTISRDDLNAMRGDKKRVKAIGRSC
FT                   DWVLVQADLMGLVGSVLGPALGPRGKVPTPIPPRANLTEFVNNYKRAAWVRIRGQPQIM
FT                   SRVGTTSMKPEELVDNVNAVLSVVESRIGAAKIGGIYIKTTMGTPVEVPLR"
FT   gene            249288..249362
FT                   /locus_tag="ASAC_R0010"
FT   tRNA            249288..249362
FT                   /locus_tag="ASAC_R0010"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGA"
FT   gene            250180..250716
FT                   /locus_tag="ASAC_0250"
FT   CDS_pept        250180..250716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18657"
FT                   /db_xref="InterPro:IPR018576"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q019"
FT                   /protein_id="ADL18657.1"
FT                   /translation="MITDKDYIEWQISYRDPNGRLIEFGECLDKALNNDTNLKMEIKRV
FT                   VEEYRNVDTFDKKFTIQRIEDNRYYNEFKLINELTPILRLDGLTDNYYIDIILKPKQRA
FT                   VGYQAMVFLYIPCEKALPLEDGQKLIGRKAYQNEKVKVFLNSDHILGLLKSFLLASDTH
FT                   RKDILNILRYLNVNV"
FT   gene            complement(250706..252121)
FT                   /locus_tag="ASAC_0251"
FT   CDS_pept        complement(250706..252121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0251"
FT                   /product="Site specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18658"
FT                   /db_xref="GOA:D9Q020"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q020"
FT                   /protein_id="ADL18658.1"
FT                   /translation="MGLQADNHFSRKEKVYGQFFTPPEVANFIVDFASTFVQEKNRAVD
FT                   PACGDGVFLSALLRSGFREVWGMDIDGSVLNRMPEHVRKSAKVLIGDALVMNPLFPQDD
FT                   ALPANSFDLVVGNPPFSAKFGRVRDSRLELYELGRGRRSQAIEVLFLERFITLARPGGV
FT                   IGIILPDGIFINKNYEYVRRFILKYKVLGVVSLPRGIFRSSLSTTSKTSVLFLRKARGD
FT                   NDEVFMYEARDLDELQEVIRVYRERKGLWARVRPDSLHPKSYSAAEVKFSGSLPVKELG
FT                   ELVLDIHAGATEYGPRRRFADRGLRFISAKVVTPLGIDFRRDEKFIEPGSDMDKRRGHV
FT                   EVDDIVFVRVGVGSAGRCAVIVDESDLGVADDWIYIIKVDKRRILPHYLAMFLQTELGQ
FT                   RQLESLKRGVGTVTIPISELRKVKVPVPSMDFQEWVRSEYLRMVKFLREGNKREAEKVF
FT                   NVIKGKIEELVKH"
FT   gene            252404..252538
FT                   /locus_tag="ASAC_0252"
FT   CDS_pept        252404..252538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18659"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q021"
FT                   /protein_id="ADL18659.1"
FT                   /translation="MKLEPILGKPENKRAIRGYAILAKGDELKQIKENAFRVPSQNSV"
FT   gene            complement(252743..253513)
FT                   /locus_tag="ASAC_0253"
FT   CDS_pept        complement(252743..253513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18660"
FT                   /db_xref="GOA:D9Q022"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q022"
FT                   /protein_id="ADL18660.1"
FT                   /translation="MLGKLAILTIALFAATIIVGSIGIAFYYSYRSTLLTITAQRPLGL
FT                   VLSKVSSLEYKMYVSPSGDTYYVTLKNYPNRTVYIVLTNSSGYELGFVEFGYNSTNITW
FT                   IYMNMGGVKRNVSGSNMSSYITPLLTSATISYNPFTGTISLEAFPGLGPLYGLSYFSSY
FT                   YNINWKDLLDGQPGSTDATVGYLFTPIVFNGKSYRGVEITITPQTSFLGTSGAYSVSAG
FT                   VINLDGVPVAAQITVGTGAANYISMTLLNLTAYS"
FT   gene            253587..253862
FT                   /locus_tag="ASAC_0254"
FT   CDS_pept        253587..253862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18661"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q023"
FT                   /protein_id="ADL18661.1"
FT                   /translation="MEPETMTVGKVRGVNAMGTLGWTTVRCRVCGRLLDLSGQRPGSRR
FT                   FEAVYMCPKCAKTLDAYFCAADARSLKYRCPFCGSELVLATPVINE"
FT   gene            253879..254214
FT                   /locus_tag="ASAC_0255"
FT   CDS_pept        253879..254214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18662"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q024"
FT                   /protein_id="ADL18662.1"
FT                   /translation="MIEKNLLDGNYVIKLESEGLKTFIIDTDVGLKPGVRVDCVKALNY
FT                   NGIKLCYVKRPEGCTLVVLITENRSEVIGCYVVGYAGAAEGARDKCAQCAKEFSAAIDA
FT                   ATASKVQ"
FT   gene            complement(254192..254548)
FT                   /locus_tag="ASAC_0256"
FT   CDS_pept        complement(254192..254548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18663"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q025"
FT                   /protein_id="ADL18663.1"
FT                   /translation="MERGASPEGSPFEKSNREIARIMIKLLTNYWLYFTKNEEVNSDGM
FT                   RLLASALRYAKGAAPQVRHALRESIRRPTLHSVLRVCESLGLDMNYICRLVSIAELGEI
FT                   YGYGYYNVTAPCWQ"
FT   gene            complement(254684..255727)
FT                   /locus_tag="ASAC_0257"
FT   CDS_pept        complement(254684..255727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0257"
FT                   /product="tRNA-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18664"
FT                   /db_xref="GOA:D9Q026"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q026"
FT                   /protein_id="ADL18664.1"
FT                   /translation="MEERQVEEKEIYNMLNQKLVKQGYHIIGNHSSVKKCYWNHAALVE
FT                   GRFCYKGKFYGIESHRCIQLSVTNHWCWNACLHCWRLRPQDVGIEWNETRMPFADDPKE
FT                   IVEKAIQEYRRIISGYKGRPGVSPQMYKEATMPKHVAISLTGEATLYPRLGELIREFHR
FT                   RGISTFLVTRGVRPDVLANLEEEPNQIYISLESWDKESYNYFNRPLVPRAWELTLETLE
FT                   MLPSFSSTTVYRITIVKGYNDNETALKGFARLVDIGRPDYIEVKAYMYVGASRGRLRLD
FT                   NMPRHWEVKEVAKKLSELTGYPIVSESMPSRVVLLSKLEKPVRYGNAPVDWNSPDISAP
FT                   GEYEDTA"
FT   gene            complement(255729..256754)
FT                   /locus_tag="ASAC_0258"
FT   CDS_pept        complement(255729..256754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0258"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18665"
FT                   /db_xref="GOA:D9Q027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q027"
FT                   /protein_id="ADL18665.1"
FT                   /translation="MSLRLGALPQFKVPPKGEHYDVLIVGAGPAGLSAAVYASRFLLKT
FT                   VVVSEDVGGQLNLTNVVDDYPATLSISATELISRFREHAEKLFGVPIYTNITVQKFSRE
FT                   GDEYHVTGTRGLDVYSKTIILAVGSRRRKLNVPGENEFAGRGVSYCSICDAPLYKGKEA
FT                   VAVVGGGDAAFEGAILLSGYVKKVYLIHRRSEFRAKPFYVQEAMSRPNIEFVLNSVVTE
FT                   IKGDKLVRSVVVKNNVDNSIRELNVDGVFIEIGFEPPKDWYQSLGLEVDELGYVKTDLW
FT                   MKTNLPGVFAAGDAISLWRGFRQIVNAAASGAIAAYSAYTYLTEHGLVRRPALASKEAA
FT                   K"
FT   gene            complement(257011..257682)
FT                   /locus_tag="ASAC_0259"
FT   CDS_pept        complement(257011..257682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0259"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18666"
FT                   /db_xref="GOA:D9Q028"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q028"
FT                   /protein_id="ADL18666.1"
FT                   /translation="MCAEENNEKSVKYSDMVYEMLKNDILGRRFEPKDKLSETTLAKLY
FT                   NVSRTPVREALHKLEKEGLVVKLSDGYHVSFLTKEQILKIFEVRAVLEALAAEKAAENR
FT                   DPAMLSKLREAAENFKKADRSNPLALAQANSYFHDIIADMSGNEYLRDILKDLRNKLAI
FT                   VRVDLFASSNRVEQEIEEHWRIYEAIEKGDPKEAHDAALKHQMNLIEFIKSKRMVGGIL
FT                   V"
FT   gene            257775..258209
FT                   /locus_tag="ASAC_0260"
FT   CDS_pept        257775..258209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18667"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q029"
FT                   /protein_id="ADL18667.1"
FT                   /translation="MSSSLHEEYYELLWRAVKFGLSEVRSGCVDAKTLEGECVKSRGYR
FT                   SFVEMPLYIRLLCASSAVIAELMCDYFSVIADYVASNGLDRDGLCQELREADLLLVVIS
FT                   STLAEEAAEYKIHDSVYEAFQNAVSNIRGLSKSLCPDDHN"
FT   gene            258392..258506
FT                   /locus_tag="ASAC_R0011"
FT   tRNA            258392..258506
FT                   /locus_tag="ASAC_R0011"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            258584..259540
FT                   /locus_tag="ASAC_0261"
FT   CDS_pept        258584..259540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18668"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q030"
FT                   /protein_id="ADL18668.1"
FT                   /translation="MPNGAILLGNNVVADSYHKRPIRVVTHAHEDHTKYLSRSISESLF
FT                   IAATPVTHEFLKVLGYSIPQSKALLLDYYKEVEFDNEKLKLIPSRHIAGSAQVMVETPQ
FT                   GTAGYTGDFKMPGTPPLQDLDVLVVDATYGSPHLSRKGTEWDALGALVNIIEVESPNNP
FT                   IIIYGYNGKLQEIMVELRIRGVSGAFLADETTLKLAKIASKFYNVELGDVRLYSRDELL
FT                   PGSIAFIHLSKSSSMIRVPAVHVILTGTERRGPAVKVNDKVYRVSFSDHATFWEVVDYI
FT                   RESRPRKVIVDASRGFDSKFMAKYLSNVLNIDAVSEP"
FT   gene            complement(259687..259848)
FT                   /locus_tag="ASAC_0262"
FT   CDS_pept        complement(259687..259848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18669"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q031"
FT                   /protein_id="ADL18669.1"
FT                   /translation="MTLNNMLYLLPNITSRALETMSRKAISIADPTIADVSPTRERSIE
FT                   NVVSRFRA"
FT   gene            complement(260003..260815)
FT                   /locus_tag="ASAC_0263"
FT   CDS_pept        complement(260003..260815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18670"
FT                   /db_xref="GOA:D9Q032"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q032"
FT                   /protein_id="ADL18670.1"
FT                   /translation="MSQGEDERLRLFERSLSRFAGVLGLRVNVELSRKVEEVQLKIMDD
FT                   VTKVIDKIWSQGLTLQDLLARLSNDGVLREEAVYASKAIGESLNPDSVDDVLARAISGD
FT                   VSQEGAKSALIAFQAIARAYASRYFKENGSIEHLSPYCPLCGAESRTMVKRGDKYVMVC
FT                   HLCGYEWVIGRGSPVCPFCGNDNKFKLGTFMDKEWKYGLMFCQECGSYWRVIWDEEMAS
FT                   APSIVLPLLAMAAERFRTALPKDIVNGSQEPGAEVSLDKEEDETEGKE"
FT   gene            complement(260822..261928)
FT                   /locus_tag="ASAC_0264"
FT   CDS_pept        complement(260822..261928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0264"
FT                   /product="Electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18671"
FT                   /db_xref="GOA:D9Q033"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q033"
FT                   /protein_id="ADL18671.1"
FT                   /translation="MSQWTAPPSAGSQDCDKLCPEWECRDNSEYRGVWVIGEVDENGII
FT                   EPSLQMLTPAKKVASKLNVKITGVLLGSNVKRFANQFIEYGADEVIVVDDPRLSSYAPN
FT                   VYGEVAVSLIKKYKPEMVFVAGTMKGRELAPYIANHLRAGITADCTDFDVDEKTRDVFQ
FT                   IRPPFGAVLLAYIRTPNRRPQLATARPNVFPLPQRDPSREGEIIEEKVDYVPQPKARLV
FT                   SRKVVPRTEVPIEKAELVIGGGKGLGTAEGFKMLQELANAMGAVVGGSRKAVDLGWIPH
FT                   ERQIGQTGKSLKSVIYMAVGISGAAQHMFGVREAEVVVAINKDPTAPIFSQCDYGVVAD
FT                   YREVIPHLIKMLKDLKEQVKRGETPRVE"
FT   gene            complement(261925..262779)
FT                   /locus_tag="ASAC_0265"
FT   CDS_pept        complement(261925..262779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0265"
FT                   /product="Electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18672"
FT                   /db_xref="GOA:D9Q034"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q034"
FT                   /protein_id="ADL18672.1"
FT                   /translation="MRIVVGIKWVPGTQSVRIDPKTGTLIREGVPSIVNPHDLPAAELA
FT                   LRLRDKYGGEVIAISMAPPPAAKGLEYLVGMGVDRAILITDRAYAGADTLATSYVLANA
FT                   IKKIDKEIGKVDLVVFGQETTDSSTAHIAAQTASWLEWPYIYYVRNAWLTEDGKLRVER
FT                   ILEEAIEEWEVDLPAIINVAMKSLKPRPVTLINKIRFKANPSIMMTWTNNDLKLDPRCT
FT                   GLKGSPTFVAKTVDVPEVPRKKQVYVPKNGEDAAKWILKSLLSDEKASKALIKALKEGG
FT                   DAA"
FT   gene            complement(262791..263096)
FT                   /locus_tag="ASAC_0266"
FT   CDS_pept        complement(262791..263096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0266"
FT                   /product="Ferredoxin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18673"
FT                   /db_xref="GOA:D9Q035"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q035"
FT                   /protein_id="ADL18673.1"
FT                   /translation="MSAQQAKQEPQPMKLEDILQSDVWNVDEEPHIVVDYTKCEKCPAK
FT                   PCIYLCPAGCYTLAGDRIVFSYEGCVECGTCRVICPMDAITWNYPKSGHGIIFRFT"
FT   gene            complement(263093..264397)
FT                   /locus_tag="ASAC_0267"
FT   CDS_pept        complement(263093..264397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0267"
FT                   /product="Electron transfer flavoprotein-quinone
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18674"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q036"
FT                   /protein_id="ADL18674.1"
FT                   /translation="MSSVPTKFDVVVIGAGPAGSAAAYTLAKEGFKTLLIDRGRGGGEK
FT                   ELFGGRVYAQPLREVWPELDKEAPIQRWVTRERISMVNGDEVFTVEYKSPAGKSFTAFL
FT                   PQLTSWMARKAEQAGALYVNEITVDEIAFRDGKAVGVRSGSDTIEADVVIDAEGVNRLL
FT                   LERAGLVEKLKPDHVALGVKEILRTGATQLEASFGIDSSEGVSWVVVGDITKGVPGGGF
FT                   IYTNKETVSIGVVLHLKHAIEAIEAGSLNQHVYELVEGFRLHPFFRRLWRDATISEYGG
FT                   HLTIEGGLKFAPERFAYPGLLVVGDAAGLLLSTGVNYRGVDFAAYSGKLAAEAVKYARD
FT                   HGGFTYDNISVYETYLKNSFVYKDLKKHLAAEMLMNDPALFAKLPRIALGLFRELYEQD
FT                   YSTPTPYEALISVLNNENIGLFNLLPLTLSVVRSL"
FT   gene            complement(264563..265039)
FT                   /locus_tag="ASAC_0268"
FT   CDS_pept        complement(264563..265039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0268"
FT                   /product="translation initiation factor IF-2 subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18675"
FT                   /db_xref="GOA:D9Q037"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q037"
FT                   /protein_id="ADL18675.1"
FT                   /translation="MNLYPFVESIAGDAALSEDLEKLKDYEWLLGRVYEKIPPKSGSGT
FT                   FELPEPQVIRVGTQTIIKNFRDISQKLKREPDMVSRYLMKELASAGSYEEGSGQLVLSV
FT                   KVSSKVLKQLLDMFVKSYVKCPTCGSIDTHIEKRGKVWILVCEACGAEQTLKPF"
FT   gene            265105..265177
FT                   /locus_tag="ASAC_R0012"
FT   tRNA            265105..265177
FT                   /locus_tag="ASAC_R0012"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            265347..266726
FT                   /locus_tag="ASAC_0269"
FT   CDS_pept        265347..266726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0269"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18676"
FT                   /db_xref="GOA:D9Q038"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q038"
FT                   /protein_id="ADL18676.1"
FT                   /translation="MPWSILNLLRTNPEALREVARKRQIDVKIIDEAVQLDEQWRKVQA
FT                   EINELRHQHNVISAAIPKAKGEEREKLLAQAKELSRELEDAERRLSELEAKREEALWRL
FT                   PNVVLDDVPVGGEEATRPVRFWGTPRVYHEYLDAFKAQTEAYGFNVPYELIDWKPVGHA
FT                   DMLENVLKLGDTEKASEVAGSRFYYLFDDLVWLDFALLLYAIDKLTSKGYTLVLPPYML
FT                   RYKVINSVIDLATFQDAIYKIENDDLYLIATAEHSLAAMYYNEELYDDELPKKFVGISP
FT                   AFRREAGAANKDLKGIFRVHQFHKVEQFVFSKPEESQKIHEELISNAEGLFQGLGIPYR
FT                   VVNIASGDLGACAVKKYDLEAWMPAQGKYREMVSASNCTDWQAYRLNIRLIRRKGMERG
FT                   EYVHTLNSTGIASTRTITAILENFQEPDGTVIIPKVLRKYLEPFDAAPKDFIKPRPRKA
FT                   I"
FT   gene            complement(266771..267988)
FT                   /locus_tag="ASAC_0270"
FT   CDS_pept        complement(266771..267988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0270"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18677"
FT                   /db_xref="GOA:D9Q039"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q039"
FT                   /protein_id="ADL18677.1"
FT                   /translation="MRIEEIKAVLWKELLDMVRDRRALALMIIVPLVGLPLMALLAGGL
FT                   SSAQLTTVYIQVNDTKSFGIAEWLGESIVNASEQQGLKVNLTVSSGPPPRVYDIEITIP
FT                   RGFYNNLTAVDGVATLIVRVMVGSYAAQEVSNIISSVVSQLSSQVVDSRVDSLARMAGI
FT                   NISAERLLNPIVITTGYILPSGKAASAQQVQLSLTVRLLQFSLFFVVNPAVVLMTDAFL
FT                   GEKERKTLEVLLASPLSGTSLLVGKLLSSAVMGLAIAVADSAGFIIYFLMLASSAGLRL
FT                   TPALLGLNMVDSAVLVLMTSSFIMPIVLRSPSARAAQASAYALLMVALGIYFSALFVNV
FT                   GSLPTAIRYTLMAIPFTEASLALSNYVVGQYLMAALDIIIMVAFTALFVALSLKAFNPE
FT                   RLVTSR"
FT   gene            complement(267969..268763)
FT                   /locus_tag="ASAC_0271"
FT   CDS_pept        complement(267969..268763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0271"
FT                   /product="NatA-like ABC-type transport protein, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18678"
FT                   /db_xref="GOA:D9Q040"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q040"
FT                   /protein_id="ADL18678.1"
FT                   /translation="MEAALGRPAGLPLDNNENVVEALEVTKRFGKTPALRGVNLQVKRG
FT                   EVHVIAGHNGAGKSTLFKIIIGLIRRDSGSLKVLGVDPSAPSWRKLVRYIGYVPEDASP
FT                   YERLTGYEYLRFFARLYARDPSEVEEMVKVGVNIAGLSDRDLRRKAGEYSNGMKRRLLI
FT                   ARALMHRPLLVLLDEPTNGLDVFSAHEVRTMIKSLSRTGVTFVIATHNMAEAEYLADRV
FT                   TFMAYGKSLFAGSPKEARESFGAENLEEAFVKAVKSYEDRGD"
FT   gene            complement(269422..270222)
FT                   /locus_tag="ASAC_0272"
FT   CDS_pept        complement(269422..270222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0272"
FT                   /product="hypothetical protein"
FT                   /note="DUF137 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18679"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q041"
FT                   /protein_id="ADL18679.1"
FT                   /translation="MEDIPRSHPRYWSLVTRQKLVDAMKEGVVVPQGLISHGRGEAFDY
FT                   ILGEKSLDFALEAERTAVAAMLLAKRPIISVNGNYAALAADDIVKLSEQLNAPIEVNVF
FT                   HRTEERVKVIEDFMKRHGATRVYGSECQKTHIPGLESARGIVCVDGIYSADVVLVAIED
FT                   GDRTEALRRMGKVVIAIDLNPFSRTAQAASITIVDEAIRATKNMISMAEELKGLGKDKL
FT                   RDIVSSYSNRRTLSMAFRAMLERLEYASSKGIIIDLGFRDEVNV"
FT   gene            complement(270227..271012)
FT                   /locus_tag="ASAC_0273"
FT   CDS_pept        complement(270227..271012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18680"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q042"
FT                   /protein_id="ADL18680.1"
FT                   /translation="MWGSTPRDSGSVGVGIAVEPRLELCYDLKLSGEPAGTAAKLLESN
FT                   GVDLSKVKSSNPLPWSFGYATSGASAVAAAHLASYLKGKSLGSLLVQAHEIEVQDRTGL
FT                   GDVLAISCGLGLVLRRRAGPPGIGQVDCLYLPRSISLLSIEAGGMSTESLLSSLGDDFY
FT                   VESSNVLRKLDEELSLEAFIESVRALNDKLGLPSSILGAQNFEYVTKVPGLLGYYTKKR
FT                   LVILIIERDLVGDAVDYLRKGLPYDIRELSPSEAGPYLR"
FT   gene            complement(271104..271940)
FT                   /locus_tag="ASAC_0274"
FT   CDS_pept        complement(271104..271940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0274"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18681"
FT                   /db_xref="GOA:D9Q043"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q043"
FT                   /protein_id="ADL18681.1"
FT                   /translation="MNSKRILLDDVINIDYEKAIDAITSFIKDFLESSSVKGFVIGVSG
FT                   GVDSAATYFAAVKAVGPEKVMALIMHDSTVTPKEDVDDAKHLIEIARTQYNIIDIAPIV
FT                   ETYRSTIPVYDPADTVPLGNLRARIRMSLLYYYANKFNYAVLGTGDRSEAFLGYFTKYG
FT                   DGGVDLLPIAPLLKSQVRRLALKLGVPEKVAFKPSSPRLWPGQTAEGELGVSYDQVDLV
FT                   IHAIEDLKMTPSEAAEATGVSMDIINRVLQLNKSTQHKRSLPPSPSLESVVRYMPR"
FT   gene            complement(272051..273292)
FT                   /locus_tag="ASAC_0275"
FT   CDS_pept        complement(272051..273292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0275"
FT                   /product="Coenzyme A biosynthesis bifunctional protein
FT                   CoaBC"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18682"
FT                   /db_xref="GOA:D9Q044"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q044"
FT                   /protein_id="ADL18682.1"
FT                   /translation="MSFRHPSLDITGSTSKELAGHCIALGVTASASIYRSLDTARALMR
FT                   RGAEVHVIMTRAAADLVSPKLFHWATGNRPVVAISGDIEHVEMAHSCSAMLLAPATYSS
FT                   ITKLALGIADNPVVLTAITMMGYGRPVAVVPAMHEGMERSPQYQDAVSRLKGMGVLVIP
FT                   PLEAESVAKYPDPYLVARAFTSFALRGFDMKGLRVLVTAGATRSWIDSVRFVSNPSSGR
FT                   MGVEIAIDAFARGAEVDVIYGHVDVKIPHFVNSYHVETTEEMAERMRELTASRSYDIIV
FT                   GAAAPLDFTVEAPYKGKLKSDSSYTITLRPAPKTLKSITLKPKVLISFAADVATTEKEL
FT                   ISSAMEKASKYGATLVAANPVNVGTYGFASEYDKVVVVDTGTGRIYDLGLDRKESLARK
FT                   ILDIALSQIKSRNG"
FT   gene            273387..273977
FT                   /locus_tag="ASAC_0276"
FT   CDS_pept        273387..273977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0276"
FT                   /product="N-terminal acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18683"
FT                   /db_xref="GOA:D9Q045"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q045"
FT                   /protein_id="ADL18683.1"
FT                   /translation="MKAEEQEGSEGFPFIIRRAREEDIDQVMEVNLASLPENYWYSFYV
FT                   YVLNEWGDAFLVAEHQGKIIGYIMNRVEETHDKVLMGLENELTERPGKSEGLLDAIRRR
FT                   FSESAKVGHVISIAVLAEYRRKGVGSALMQEAINVLKSKYDVDAIYLEVRVSNTPAINL
FT                   YEKFGFEKVRIIKGYYRDGEDAYVMVKRLKPVQ"
FT   gene            complement(274113..274547)
FT                   /locus_tag="ASAC_0277"
FT   CDS_pept        complement(274113..274547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18684"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q046"
FT                   /protein_id="ADL18684.1"
FT                   /translation="MYLINARKSVRNSMVRLRAYSKENELKQMEDTLNALDWLLEWALL
FT                   KVQTLITVGLVNWREVATVMNVVKKVMQEYSYLDPRIEEEISGAEESLSRAWMNIEPSL
FT                   PEEFSEKDLTSIEEEAKKVIKEAEMVAKSRGSANTLASQQ"
FT   gene            complement(274710..277124)
FT                   /locus_tag="ASAC_0278"
FT   CDS_pept        complement(274710..277124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0278"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18685"
FT                   /db_xref="GOA:D9Q047"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q047"
FT                   /protein_id="ADL18685.1"
FT                   /translation="MSRRDSGPRTHGEESFMDIIERFSFPISLAVLLAMIAVSTYIRLL
FT                   PGLIYGFKYVNGNDPWIFYWLANYFYVHDLGGLSQLSHVGTFWYPWGRNFLKTEYLGIP
FT                   WLSAFMTKLLGKGQAFIIEAEGLLPVIFAVIGIAATYMAVYRATRSKLGAITAASVYAF
FT                   YPAIVLDKSFATYPGKQVSGLGIIALSLYFLAVAYTSTSRNRSLVAALVGGIVGGSLAW
FT                   LWGGYEYVALILAVIVLLDPFIVSPTMDRFYKHLAAAVGYLAVLSTSPAVGPTYVYHSL
FT                   GLALLAVLAVYFLEANVEKLHLERLHLTSTFTRKMHLWVIILGVGLLAAAAMSGIISLP
FT                   SRVLLALGIRPLTGVVPLTVQEYMPIPFSEAMAEYGPVFFVTLIGLIVLIYDVVARRER
FT                   LSSTDTLRVAFLALGVLFMVASINEAYFIPSAAFFLALSAGTSIGALTSMHVSYFDKKT
FT                   RRTYYKREPAALAVGVILAIIILGFAAYYIPEDYAALKLDAPAVTTGWLTALSVPTSNG
FT                   TSRVIVPLNNAWIAALNYIKYNTSKKSIVVSWWDYGYWIAALGNRTTVVDGSTINGTQI
FT                   GLVANVFTAPVNQSPVYLEMMRLAPNDTYLITYDIFIGIYDNSTHSVIMFPYPNVYPVN
FT                   PQAGVYAITYGLGDIAKSYQMLRIALRVNPYADSPFFSNYTSVTTESNYEFYQFPAFVG
FT                   GPSSNVSLTLHTTIYDLMMYGISVLNKYGYFGTGAKFLTNVTSFVPAGVQYVDPLTGSI
FT                   VPEPITPPSPLPYYQPAKVFISVPYAWSPAGSNVTYFYSVVVFLYRWTGVI"
FT   gene            277181..278392
FT                   /locus_tag="ASAC_0279"
FT   CDS_pept        277181..278392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0279"
FT                   /product="Peptide chain release factor subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18686"
FT                   /db_xref="GOA:D9Q048"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q048"
FT                   /protein_id="ADL18686.1"
FT                   /translation="MNNIKRNKVNNRKGLIGSALTLNRKGTMSEDLEKKLLVDKRTLKE
FT                   VINELKQWSAPATVLLSLYVPPGRPISDVTQMLREELSLADNIKLKRTRNAVKRAIAAA
FT                   IDRLSMIPKVPPNGLVAFCGENLDNGDFKCYVFSPPEKVPVFYYRTDKRFITEILEDMI
FT                   ENEDSVGVIIVERDHATIGLIKGSRIQVLEELEDFIPGKHMMGGQSQRRYDRIIEQMVD
FT                   DFMKKVGERANEYLLPIYEAGKLKAIIVAGPGYAKSDFIKSGYLDYRLQKIVDPHLIDV
FT                   SYQGEEGIREALEKADDVVQLSLYRETMNAFENFKLHLAKGTGLAIYGPDDLERALDMG
FT                   AVAVLLVHEDRQDVDKWKERAESMGAKVYIIPESLPESEWFLKTFDGLAGILRYKVDLS
FT                   SQQG"
FT   gene            complement(278413..278925)
FT                   /locus_tag="ASAC_0280"
FT   CDS_pept        complement(278413..278925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0280"
FT                   /product="Nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18687"
FT                   /db_xref="GOA:D9Q049"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q049"
FT                   /protein_id="ADL18687.1"
FT                   /translation="MLLYGRFQPFHRGHVSLVKWALSQGFDEVVILVGMASENYTVRNP
FT                   FTAGERIEMARLSAKDENISLDRIVTATIETLEVSIGCAYYVLSYVPKVKAIMTRNPVI
FT                   GKAFSDAGIEVISPPTFNREEWRGERIRAMIARGDPKWKEYVTPSVAKFIEEIGGVDRI
FT                   RKISSED"
FT   gene            279007..279639
FT                   /locus_tag="ASAC_0281"
FT   CDS_pept        279007..279639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0281"
FT                   /product="Peptidase family M50 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18688"
FT                   /db_xref="GOA:D9Q050"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q050"
FT                   /protein_id="ADL18688.1"
FT                   /translation="MRPWRRPWYYAEVDEPYSWIIGILAVLVAMAGVQAFRLSTYTSVY
FT                   SYVVGGVVIGMVVHELMHRNVARRYGMRSSYVINWLGVIVTLVTAILPIKLIAPGYTRV
FT                   YSRGFEEDRRGILYSVAAGPMSNIVMALAALIAGALVRALVSSVFAASFTSTWLIGFSN
FT                   INSYLAFFNLLPIPPLDGYKIFRLSLELWIIMFIVSIAFFAATLMLL"
FT   gene            279754..280059
FT                   /locus_tag="ASAC_0282"
FT   CDS_pept        279754..280059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18689"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q051"
FT                   /protein_id="ADL18689.1"
FT                   /translation="MSLTPDEREPDKEDGKRRWVIKMIKSAKSQHKLCPYYDKKTQICF
FT                   LMVTMNNQQGKCDREGRFDGCPMFTNFLERVYDDYTAKKKVLPNSFQDIVWGITSI"
FT   gene            complement(280159..280563)
FT                   /locus_tag="ASAC_0283"
FT   CDS_pept        complement(280159..280563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18690"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q052"
FT                   /protein_id="ADL18690.1"
FT                   /translation="MKINMNDGKGDGKDGSQVSEVSITDALSRIYEDGDVIVYTAPNEE
FT                   ELKEILVNLLRRNGRMSVKDFHRYLSGLASEDKIRYALNELLRNDIVTMDKQGYFYLTE
FT                   LLEAEGEYWSDESGESSEIGEASDNLDDSM"
FT   gene            complement(280706..281161)
FT                   /locus_tag="ASAC_0284"
FT   CDS_pept        complement(280706..281161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0284"
FT                   /product="RecB-family nuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18691"
FT                   /db_xref="InterPro:IPR018665"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q053"
FT                   /protein_id="ADL18691.1"
FT                   /translation="MRKVIPVIHNTSSVQRLVDMARIVLSMNIDLLVATKVYGAAAQSG
FT                   IAEAFRLLLKAGKGLVVLPELKDAVETYDGTQVFLVDKEHAAELVDPLSGDFTAGSNSP
FT                   LMLVFNGSDAPFSPQELSLGKPIYIKGLSYRAGSTAEASLLLYGILR"
FT   gene            complement(281172..282575)
FT                   /locus_tag="ASAC_0285"
FT   CDS_pept        complement(281172..282575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0285"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18692"
FT                   /db_xref="GOA:D9Q054"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q054"
FT                   /protein_id="ADL18692.1"
FT                   /translation="MSQEKDHMDYAQDLDIAARPDLTISVLGTDVGSLLGHGIPLFTIG
FT                   GGYLRSALSQILVNFHARRGYYIAETPIVSSGALFELSGHMGYYKQNMFVFQVEGKEYA
FT                   VKPMNCPFHILIFLSEVTRHRNKVSLPFKVFEVGRVHRLEPSGSVYGLLRSRSFTQDDA
FT                   HIITLGKDAVNVITSVFDEMITIYSKLFNVEMNPSTVTLRLSLSDKSKIGTDFMGTKDE
FT                   WEKAEDFLRGALEAIASKYGLRYTAAEGEAAFYGPKIDVLVKLGSGQEGKEWQLGTIQF
FT                   DFNLPRRFKIFDAAKELYGSEDVYIIHRALIGSIERFLGAYLDNYKGRLPFVLAPLQFA
FT                   VLAIKAGDEFDKRVEDFALSLHRALVAKGFRSGYGETTRTSLSGDVRLLESGPKPAAIV
FT                   YVGRREIEKGSVTVSIYEGGSRRQTSVNASDPLGAADAIESLASRLEEPVKEIAGMVPR
FT                   IPGDLSYQL"
FT   gene            complement(282614..283267)
FT                   /locus_tag="ASAC_0286"
FT   CDS_pept        complement(282614..283267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18693"
FT                   /db_xref="GOA:D9Q055"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q055"
FT                   /protein_id="ADL18693.1"
FT                   /translation="MSWARIVAVLAVATAVEALSMVARQRPIAATSLGSFIYYVLLLSV
FT                   LPLVTAVGAAVSVVLTGSPYPGIAISAIPLSLSSSFQALLVGLASLVVSLVATLATYFL
FT                   LELRDRQPGSGPIARARSPSAVPLASASLGLAIQSFSASITGSLIYSEAVYLAASVTAA
FT                   VISSLASRGLLKELAYGLLSSLGPLGLAVVLSTVLIQERGLDRMSQGVQAPKKP"
FT   gene            283354..285819
FT                   /locus_tag="ASAC_0287"
FT   CDS_pept        283354..285819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0287"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18694"
FT                   /db_xref="GOA:D9Q056"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q056"
FT                   /protein_id="ADL18694.1"
FT                   /translation="MKLEPKISETRWDVNKELELLDLWRKEAASSTGAAEWREKEVLVI
FT                   DTPPPYASGKWHVGGAAHYAQIDMIARYFRLKGYYVLVPFYADRNGLPVEVQVEKTYNI
FT                   NAKEMAATPEGRRKFLELCREFLDKAEKDLVNVWTRLGCSFDYWRDGTDSPKYRTMTQR
FT                   TFIDLFKRGMIYEAERPVRWCPRCGTTLAEAEIEYEEREDFIYFIKYRLADSGQDLVVA
FT                   TTRPELLPACAALAYNPQDNRYKGLAGKRAVAPIFGNEVSIVEHPSVDMNFGTGLEMVC
FT                   SYGDEDDVRLFRELNLKPKVIIDQDGRMTEEAGFLAGLKVEEARRKVVEELEKRGLLVK
FT                   KVKVKHTVPVCWRCKTPLQIINRTELFLRQLDLREQMKELVSKLDVRPEFHRRKLLEWL
FT                   DSIAMDWPISRDRYYGTEIPLWRCTKCGSLLVPEPGRYYRPWEEEPPWDRCPACGAPKE
FT                   YLKGETRVFDTWFDSSISMLYVTKWLEDPEFFKKASPNVLRPQGEDIIRTWLYYSLLRV
FT                   YQLTGKPAFRWIRITGMGLDPKGRPMHKSLGNVIDPDPIISKYGADAFRFWAASSAKLG
FT                   YDYRYDEKKVITGRNFATKLWNLARFISAFPESQEVSSLRPIDRAFLALAQQYLDAAVK
FT                   GYEDLDVYEPAVQLYELSWNVFAAHYVELVKDRAYSEGYPYEDRASAWYTLHRIFRAAL
FT                   VLLSPIMPFVTDYIYRQLYGRSVHAERLPEKLIEAPNLNELAEDARQIMNVNSSVWAYK
FT                   KASGLRLTDPIKDYAVAVPARLSPYLDDLKLFHKAKFVTYERPLPEWTNIGPGIYLAPL
FT                   PSTGADLSI"
FT   gene            285892..286818
FT                   /locus_tag="ASAC_0288"
FT   CDS_pept        285892..286818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0288"
FT                   /product="Putative L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18695"
FT                   /db_xref="GOA:D9Q057"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q057"
FT                   /protein_id="ADL18695.1"
FT                   /translation="MITVVGGAGRVGVTTGAMVLLRDLDDVMLIDIKPNAPQGEALDLN
FT                   HMAAVLGISRRAYGSNDYKDMSGSDIVIVTAGFPRKAGQTREDLLRVNADVMKQIAEQI
FT                   KEYAPNSKVLVLTNPSDAMTYVMYKKLGFPRERVIGFSGLLDSPRLAYYASVKLNISPA
FT                   SIQPVVLGMHGEHMFPAPRLSSVGGAPLSSLLSQKDIDEIVKQTVEAGAEIIKLRGYSS
FT                   NWAPAAGLALMAEAIKKDQRKVYIVSAYLNGEYGYKDVIAEVPAVLGRNGIEKILELPL
FT                   TDEERKGLDASVNAVRDLLNALPPEYR"
FT   gene            286944..287207
FT                   /locus_tag="ASAC_0289"
FT   CDS_pept        286944..287207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18696"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q058"
FT                   /protein_id="ADL18696.1"
FT                   /translation="MASGEQLPKKVFYINIYQLNYKPSSGCEFFESYEVGGSYIAYCKV
FT                   LESYITRSNVHKCETLFKDCPFRKVGVKASLSQDNEASAATS"
FT   gene            287390..287806
FT                   /locus_tag="ASAC_0290"
FT   CDS_pept        287390..287806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0290"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18697"
FT                   /db_xref="GOA:D9Q059"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q059"
FT                   /protein_id="ADL18697.1"
FT                   /translation="MDGAEMLVCDECFVKLTKSGRAVPVTSRPREVRPRPKRTANEVAL
FT                   EVVDNYPELIRAARESKGWTQAALAQKLKISEAMVKKIESGKYKPTVDLAKKIEAVLNI
FT                   KLLQPVESEEEGEEPPEDHLTFGDVAVVRRDKNS"
FT   gene            287845..288966
FT                   /locus_tag="ASAC_0291"
FT   CDS_pept        287845..288966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0291"
FT                   /product="Putative GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18698"
FT                   /db_xref="GOA:D9Q060"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q060"
FT                   /protein_id="ADL18698.1"
FT                   /translation="MISREYLDHLEEALAIAESANYEVVDIIKRSRPGRRLSDEAARRI
FT                   SERAHRANAEVIIYYGNLEPSSLYKLEKESKLKVLDRVLIILEIFALHAGSKESKLQIE
FT                   MARLKHELPLIREYIRRAKAGEQVDFLGPGRYAFEAYEKHVITRIARIRRELDELRRRV
FT                   KTQEQARKDSGVVLASIVGYASAGKTSIFNAITGERQPTGPEYFTTLFAKHKMVNFNNT
FT                   KIMLIDTVGFVRDVPAEIIESFYSTLQEASLADVLIFVVDSSEDVSAIREKVAAGVSLL
FT                   SKLNAINKPIILAMNKIDLVARDDLNKKESLVRELLSHMGIKADLVEVSAVKKLNLEAL
FT                   LEKVSESARGAGGPSETLRQGVRAEARPQADAR"
FT   gene            288926..289459
FT                   /locus_tag="ASAC_0292"
FT   CDS_pept        288926..289459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0292"
FT                   /product="hypothetical protein"
FT                   /note="DUF127 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18699"
FT                   /db_xref="GOA:D9Q061"
FT                   /db_xref="InterPro:IPR002845"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q061"
FT                   /protein_id="ADL18699.1"
FT                   /translation="MYVLRLGHRPTRDKRVTTHVALVARAFGANGFVLEGVCDDSVYNS
FT                   LTKASNMWGGAIHYECGVNGHEYVKSWKANGGEVVHLTMYGMPVDDAIGKLSSSPKPKL
FT                   IVVGSQKVEAFYYMNADYNIAIGWQPHSEVAALALFLDRLFKGRELYTYYTDAKASIIP
FT                   TRRGKRVEWRGQRK"
FT   gene            289434..290018
FT                   /locus_tag="ASAC_0293"
FT   CDS_pept        289434..290018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0293"
FT                   /product="Transcription initiation factor IIE, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18700"
FT                   /db_xref="GOA:D9Q062"
FT                   /db_xref="InterPro:IPR002853"
FT                   /db_xref="InterPro:IPR016481"
FT                   /db_xref="InterPro:IPR017919"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039997"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q062"
FT                   /protein_id="ADL18700.1"
FT                   /translation="MSGEGNGNNEDDKSLEGLRQLIRMLAVKSGIDEAMADDLFDLLLT
FT                   VDPEKGISDEEVEQMKGYKQADVRKVFRIFYDLRIASYRRGKHPDTGATRYYWYLDSRD
FT                   ADLALLRRKKQVLEKLKMRLEYERSNEFYVCPKDGTRYTFDYAYEYQFTCQKCGTMLVP
FT                   EDNSSYIRVLENRISRLEEEIKRDERQIFGH"
FT   gene            290008..290991
FT                   /locus_tag="ASAC_0294"
FT   CDS_pept        290008..290991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0294"
FT                   /product="Cytosine-specific DNA methylase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18701"
FT                   /db_xref="GOA:D9Q063"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q063"
FT                   /protein_id="ADL18701.1"
FT                   /translation="MAIDLFSGAGGFSRGFELAGFNVVAAVENDPPVAKTYKANFPETY
FT                   LIADDIKDVSEPTIKDVSGYGRGDVDVVIASPPCEPFTPTNRRRMQDPVDRILSDPIGQ
FT                   LYLHAIRLIGELKPKYFVIENVSGVAEGPIRKVIEDELRRSGYDEVYFNIIRSEKYGAP
FT                   NERVRAFVSNVQLKLRESRPITVEEALKGLPEPGSPWPPNHDYPQPLSRRLERKVSRIG
FT                   WGRAMITFEGADSRRFRNFIRLNPKRPAPTVMGSSRFIHPYEDRLLTVREQARLMGFPD
FT                   YHLFLGGRDSQYNMVGEAVPVPLAKNIAEFLLTLLDNEGRGFGRDG"
FT   gene            complement(290995..292161)
FT                   /locus_tag="ASAC_0295"
FT   CDS_pept        complement(290995..292161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0295"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18702"
FT                   /db_xref="GOA:D9Q064"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q064"
FT                   /protein_id="ADL18702.1"
FT                   /translation="MSLSESGKNTREKPDDDELSLLREKVRYLTQLNMNLEKDLEFYKQ
FT                   ELNKLLEPPYIEAMVLEVLSDGRAVVKSSTGPNLVVRIASNVDIDKLRPGASVALNNKG
FT                   STIVEVLPSIHDPLVEAMEIEERPSITFKDVGGLEEQIREIYEVVGLPLIKPQLFDEIG
FT                   VEPPKGVLLYGPPGTGKTLVARALAGEVKATFIRVVASQFVNKFIGEGARIVREVFRLA
FT                   KEKKPSIIFIDEIDAIGSRRVDMGTSGDREVQRTMLQLLAEMDGFDPLEGVKVVAATNR
FT                   IDLLDPALLRPGRFDRIIEIPLPDKKGRLEILKIHTRNMKLKDVDLEEIASMTEGFSGA
FT                   ELKAVATEAGFFAIRDGKNYVSQEHFIKAVDKVRNRMEKRKQIFGTHI"
FT   gene            complement(292435..293187)
FT                   /locus_tag="ASAC_0296"
FT   CDS_pept        complement(292435..293187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18703"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q065"
FT                   /protein_id="ADL18703.1"
FT                   /translation="MKVNVHRGAMKKDVEREQPLEALKERGGPRSKLVDAILVLLLARP
FT                   MKAAEIAEVLRREPKYISSYLSYWKSRGYVDYDLGLWYLTPKGEDYARQVAEAQRDEQF
FT                   NEFVALAQRLMSTVSQTRNYKRGGQQGSEGSEVQSFIAGLTNKTDKKLQESRVSDAACV
FT                   LQELKDKVSDEESEVVMELLTHYSKYGVTYMYLDQLAEKLKADYEWLLRKVRDLQSKGI
FT                   VYIYTDPRLGIRVGFSKNVKETLSRCQH"
FT   gene            complement(293288..293899)
FT                   /locus_tag="ASAC_0297"
FT   CDS_pept        complement(293288..293899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18704"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q066"
FT                   /protein_id="ADL18704.1"
FT                   /translation="MATLKRITAAERGGKPGFGPWHVLEALRKISKYELGRIALSRELG
FT                   LTEASTKTLLRRLVDEGLVIKDDKGSRTSEKGLQLLSSIGDVLSPTRCSVKGVERLEDC
FT                   LTLTIDSEPPRDLTKIYEIRDYVVSEGCRLAVVGYLDPPQLGFPGLPSELESALRESVA
FT                   NVCGLSEGRRGTIIIVPSSCGPALVGAATDLLAQECGLSL"
FT   gene            complement(293868..294161)
FT                   /locus_tag="ASAC_0298"
FT   CDS_pept        complement(293868..294161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18705"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q067"
FT                   /protein_id="ADL18705.1"
FT                   /translation="MNGGRDRAIKEALLSQLKGKVPLDDVIEWLWDDFGLKAKRSWDDV
FT                   GKVITSSNEILPQDVAVFMIEEGVTPDEGAWSVLPAPKGLRGSGNIKANNGS"
FT   gene            294379..295923
FT                   /locus_tag="ASAC_0299"
FT   CDS_pept        294379..295923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0299"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18706"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q068"
FT                   /protein_id="ADL18706.1"
FT                   /translation="MPEKAALEGVKLLEKYAVIGMPKVEVSIYEDTEGRRYYEVAEPPL
FT                   NTEVRRKAYSELLSVISRNLTLLEALNASGSVEKAFNILRPYAYEVVKSIVRGQLKARG
FT                   SLDEAVTAVTYHVARDLVGYGPIEPLMRDPYIEDISCNGIGIPVFVYHTRYEWLTTNVV
FT                   MQSAQELNSLVAKLGVRSGKEPSIATPIVEGVLKREGYRVNIVLDVVSRHGSQFTIRKF
FT                   RAEPFTIVELLRLKTLDPLVAALLWIAVSSKQGVVFYGPTGSGKTTLLNAVTMLVPTEY
FT                   KIVTVEDTPEVFLPFHENWGGMVSRPSTDPRVENVTLQSQVEAALRQRPDVIIVGEIRS
FT                   REAYAFFQALATGHGGLTTVHAESADVLVKRLTSPPMNVPASLVSTAKVFVNILRVERG
FT                   GQVSRRVTRVHESRGYDPSTDSIRLGEIVVWDPEKDVWRLTKERIDLLSTVAELRLITY
FT                   DEAYEDVIRRATVLEWLAEKNADVTLLHTITRLYERDPENVYKTALKEVKRFEPPA"
FT   gene            295937..296782
FT                   /locus_tag="ASAC_0300"
FT   CDS_pept        295937..296782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18707"
FT                   /db_xref="GOA:D9Q069"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q069"
FT                   /protein_id="ADL18707.1"
FT                   /translation="MKFPLCRALLRLSPNIEYIIIGSGIAKDLDSYCRKVALPLMALMT
FT                   VALPFLAFVVLERLSPGALVEYLSLALAAASGLLLSIALSIGVPTFSYTSRADYLEAKF
FT                   HVFASTLASLLAGGQNLSEALAGLAKYEDELKEFKVEINYIKLMTSLSQDPVVILNELS
FT                   KITPSNSLKTLAESLAKGVSTGSDLLSIVSYQLETYTNYYYSLVDKVAASVGSLLEMFL
FT                   SAGMIMPILVTIMGILFSVYPIHGVSFTSLVVLAIFILMPIISAVTVVLIDDQVSKIKL
FT                   "
FT   gene            296784..297692
FT                   /locus_tag="ASAC_0301"
FT   CDS_pept        296784..297692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18708"
FT                   /db_xref="GOA:D9Q070"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q070"
FT                   /protein_id="ADL18708.1"
FT                   /translation="MIRLKLSKSKLFYATLAVAIALDEYVLVFLIIRHVTYRFFDGIPV
FT                   PLGVTSIIATDIIIFGPLLPAAIVLSRRQSVDKRLKLQSRVFLQVFPSIAASSESMAEA
FT                   LEAAASLSERPLRDYISAFSALYRATGDAESSFRKVFSKVPREVRLLLSSIVVAERSGG
FT                   RARDVLEVVSKYAAELDRMEFSLFNRLRSYSMIVYMGVAVYGAASGIGVSIARSLSQAP
FT                   VTLGASQLSATTLVAIVGFLYYALIVLSLASAYVMAKAIDDYPPKVVGNFMQLLAIGSA
FT                   TLAATLVIMHGPGAATLIALL"
FT   gene            297797..298207
FT                   /locus_tag="ASAC_0302"
FT   CDS_pept        297797..298207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18709"
FT                   /db_xref="GOA:D9Q071"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q071"
FT                   /protein_id="ADL18709.1"
FT                   /translation="MTARGISDVAAELMLILVVLAVGGAFLSYYYVTLTQYERSVGNGY
FT                   DYLQYLVPMSAWSAGDHVYATFSTGPYGVRLLNVLVNSSPASCNVTVGGVSYKLPADLP
FT                   AASMGYVSCRWSGPGLVTFVTGSGEVSVYAGP"
FT   gene            298245..300221
FT                   /locus_tag="ASAC_0303"
FT   CDS_pept        298245..300221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18710"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q072"
FT                   /protein_id="ADL18710.1"
FT                   /translation="MAVLASIAAMIYVMEQYRLRTSYAVERSQYLQLSQELQEDVKAYL
FT                   VYFNGTYVELKLYSQFPYSYQVDGLSLRLVNESPLLVSSSGGLANVTVIGPYGIIYGLP
FT                   ASAGPAQWLTIIVKLNSRLEVTQRNMVILLQSGDSMAAISVTSYVTPATQVSVNPYNST
FT                   SVQQLIGTKVVSTLISVVSPSEKIAIPKVYTIVNLTPIILYNPTGEATPKDLTVNLTIN
FT                   LNSEIVKYSSISVRDGSGLVPLANVLFAIWNGTGWDPLNGWIELYNSTEAEVWVRLDRQ
FT                   ILPYSNLTIYMLFLNGSTLGTVNWGVNSYYTQNLSTDNIAYVMQEGLLYQIYVDENGTL
FT                   YGSGGGIVEEGIGAAVSHYCNSRYGYAYSMVGFSYVGLAHFIYSLPLFNAISTFASNYS
FT                   YCVLYSGSLDQSLLYYSPTNATITFVEVSNARAERSYRPGSFTTDVINGTFISYGEPSV
FT                   SIPANEPVYDWQGYLMEGYDVEFNFQDGFEGGQPWPYGLYESQQQISWLVKSVGWADVR
FT                   GPGLTVATTTDDGTAIVIRNAPGGGLFTDWLGSWPGVSSVLLPVWATDYGQADWRSPVT
FT                   FEVPLNATVSSMGDYRVVVLYYQDIGADTYFAVFVPSISMSSNIAWYSPVFPSGGSYPY
FT                   VRAPLAPDLLLGPQSVVQGWIVG"
FT   gene            complement(300200..300574)
FT                   /locus_tag="ASAC_0304"
FT   CDS_pept        complement(300200..300574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18711"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q073"
FT                   /protein_id="ADL18711.1"
FT                   /translation="MSYEVLGGIIDVLISHINSLERSEKRIKDTESPSAIASIMLYKSW
FT                   KASLLKITAKAKETYEEAKRGNKLAASIDSCALADMVNNVLISSNPEDPVFMELRPVLT
FT                   YLKDIALASCSPDLQPTIQP"
FT   gene            complement(300676..301623)
FT                   /locus_tag="ASAC_0305"
FT   CDS_pept        complement(300676..301623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0305"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18712"
FT                   /db_xref="GOA:D9Q074"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q074"
FT                   /protein_id="ADL18712.1"
FT                   /translation="MTSPHELKGKDFLCLTDYSTEQINFLLDLSRQMKERFYAGERMLD
FT                   TLRGRSVAMIFEKPSTRTRVSLEVAAYQLGALPIMLSSSELQLGRGESIPDTARTLSRF
FT                   VDAIAARVRNHRDLEVLAQYATVPVINALSDLSHPLQALADYLTIYEKKGKFSGLKLAF
FT                   VGDGSDNMLHSLMVVGAKLGVSIYVASPASLKPNESILAAAMKDAEITGAEIKFTEKPE
FT                   EAVDGADIVYTDVWVSMGQESMAEAKRKLLAPYQVNAKLMERASSRAIFMHCLPAHRGE
FT                   EVTDDVIDGPWSVVWDEAENRLHTEKAVLAALIP"
FT   gene            301702..302166
FT                   /locus_tag="ASAC_0306"
FT   CDS_pept        301702..302166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18713"
FT                   /db_xref="GOA:D9Q075"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q075"
FT                   /protein_id="ADL18713.1"
FT                   /translation="MPPRPATGWELRQVSYLLALQFNEEVAAAITSLPLQVELRRGKIR
FT                   YVYYNGVRLMTLRPRDFTFSISPEAGKIIKRATEPPRFRVIVSSGSALEGEVTGNSVLD
FT                   ADKLIRPGDEVLIVDVNDSLLGVGKAKAPGFLMRQLGPQEVVRFRRGVED"
FT   gene            302163..302900
FT                   /locus_tag="ASAC_0307"
FT   CDS_pept        302163..302900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0307"
FT                   /product="hypothetical protein"
FT                   /note="DUF75 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18714"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q076"
FT                   /protein_id="ADL18714.1"
FT                   /translation="MRTKGISIVMRQSPESLRGSVLVAGFPGFGRIGYVVPRYLASALS
FT                   LSKVGYVLTPRLPSMIIMEDDGIGFPFELYAGNGVLALVNRAVPEPVDQNAYCSEVALW
FT                   ASQVGVKYAILVGGLSRDYEPPEEKYGYRWLHNRLYEGPKLQAPLMEEGLGVVGPLALL
FT                   HIYLEHYGVPTVMVLPYSAVDTVDYDAALVGMRVIVNELLGIKVPMDELEKLAEKQKEE
FT                   LEKISDILSQEREGKQGGTNIFM"
FT   gene            complement(302902..304449)
FT                   /locus_tag="ASAC_0308"
FT   CDS_pept        complement(302902..304449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0308"
FT                   /product="7-cyano-7-deazaguanine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18715"
FT                   /db_xref="GOA:D9Q077"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004804"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q077"
FT                   /protein_id="ADL18715.1"
FT                   /translation="MPNVFRIKDFELAGRIGVLETASGRVETPAFFPVVDPLRQEIDLQ
FT                   EIKEAGFNQVITNAYLLYRRFGDKAREMGVHRILGFDGVIMTDSGAYQMLEYGSIDIDQ
FT                   RTVVSFEKDIKSDIAVILDHPTGDVSRRLAEQSVINTLNNAREAISYLDLETSKTIWVL
FT                   PIQGGKYLDLVAKSASESADLPYPMYGIGSPTVFMEKYNYKVVVDMIGAAKRFLRPERP
FT                   VHLFGAGHPLMFPFAVALGVDTFDSASYMLYARDDRYITDYGTVKLQELEYFPCSCPVC
FT                   RKYTPKDLLEMPPEQRRKLLAIHNLYAIKRSIERVKQSIREGRLWELLVEVSHYRPEMR
FT                   EALRAISKYYRYMESFTPTSKGGLRGARLFSIESTWNPRIIRLRTWVLLRYRPPFNLVR
FT                   LAPLLSRSGMCQQSKADGLSLVYYIPYLGAVPEEICGAYPTAQFSYGEPVPDDVIRDLV
FT                   NFLRALVIRLKREGHDIIIEATPKKRWSLEIGQEMQRMGLKVLWARDLKGEPKARNS"
FT   gene            complement(304449..304898)
FT                   /locus_tag="ASAC_0309"
FT   CDS_pept        complement(304449..304898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0309"
FT                   /product="Like-Sm ribonucleoprotein, core"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18716"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR028277"
FT                   /db_xref="InterPro:IPR037156"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q078"
FT                   /protein_id="ADL18716.1"
FT                   /translation="MSIATEPARRFTAKLNSLIDHVVIVTTSDGKTYTGKLTGFDPSTL
FT                   SVVIEEAKDSSGNQWPIIIISGSRLAEIKVGESEVFNAKEFMEFLLRFGNIDRSQVKVY
FT                   EDANVVEVSRTIRVSKNGVEGSGPLAQKVNTLFREYLRTKGVVIS"
FT   gene            304975..305436
FT                   /locus_tag="ASAC_0310"
FT   CDS_pept        304975..305436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18717"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q079"
FT                   /protein_id="ADL18717.1"
FT                   /translation="MASRPIFSASYRVYWSETDAACWMHFSNYFRVCERTEEEFLARLG
FT                   FTQDSHPGKRLIMPRVSAKCDYKSPLGPGDSYRVDITGIIIGRSSLTYEYEIYNETTNR
FT                   LAAKCTIVTVAYDENLRGSVELPRELKEKLLAAGARLRDEVNDSIKATG"
FT   gene            complement(305433..306350)
FT                   /locus_tag="ASAC_0311"
FT   CDS_pept        complement(305433..306350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0311"
FT                   /product="carbamate kinase-like carbamoyl phosphate
FT                   synthetase"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18718"
FT                   /db_xref="GOA:D9Q080"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q080"
FT                   /protein_id="ADL18718.1"
FT                   /translation="MRIVIALGGNAILRKGEKGSPEEQWSNVRRTASLIAKTFQQDEII
FT                   ITHGNGPQVGYLLEVMNMAKGYPSQSMDLADAMTQGWLGFMLQMALEEAFQGRRRAVAI
FT                   ITRTLVDANDPSFKNPTKFVGAYFSEAEAKRLSSEYGWTFKQDPRGGYRRVVPSPEPLD
FT                   ILESDLIEELAREGMVVISAGGGGIPVMRTPEGLRPVEAVVDKDLASSLLAVKLKADLF
FT                   IILTDVRGVAIGFGKPNERWLDEVSADELEEYYRKGEFPPGSMGPKVLAALRFVRSTKK
FT                   IAMIGSLDELPEVVRGSSGTRIRP"
FT   gene            complement(306378..307133)
FT                   /locus_tag="ASAC_0312"
FT   CDS_pept        complement(306378..307133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0312"
FT                   /product="Purine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18719"
FT                   /db_xref="GOA:D9Q081"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q081"
FT                   /protein_id="ADL18719.1"
FT                   /translation="MPTTRVKLLAALRDLAGGAQEVLVEGSSWTDVLKKLLSQYPGLSS
FT                   VLSQDGTPRPGFLVFVDGVDSRLLDRSRQAKEIVVLPVNHGGDDRFQWITWSQIDEAVE
FT                   RIAEKINSSGFRPDAIVCIMRGGLIPGRLLADRLGVEDIGTLEVKLYISPGQRGERPFL
FT                   RQPLTLPIKDKKVLLVDDVSDSGLTLQFSVQALSLYMPTEIRTAALYIKPWTKLVPDYY
FT                   ADQVSKWIVFPWEVSEFKREVNGQESSNT"
FT   gene            complement(307150..307377)
FT                   /locus_tag="ASAC_0313"
FT   CDS_pept        complement(307150..307377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0313"
FT                   /product="30S ribosomal protein S17e"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18720"
FT                   /db_xref="GOA:D9Q082"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q082"
FT                   /protein_id="ADL18720.1"
FT                   /translation="MGKVRTTLVKRTARELLAKYPNLFTESFENNKKVVSQLTYWSSKK
FT                   LRNQVAGYITSLVRINKERQKRLSEETKTS"
FT   gene            307507..309189
FT                   /locus_tag="ASAC_0314"
FT   CDS_pept        307507..309189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0314"
FT                   /product="Thermosome subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18721"
FT                   /db_xref="GOA:D9Q083"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q083"
FT                   /protein_id="ADL18721.1"
FT                   /translation="MASQLETMGVPVIILKEGTQRTAGREALRNNMMAAIAVSEILKTT
FT                   YGPKGMDKMLVDSLGDVTITNDGATILDKMDIQHPAGKMLVQAAKGQDEEAGDGTKTSV
FT                   IFAGELLRQAEDLIDRNIHPTIIIQGYKSAVDKAIEVLNSIAEPVSIDDTDKLMKVAMT
FT                   SLNSKAVGEAREYFAKIVVDAARAVAEKRGDSWYVDINNVQIVKKHGGALTDTQLVNGI
FT                   VIDKEVVHPDMPKRVEHAKIAVLDAPLEIQKPEIDMEISISSPDAIKRLLDKQEKILQD
FT                   KVEKIAATGANVVITQKGIDDVAQHFLAKKGILAVRRVKRSDIEKIARATGAKIVTNLD
FT                   DLKPEDLGYADLVEERKVGEDKMVFIEGAKNPRSVTILIRAGFERMVDEAERAIHDALS
FT                   AVADAIMDGKVVAGGGAVEAEVAKALREWSKGVPGKMQLAVEAFVKALEALPQTLATNA
FT                   GYDPIDILMKLRSAHSDPSKKWYGIDLNTGNIVDMWANGVVEPLRVKVNAYKAGTEAAT
FT                   LILRIDDMVAAKKSSTGPSSGKKEGGEEEESSSSTSSTSSLSD"
FT   gene            309382..310443
FT                   /locus_tag="ASAC_0315"
FT   CDS_pept        309382..310443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0315"
FT                   /product="Glycerol-1-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.261"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18722"
FT                   /db_xref="GOA:D9Q084"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q084"
FT                   /protein_id="ADL18722.1"
FT                   /translation="MEQHIIELPKRIVVGEGALKSLGGHFRDMFPSGSLVFVVTGPHII
FT                   NSLYNDVKQILEDNGFSVTYTIAGPATVDEANRVAEEAKRDRADVLLGLGGGRSIDLAK
FT                   YAAAESGKEFVSVPTAPSHDGITSPFATLRGFERPYSKLAKPPRLLLLDIDVISSAPKR
FT                   LASAGFGDLIGKYTAVLDWRLAHNLRGEYYGAYAASLALMSARHVGAYARKIGLGSKDG
FT                   IRALVEALVSSGVAMCIAGSSRPASGSEHLFAHALEMISKRPPLHGEAVGVGTILMSYL
FT                   YGKDWVRIRRLLKEAGAPVNARELGVTDDEVIEALVKAASIRPERYTILGEKGLTRDAA
FT                   EELATKTKVINGD"
FT   gene            310546..311184
FT                   /locus_tag="ASAC_0316"
FT   CDS_pept        310546..311184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0316"
FT                   /product="proteasome beta subunit precursor"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18723"
FT                   /db_xref="GOA:D9Q085"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q085"
FT                   /protein_id="ADL18723.1"
FT                   /translation="MKKVFSYDALNRYGRGWHGTTTVGLIAGDYVVLAADKRATAGTLI
FT                   ASRTVKKIVKLTDYAAMTISGLVADAQALADAVREEARYYELDRGKRLSVYGMATLLAN
FT                   ILSSSKYFPYLVQLIVGGYDTAPHLYAIDPYGGVTEEKVTSTGSGSPVALGVLERGYKE
FT                   GISLDDAVNLAAEAIRSAILRDSATGDGIDVTIIGRSTYQEKFIPFQPR"
FT   gene            311227..313251
FT                   /locus_tag="ASAC_0317"
FT   CDS_pept        311227..313251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0317"
FT                   /product="Putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18724"
FT                   /db_xref="GOA:D9Q086"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q086"
FT                   /protein_id="ADL18724.1"
FT                   /translation="MESQSQPGEERRLISGLELRRRIVEEIYKNLGSAEIAKIEFEGPE
FT                   IAIYVKNPKWMLEGEEKVKELAKLLRKRIVVRSDPKARATREATIKYILENAPQDVTID
FT                   PSDIQFDEVLGEVRVLTDKPGKLIGKGKTFRNQVLAATGWRLEVQRKPPLVSKTLASLN
FT                   TLYLMASGERRHALREIGERIYRDMISGPRYVRITGLGSFGEVGRSCILIDTSESKILL
FT                   DVGFAQSGFGPDAYPMFDAPELRLDELDAVVISHAHMDHVGLAPMLYKYGYRGPIYMTP
FT                   ATRDIATLMLQDFINLYIREGKEPPYTQKDLITMLNHTITVNYDVVTDLSPDAKLTFSD
FT                   AGHILGSALVHIHIGQGLYNILYTGDLKYYSVRDNKALRLQPPANTEFHRIETLIMEST
FT                   YGATETPTREEAEQQLMDLINRTYKRGGKVLLPVMAVGRSQDMMVLLNKAMQEKKIPEM
FT                   PIYIDGLIYEVTAIYTAYPELLSKEIRDQILNEGANPFIGPQMVFVNDQSKRDEAIYSQ
FT                   GPAIIISTSGMMTGGPILEYFKALAGDQKNSLVFVSYQAAGTLGRRIVEGEREVQLEDE
FT                   NRLKTYKVNLEVARIEGFSGHANRSELLAFLRRLAPKPRTIILNHGEPAGLSALASTIK
FT                   GRWDKLGFDASPEVVVPENLETIRVYPRSSKLHNALLYS"
FT   gene            313261..314496
FT                   /locus_tag="ASAC_0318"
FT   CDS_pept        313261..314496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0318"
FT                   /product="hypothetical protein"
FT                   /note="DUF650 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18725"
FT                   /db_xref="GOA:D9Q087"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q087"
FT                   /protein_id="ADL18725.1"
FT                   /translation="MPSIPPELCARCKGYKLLCGLPRCPILERFRVQVNAVQRINGKDV
FT                   VGSTPPSVLVGEYGYPKVSFYYMVPPGKSSDEAAYYDAPKLWAERRETLGNIVKLRGEM
FT                   VSAYVRLDVNEPWRLYETELGLASLSERPVESDVLLKSLPLPQLKFDGMTKPMGPRAPA
FT                   EKVIVSGAPKLQRKAEEAIWDDAKAEDIIWELYQAGVDVYKIQDMLSLGFLGRLRARKL
FT                   VPTRWAITAVDDIISRRLRREVRDFRSVDSVEAREAEYLGNRFLVILMPGEGTFEWIEV
FT                   WHPRGLWTQQAERPIVERVEEDPLGRASAMDGGFSAARLAVLEGLRSSAKKADVVILRE
FT                   ILPTYYAPVGNWHIRETVRRAMSSESKVFDSVQAAAEYAASWLRASPQDVLAQSSLLGF
FT                   RARQRRLTDFLR"
FT   gene            314584..315060
FT                   /locus_tag="ASAC_0319"
FT   CDS_pept        314584..315060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0319"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18726"
FT                   /db_xref="GOA:D9Q088"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q088"
FT                   /protein_id="ADL18726.1"
FT                   /translation="MLAMAEDEWVKSKLQEVLEKISSEDKRITPQRVLLTKLILSKVKE
FT                   HASLKELFDAAQEELPRVGISTVYNTIKMLESMGIVDTFIVNDKLRIDQPIPHINVYCL
FT                   DSDKIFDVDGDVASTVMDSLKSKGLNVKKIVVEAYCSGEKKEDRGPGDSISNLI"
FT   gene            315216..316205
FT                   /locus_tag="ASAC_0320"
FT   CDS_pept        315216..316205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0320"
FT                   /product="Thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18727"
FT                   /db_xref="GOA:D9Q089"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q089"
FT                   /protein_id="ADL18727.1"
FT                   /translation="MTSVFQALPMHANPLGMLFGGIMEDWMVQVSSMEATRIARRPTLL
FT                   ASLESLYFLSPVLVGENAIITAWVDYVGNSSIDLSLLVEAENPIMNEKRLTTLAHMTYV
FT                   AVGRDLRPVPVGVCIEPRTPEEEALYEDAIKRRKAREERIKDRRQRVFDTSPPRGLLDK
FT                   YTVVTNKVVMPEDVMQINTLFAGRLMRLLDEVTALVATRYARGPVVTASVDSTDFYTPI
FT                   LLGETIVAYSTLTYVGKSSMEVMAKVIKRDEITGEERHTTTSYFTLVHVGPTGRSEPVE
FT                   PFTPTEDWQKKLMAEAEERRSLRLEGLQAFRDNAEKVRELLAQKGLAP"
FT   gene            complement(316208..317401)
FT                   /locus_tag="ASAC_0321"
FT   CDS_pept        complement(316208..317401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0321"
FT                   /product="Putative 3-ketoacyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18728"
FT                   /db_xref="GOA:D9Q090"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q090"
FT                   /protein_id="ADL18728.1"
FT                   /translation="MPKLKQNVYIVDGVRTPVGKFGGAYKDIPAVDLASFTLKEVLERA
FT                   GLKPSDLDMLIYGHVIRAGTGMDSARQVAIKSGVPYHIDSMTVDMVCASGMAAIITAAN
FT                   YIASGSYNVIAAGGMESMSMAPFIIQSSARWGMKHLIGREWQILDAMVYDGLWDVLLNK
FT                   VMGEEADMTAAEYNAPRDELDRISYESHERAAKAWDGNLMKDFVVPYEKNGKVVLDHDE
FT                   GIRRDTSIEKLKSLPYAFTSRGPHTAGSSSQLSDGAATLLIASEEAVKSLGLKPIARIV
FT                   GFAYHGVETWRFPAAPVGAVKKLLDDVGWTIDMVDYWENNEAFAVNSYIMHKELGIPYD
FT                   RMNVHGGAIAVGHPLGMSGARITLELINVLRRHGGKRGVASICHGLGGAASIAIELV"
FT   gene            317560..318531
FT                   /locus_tag="ASAC_0322"
FT   CDS_pept        317560..318531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0322"
FT                   /product="Putative methylcobalamin:homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18729"
FT                   /db_xref="GOA:D9Q091"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q091"
FT                   /protein_id="ADL18729.1"
FT                   /translation="MVLGGFPRTREARHALRDMERGAGSQVSIEWNVTAEEAAVIGVQE
FT                   ALGFRYVVDGMVDWHDIFRPFVNAWRNVAVSGLLRYFDNNFFYRVPVFTDRPDPDHFVW
FT                   PPRIRAFSNIAEPSPLKAVIPGPLTFLLMSKNASELSKEDLAESIASALAMEAQAAEEA
FT                   GAALIQIDEPYMTDQELSRDDAILGVELINSIVSRLKVPTVVSLYFDVAREDVYEALLN
FT                   IKATYISIDVADAPTRALSLIAKKGLGGHKPILGVIDARRIESDDFNKIKDWALQVSKE
FT                   AGDEEIGLTTTTWFDVIPYTYSLRKAYLLSTITERLGEVMSQ"
FT   gene            318528..319520
FT                   /locus_tag="ASAC_0323"
FT   CDS_pept        318528..319520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0323"
FT                   /product="Probable methylcobalamin:homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18730"
FT                   /db_xref="GOA:D9Q092"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR022921"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q092"
FT                   /protein_id="ADL18730.1"
FT                   /translation="MSYQVPSKFPTTVIGSYPKLPEASELIKRRDRGEISEEEFHRLIR
FT                   GPIAEVVKDYLEAGIDIVSDGEQSREDMVVYFAQRVQGYEEGEWVRIYDNMYFRKPIIK
FT                   GPLIRTSPLAIEDWLYTSSISGGRPVKFIITGPYTMMEWSFNVYYKDRSELIMALAKVI
FT                   REEVLDAVRAGAKYIQVDEPALSTRPWREEAELAGEALRYVFSGIEAKRVVHICYGRLE
FT                   RILPYILDYPVDQFALEFKNSNFRLLPYLKEYGYNKELGYGVVDVHSMQVETVKEVKEA
FT                   IEKLMKLDVLPPEKVYINPDCGLKPLPREVAKAKLVNMVKAASEARSEW"
FT   gene            319514..320578
FT                   /locus_tag="ASAC_0324"
FT   CDS_pept        319514..320578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0324"
FT                   /product="Putative hydrogenase expression/formation protein
FT                   HypE"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18731"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q093"
FT                   /protein_id="ADL18731.1"
FT                   /translation="MVDDYSIRLYEGGWTGKLPQEILEQIVLSRVRGLTWASTLMGPAI
FT                   GEDAALIDLGSCVMAVHSDPITESHFSVGSLAVDVASNDIAVRGVRPQWMLVDVLMPVG
FT                   SLLSSLSAVVSELSSEARRLGIEIVGGHTEASPGLKHAIVIATVMGCGRHDYIVTTAGA
FT                   KEGDIVIQVNPTAMEATAIIANDFKDLLLGAGLSESEISEASSLISRASIMNYALPLAE
FT                   RRLVTSMHDITEGGLIGATYEVAKASGHDITIYSDSVVVEDITRKIFTALKMDPLKSMG
FT                   SGSFIATVRPENKERVLELLRDLGVKSSVIGVVGGSSRTPKLIVKGKGSEQVYSSPPED
FT                   EVAKLWSRGREPND"
FT   gene            complement(321066..322715)
FT                   /locus_tag="ASAC_0325"
FT   CDS_pept        complement(321066..322715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18732"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q094"
FT                   /protein_id="ADL18732.1"
FT                   /translation="MEIKKLIDGVPRRYRPLASIPSAAIIAKLLLDAGVLRIPTGLAID
FT                   AAGAALLSSVAGVSIAIRRHNRKAPSNNMSFRIIEVVTTGTAEERAQASQLLASIVKER
FT                   AKAGRARYMVISMLQGGYSRTLIGVMNPNPSEVSIEAEILKTLISMNVKGARLSELEEV
FT                   PESLVKGLEALEPTGKGEPVIVEPSRGSLPLMPSEGQTTGLRLGVAYEGAYPKPVQLTV
FT                   DDIKGHVAIFGSTGTGKTTTLTTILEGLSSIGINFVAFDWAGEINRLVNDSLERWSPLK
FT                   DGGINPFTDKGLRSSPELLLDVLSSAMNLTQPQSYIVMRVFNDGIPRSFGELQEAIEAY
FT                   PEEARWDREVKRGLLRKVAIVASAKFSGIFNGSVDLEELEESPRIVLLDEIESYTVRRA
FT                   YSLIMLAAMFSHRNRTKPVVAAIDEAHNLFSDDNDLLGHIMAESRKYGLYIALATQSPS
FT                   AVPNDVLLNANTKIVHALRSLRDKEVVVQSMNLSHDMINLLDKLQPGEAIVQSPTIVNP
FT                   ILVKVQLRAPLRDGVSNGRVGEPVNVNASPPL"
FT   gene            322840..323793
FT                   /locus_tag="ASAC_0326"
FT   CDS_pept        322840..323793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18733"
FT                   /db_xref="GOA:D9Q095"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q095"
FT                   /protein_id="ADL18733.1"
FT                   /translation="MPVAFECSSTDKLASLDDVKGEATAGLRKVIELTGSVDLNAIYSG
FT                   HELIGRSYDLYVFKLISGASEVGQLRVVVRKSLFINLTGVLFTNGLALMPPEGELLKRG
FT                   EVKEGEVLSQVMTSKECTAAELPPGQVAIPKFVIYSAEGEIPRIERGSWKLVLVGPDGS
FT                   SVELGLADIMSEARDLGPEDFHCVTGWSVKGRRYLGVPLRDLFRKLDSLEGAKWVYSWS
FT                   HSGYTSVMPIDVAVESAALVVGMDGKALPDENGGPARIFSPLLYGWKGTKWVSMIELLR
FT                   DYEDGYWEALAYHERGLVSHNERFKLRNPSLVDLCW"
FT   gene            complement(323924..324487)
FT                   /locus_tag="ASAC_0327"
FT   CDS_pept        complement(323924..324487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18734"
FT                   /db_xref="GOA:D9Q096"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q096"
FT                   /protein_id="ADL18734.1"
FT                   /translation="MNRHDLFRRHLMSPVDVSLLEPLRLQPGMTVVDLGSGPGRFTIPV
FT                   AKIVAPGKVYAVDIDKESLRIVAEKASEEGLSNVEVVEADATQGVGLPDNVADVVIMAN
FT                   VLHDFIHEGVSQAVLRTAVRLLKRGGRLAVYEFKKGSLSFGPPQWLRVDPEKVIEELRA
FT                   AGLASIDVIQNVNETHYLVIGVKP"
FT   gene            324582..325016
FT                   /locus_tag="ASAC_0328"
FT   CDS_pept        324582..325016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18735"
FT                   /db_xref="GOA:D9Q097"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q097"
FT                   /protein_id="ADL18735.1"
FT                   /translation="MSNTDAGSELQHEFIRKLEIAMLGVLSIISLLIGYMVGLVAARAF
FT                   SDSSIVVSLLLYLLLLAFYPRYRFPFLAYMVGADIGSLVFDIAVLHAKVVIYPLVVLLV
FT                   NDLGKFSVNIDFVQLLVLLEVIVYIARKLHKARNRKMEAS"
FT   gene            complement(325024..325212)
FT                   /locus_tag="ASAC_0329"
FT   CDS_pept        complement(325024..325212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18736"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q098"
FT                   /protein_id="ADL18736.1"
FT                   /translation="MREKSLESSLTFKLAEANISIRNEVIRLAGLAALCRHFEPELSEK
FT                   ISNEVLNPLLSKYLSIE"
FT   gene            325542..326951
FT                   /locus_tag="ASAC_0330"
FT   CDS_pept        325542..326951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0330"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18737"
FT                   /db_xref="GOA:D9Q099"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q099"
FT                   /protein_id="ADL18737.1"
FT                   /translation="MTTSERTTATTGGQLSRKLGLLDLVFLSFGGQAALLSLLTYATGV
FT                   VSYTGVFAPVVIIIGTLLVLLNAAVVYGLSKRYGEAGGYYIYAFYSLTRRLGLETGWLY
FT                   IMYSVIYGSAYFLGAAYVLRYAIHLDPFLAAIIIYIPAATFLVLGIRPSAKYAEIASII
FT                   ELAALIYISLVNLTIAGFRFYNPFSLKSIPSSSLLAAGMLFAIGIPTGYGSITPLGGEA
FT                   IRKEYIGKAAIIVVIVGGLLASMVIYSLLDASLATGQINFILTARIPVIDFMRKFYGDL
FT                   YAIPLVFAAFNDGVLAPLSFMAATSRTLYAMAKNGMLHRGLAVIRGDHPFNAVIATVII
FT                   YGMVTFPALALYERPFALFLVYGSLAGLANLFVHVSANFSYILEGFRGLRRAMTFNSLK
FT                   SFNWIFRKFTDILIGFSASIISLWAMTLSFMSKNLQLEVDIFIVWIIIGFIYAEVLDEL
FT                   KSIRSSELPQG"
FT   gene            327011..328144
FT                   /locus_tag="ASAC_0331"
FT   CDS_pept        327011..328144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0331"
FT                   /product="isopentenyl pyrophosphate isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18738"
FT                   /db_xref="GOA:D9Q0A0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A0"
FT                   /protein_id="ADL18738.1"
FT                   /translation="MTFTSARKLEHIDIVRKGGVEPQETTLLEYVRIVHRSLPEANLED
FT                   IDLSVKLCGRELGAPLIITGMTGGHPDVEPINAAIAEVAEKFGIAMGVGSQRAAIEDSS
FT                   MIHTFSVVRERAPHAFIVANLGGAQLAKGYGVKEALKAVEMIRADAIAIHLNIGQELFQ
FT                   DEGDTKFSGVLEKVAELVEEMPVPVIVKEVGTGLSAEDISALRSVGVKCFDVAGLGGTN
FT                   WIKIEALRSKAKHGAPLRDPASIADLWGNPTAIAIVEARNAAPDAYIIGSGGLRDGHDV
FT                   AKAIALGADVGGFAAPALRALSAGREGLERYVSQILYQLKAAMLMSGSKRPQDLWLAGI
FT                   TIWGRLKDELESRGINIGSYLNSRAMTLLWRRRDNDI"
FT   gene            328134..329150
FT                   /locus_tag="ASAC_0332"
FT   CDS_pept        328134..329150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0332"
FT                   /product="Farnesylgeranyl diphosphate synthase"
FT                   /EC_number="2.5.1.1"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18739"
FT                   /db_xref="GOA:D9Q0A1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A1"
FT                   /protein_id="ADL18739.1"
FT                   /translation="MTFDDMNELVEKYVPLVNSDIYDVVKGAPEELYNASLHLIKAGGK
FT                   RLRPLVVLATARALGGVDAEARAIPLASAVEIFHNFTLVHDDIMDNDDFRRGVPTVHKV
FT                   YGVPLAITAGDLMFSLSFASILRSLEKGLDEEYVIKAVQALTEASRKVAEGQGYDMLFE
FT                   RSWNVDAEDYLRMIYLKTGALVEASAKLGAIAAKAKDEVIETMGEYGRLVGLAFQIRDD
FT                   ILGVFGDPSKTGKPVYSDLRRGKKTILALKAASSNEKVKELLIDIFNGDSSEEKLKEAA
FT                   EAIKSTGALDYAQGLANSYSRLAVEKLDMLKASGLIVDEKAYRALRDLAVFSAQREK"
FT   gene            329153..330883
FT                   /locus_tag="ASAC_0333"
FT   CDS_pept        329153..330883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0333"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18740"
FT                   /db_xref="GOA:D9Q0A2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A2"
FT                   /protein_id="ADL18740.1"
FT                   /translation="MSLDELRSLIYRVTLRNAVQHGGKAMINSVMSTLIAEHPELRQRA
FT                   RELAPIVKEMVDKVNSMSAEEQRDTLAREFGEAVEEGQKKPKPEQKVLPPLPNAQEGKV
FT                   VTRFAPNPDFAIHIGNARPAILSYEYARMYKGKMVLRFEDTDPRTKTPMKEAYEMIRED
FT                   LRWLGVRWDEEYIQSLRMEIFYSTMKEALSKGCAYVDLGGEESKKLISEGKPPEYRDKP
FT                   PEWQLEQFDRMLSGHYKEGEAVVRFKTNVNDPNPSLRDWVAFRIIDTDAHPHPLTGDKY
FT                   IVWPTYNFAVSVDDHLMGITHVLRGKEHQLNTLKQGYVYKCFKWPEPTYIHFGRLKLEG
FT                   FIMSKSYIKKIMSDRPGEFMGLDDPRFGTIAGLRRRGILPESIRDVILDVGVRPGDAKL
FT                   SWANLAAVNRKRLDPIADRLMFVELTGGRGIRMRLSQPDCYVAKIPLHPNRPQAVREIK
FT                   VCDGDYIYVPSEDAKAPMVRLAGLGNYAVNANDGLLEFKNDSLEEARKGGYPIIQWVPE
FT                   ASSVRLTVLEPDGLNLIKHDGLAEGYINNYGKGSRLQFIRYGFVIIDSVNPLVAILTHT
FT                   "
FT   gene            complement(330901..332223)
FT                   /locus_tag="ASAC_0334"
FT   CDS_pept        complement(330901..332223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0334"
FT                   /product="Trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18741"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A3"
FT                   /protein_id="ADL18741.1"
FT                   /translation="MTECSSSILKWYTSRPWMLSCDSVAYYCEPIEGGLALTVEGCGEK
FT                   AFAPISMLPDGSLLELDSSATWLNSILSSSTAAFQSSCRGLRKIRELKIVSSGLRSISY
FT                   EAVDEGGERLLIKALRRLESDNIEHLVLRYLTFVNYKWVPKFICNLTYESSPYIIITSF
FT                   IDGFPAATTYVNDASNRSTANVNSIGPKIGLAISELHNVMMTCSESWCRPEPITDADIR
FT                   RWLERISWRSSWLRDKGSRMLPYSDRPLVYEAADSLEELVSSLEPLAEKLLGRTKLRIH
FT                   GDLHLYQIVESQKGDIYITDFEGEPYKMPASKLEKEPAVRDLAALARSIDYAAMMGEQL
FT                   RTGASLLQVSSWPPEELLRWEKEAFRSILESYVRNAESKGLSNLLDGLSSLFFWLVERA
FT                   SYESVYEIIARTGYHYVPLNAIIRYKEGFDELAKYVKEFSS"
FT   gene            complement(332295..334133)
FT                   /locus_tag="ASAC_0335"
FT   CDS_pept        complement(332295..334133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0335"
FT                   /product="Glucoamylase"
FT                   /EC_number="3.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18742"
FT                   /db_xref="GOA:D9Q0A4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A4"
FT                   /protein_id="ADL18742.1"
FT                   /translation="MVSNGTIAALYDGNFYIRSIYYPMLDQHHNHSVNGAFKIGLWKDG
FT                   QMLWLENVDKSIEMDNLIARAIFRLSDATVELTSLASQTRPAIITKVSIKGEGLFRFIQ
FT                   YNDFRLNNSELGDTALYDPRLDAVIHYKGSTWFAVTSSHKLYEYTTGRRDQGAVLGDCQ
FT                   DGVLNKNPIAQGSVDSAVSIAAKEFYLYIVAGRSYNDLVESLKDLRASPGEHFERDSRY
FT                   WSVLTEPVKNVKLLKQSVAVLIGHMGNNGEVPASLDTSILKFNLDTYAYTWPRDAVHVA
FT                   IALDSMGYWSFTRRFYEKLFTELMTPEGYLYQKYNADGTFGSTWHPWTSETEISKNIQE
FT                   DETALAVYGFWYHIVTSNDYFLLREVYENLEKATEFMASFINGKLSLPLMSYDLWEERL
FT                   GVHAYTVAAVYAAMKSAADIARRLGVWSKEDKWRRLAKAIQNGFREHMFNRDGGHFYRM
FT                   IVIDKDRVVSVDKTVDSSILAAGLLGLVEPSDPMFESTVKVVRDKLWVSRVGGLARYEN
FT                   DYYQRITGDYTGIPGNPWIITTMWLAQSYILQSDFDSAKQLMTWVEGVASPTGMLPEQV
FT                   SPFDSAPLSVMPLAWSHAEYIKTYFMLGGKSLLPPG"
FT   gene            complement(334308..335126)
FT                   /locus_tag="ASAC_0336"
FT   CDS_pept        complement(334308..335126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18743"
FT                   /db_xref="GOA:D9Q0A5"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A5"
FT                   /protein_id="ADL18743.1"
FT                   /translation="MPVKRIGFRGVLKRILIKSPQGMFAFDAKINVYVDISSDRKGAHL
FT                   SRNVDAMQILDSFPQESWSLEGLAESIHDQLLNLHSYSDSAGVELYTTYWARAVFEDIE
FT                   SLEPVRVKVAVTGGRYKKTFLTSVSVKGFTVCPSAQRTIADMFNYSSTAPSHSQKVMLK
FT                   GSIISHKLHIISVDDIASALWASLSAPAFTLLKRPQEAKLVFGAHRNPRFAEDAVREAV
FT                   RRLRCLVGESLPKDTVLRAEIYSLESIHPHNVFAVAEGKVEELPKMGCGV"
FT   gene            complement(335134..336810)
FT                   /locus_tag="ASAC_0337"
FT   CDS_pept        complement(335134..336810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0337"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18744"
FT                   /db_xref="GOA:D9Q0A6"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A6"
FT                   /protein_id="ADL18744.1"
FT                   /translation="MVTLRFRPERLVETTGLDLDIVEEALFRLKCETELNDNYLSVEIN
FT                   PDRPDMFISEGIARAVRGIESIELGWTPLDGKLRDSGLELVNEMPETRPYIAAAVVYNV
FT                   NVDSESFLEELVQFQEKLHDTVGRRRRKVAIGFHDLAKVKSKRLRYSMIPLKSSMVPLG
FT                   GSETMSIAEVLRSTEQGVKYGNISLAEGLHPAFTEDGGAVLSLPPVINSELTRVEVGTR
FT                   DLLIDVTGTDLASVLKVLDIITLNLAERRGTYIGFVRVVPRTGEPLHTPVLKSRELSLD
FT                   INYVNRVLGTDLTVDEVTLSLLKMRHSASPENGHVKVTIPPFRYDIISEIDLVEDIAMA
FT                   LGYDSPKLLPSKYMNDARGSLLDHTLLSRAARDIMAGLGFTEVMSYILTSSSLLRLFDM
FT                   ISDTVELKNPVQEELDALRPSLVPQLLQLMFFNVSKTKPVNIFEIGKTVKKIGSEAVED
FT                   LKLAAATMDDSVSYEDIQAVAYAFIRSFGLKPSAKPLTASWLLAGRSASLLANGHEIGV
FT                   IGEINPVILDKLNVTYPVAVFELSLTELLKVIRAGAAGQKP"
FT   gene            complement(336815..338260)
FT                   /locus_tag="ASAC_0338"
FT   CDS_pept        complement(336815..338260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0338"
FT                   /product="phenylalanyl-tRNA synthetase subunit alpha"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18745"
FT                   /db_xref="GOA:D9Q0A7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A7"
FT                   /protein_id="ADL18745.1"
FT                   /translation="MAAEQLSPGELELLKKLASLGEPLDLEKSEELIGMPTSSAASLAS
FT                   LLEAKGLVKVDRRTVTRILLTERGEEALRNGLPEERLLELLEANNGSVAVDLARSSLGN
FT                   DFNIAIGVAIKAGYVKIANGMITLVDHEGFKASVVNLKGGLRSIKEGGLVSEKIVDVLK
FT                   GRGLVKVEQKNLVSIRLLPQGLSLATAKPSIAKLSHELIATGKWREYTLRPYDVSAEPP
FT                   LRMPARKHFFAEFIEELKDLMKEMGFVEVSGPLVELELFNFDALFQPQDHPAREMHDTF
FT                   WPDLPPADLSDYADIVARVKYEHEHGWGYQWDGSVASRRILRSQTTAVTIRVLASRPRP
FT                   PIRFFTIDKVFRADPVDATHLSDFHQLDGIMGWKDFTFRDLLGFLSEFGKRLGLELKFK
FT                   PAYFPFTEPSVEGYARIGSSMVEVFGAGLFRPEVLRIAGVDYQVGAWGMGVERLALARF
FT                   GLHDVRDLYSKDYDFLRSFKVEV"
FT   gene            338369..339301
FT                   /locus_tag="ASAC_0339"
FT   CDS_pept        338369..339301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18746"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A8"
FT                   /protein_id="ADL18746.1"
FT                   /translation="MITVGATRAILRLVKQRIGEPALRKVEPPKGFLFVTSQESVDIVT
FT                   YPASLDYLLVQPEGYSDVFKYTSELKIAQEPWQSYCQWHNGPLDEADDPLKRLYCPVAA
FT                   EGFCSKHRRSERAIYTLCLDSRSEKALEACKYIDSVVKGEYVVYMLDYGGDKPKVGATR
FT                   KFRLLERIAEQPHVVATVIMEVDSLLAARKAEMRISSSGIAVESWRHKLLNAQDHYFAS
FT                   LRLSEAASKASKLLGVQWDNKLFSIVSQDFISMRPRVVDAESLVDKSLIPWASWGGFIM
FT                   FKDSGGSLVAVKSSQLMHKNSLIVDLGST"
FT   gene            complement(339294..339986)
FT                   /locus_tag="ASAC_0340"
FT   CDS_pept        complement(339294..339986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0340"
FT                   /product="purine and other phosphorylases, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18747"
FT                   /db_xref="GOA:D9Q0A9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0A9"
FT                   /protein_id="ADL18747.1"
FT                   /translation="MPYHIKAERVPEGVLITGDPLRADRFASLLERPRLINDNRGLRTY
FT                   VGFYKDKEVAIAAHGMGGPSVAIVVEELISIGAKRIIRVGTAGAISPELRPGDVLVADA
FT                   ASSTYGGAGLGLYFGSICPPSSPDLELTYRLLQELSKLGVKATKGAVFSSDSFYAESNV
FT                   LGLLKSLGFKAVEMECATVTALSRIRGVSAACALVISNSAGSLQSDQALVDKGLMSAAA
FT                   ASLEVLIR"
FT   gene            complement(339987..341888)
FT                   /locus_tag="ASAC_0341"
FT   CDS_pept        complement(339987..341888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0341"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18748"
FT                   /db_xref="GOA:D9Q0B0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B0"
FT                   /protein_id="ADL18748.1"
FT                   /translation="MTRAIVSSSEILSDMLGVDQLVAFRDLMEPVKEEYGDSSFPSIRY
FT                   SKDPDEVAKILASRLASDYNIHYVDVKNLKGFTNLTFRCGDLVKAVVEWAKNGEELEVP
FT                   KTSRPLKIVVEHTSANPIHPLHIGHTRNACIGDSLARLLKSRGHSVVTRFYIDDVGRQV
FT                   SIAALGVKLLGIDVLKESQRLSIKPDSLVGWIYAVTSTTIDLLNAKKAGNSEEAEKLAS
FT                   TLARLKSQDPGNFFDKLYTALSSLENPDAAVADLNNRYEKGLEPEKTLIRSMVQAVLEG
FT                   FKQSLEILGVSFDFWDWESDLVWSGLVGRLVEEAKGSRYFIKYKDADAIDVPQIISEEI
FT                   QHDKEALSSIRLPKGFSLPPLILLRSDGTTLYTTRDLAYSILKFSQANADKVINVIGAD
FT                   QRLPQLQLRVALYGLGHRREALNLIHYDYEIVRLTTGSMHGRRGEYVTLDSLLTELSTR
FT                   ALKEVTERNPSMSKEEAMVIARSISVGAIRYFMVHMSASKPLTFSVDKAMNLRESSGPY
FT                   LQYTYVRAVNILEKHGKVDLNSVDPDKCTEPRRRLLVKALKTPLVIAKAADDLAPEDLV
FT                   SHLADLADSFNTWYEQDSVIREPDVGAKELKALIVDIVRQSLGIGMSVLGIPTLRRM"
FT   gene            complement(341936..343459)
FT                   /locus_tag="ASAC_0342"
FT   CDS_pept        complement(341936..343459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18749"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B1"
FT                   /protein_id="ADL18749.1"
FT                   /translation="MFLRSQGKGVSISEELTAIYLAEAYFNLSDRADYDDIMTIILAAL
FT                   AKDDESEALIKEYLSGLPAWHDNFDNNLRKRGCKDHNPKPYYDVINEVQYVHGIPKNPR
FT                   KLKYVANMLAKLGELRDPRVVAKILEQRPSIALSVGKERSLAAVRYMNSEKAAEVVRKL
FT                   IANADSYEEALSVAKAVDPRLLWRVEIKGFIKGSSLEALVKASLSLRHAAASLSDREPR
FT                   YLQLAMEESKYAEAALSKVNEGELSETARSLLNEAKAIIGVAQGGPSSLANLPPEVLIP
FT                   VVQDLYINTEDAKERRALERLLELSLARTATGLHQGKRTTYNTAGGRLDLRRSELKYIR
FT                   MASNFMTYRTREKVKSFSLLLDISGSMRPYSSMALAAAALATDSIDLLVLFNDTVKPVK
FT                   GPLKRQTMIRLLASLRFDGYTNVSQALRASETAKRVVMISDLRQTVRDLEPSETICSFI
FT                   SRGRRLALLAPPSASLAEISKIQGCGATVVTVSGQSDVIRAFSEILRKV"
FT   gene            complement(343491..344453)
FT                   /locus_tag="ASAC_0343"
FT   CDS_pept        complement(343491..344453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0343"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18750"
FT                   /db_xref="GOA:D9Q0B2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B2"
FT                   /protein_id="ADL18750.1"
FT                   /translation="MESYGSDKEDPIEAKAREIYSQVSEAARPVRNPVEAVKVLEERFK
FT                   LLVDLRIVKVTFAAFMIGRPVLFEGPPGTGKTEIGEALLRLWSGRDPFVLPASPDYDEY
FT                   KTIGDFHPLMAMRYGFNENSFIPRPLLAAMILDAGVLIDEIRRSNEDFQNMLLDIIDKR
FT                   RIVVPELKRAFKAKGLGFQFIFTSNPTDVAQGELSDAFLRRVVRIKFTYPDPEDELKII
FT                   MLHVNDRPLVKDSMLRRVVSAVNALRSSNSMSHKPGVDASISWVRLAQAIAKTEGSASV
FT                   LPRHLIETAAAALIKDPADEDTVYATVKEYIGEGVTYED"
FT   gene            complement(344503..345066)
FT                   /locus_tag="ASAC_0344"
FT   CDS_pept        complement(344503..345066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0344"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18751"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B3"
FT                   /protein_id="ADL18751.1"
FT                   /translation="MPRRRGLLEILRLFIGRAFHAMFMLRDKVKGYISEHDLVLSLNEN
FT                   VMIVGRADAIKVAEGKAHIIERKSSKAPRKGAWVSDIIQAGAYGLMVARNYRPQEITVE
FT                   VRYPTASRVFKFDSRLSALVLKAIDDYLLVKKNGILPAAKRGRRCNSCPYREACFLLDL
FT                   EGEEAKNLEEPGSWLIDIDTIEEQ"
FT   gene            complement(345129..348314)
FT                   /locus_tag="ASAC_0345"
FT   CDS_pept        complement(345129..348314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0345"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18752"
FT                   /db_xref="GOA:D9Q0B4"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B4"
FT                   /protein_id="ADL18752.1"
FT                   /translation="MKVSGLLASDNRPQHEIESWVFSFWDKNNIYHKMKSSRGNKGKLY
FT                   FLDGPPYASASSIHLGTAWNKVLKDALLRYYRMLGYDVWDKPGYDTHGLPIEILVEKMY
FT                   NIKNKKEIETSVGIERFVNTCLDVVENNIKGMTENFKQLGVFMDWENPYVTYSDDYIES
FT                   GWYLFKVAHDKGLLYRSQRVLHWCPRCETTLADYEVSEYTELEDPSIYVKFRVKGSDNL
FT                   YLLIWTTTPWTLPANAFVMAHPDMEYAEVEANGERYVILSSRVEAVMGEAGVTNYRVVR
FT                   TFKGSELEGLEYAHPLEDIVPAQSVLKKYHRVVMAPEAVVATEGTGLVHSAPGHGDIDF
FT                   EVGSKLGVPPISVVDNQGRLTEDAGKYKGLYFRTEANEAIINDLRSRGALFHIGKVRHR
FT                   YPICWRCKTPLVLKTTEQWFIGVSKLRQELLRQLDNVEWVPSWAKSRIASLVTNIEDWV
FT                   VSRQRYWGIPLPIWVCNNCGHVEVVGSVDDVVRLGGRRPEHLHRPWIDEITLRCPKCGG
FT                   VMTRVPDVADVWFDSGIAFYASLGFPRNKEAFNRLMPVDLVLEGHDQLRGWFFSLLRSG
FT                   VIGFGSAPYRRVLVHGFVLDEQGREMHKSLGNYVAVEDILKKYPRDVLRLYLLRNTTWE
FT                   DLRFSWHNIDVTARDFTIMRNVYAFASMYMSLDGFDPKAVTLDSVRDHLEVEDRWLLSR
FT                   LNSYLDEYRKRLDKLEVHEAARIVRDFIVEDISRWYLRLIRRRVWEESDTPSKRAAYAT
FT                   LYAALKTWILMAAPIMPFLSEYLYQNFIRPAEPDMPESVHMTRLPEPDFSLINKDLEDK
FT                   MEIVRKITEYALSARMKGGIKLRRPLKTLYISPSSQVVQDAVKELQGLLAQAVNVKEVK
FT                   VVSSELLNELREYSLEPEFSTMGPDFKKLTPAVIKALQSDAMAAREILQKGFYDITVNG
FT                   QTVRVERRHVRITAKYPDWLLAEETPYGTIALDRRISEQEALEGTVREIIRRVQYMRKQ
FT                   AGLSVDAYIELWINGDEELLAATKVLEDYVKSETRAAAIHYDSPPEGVKSSEWEVDEKR
FT                   LSLAIREVKRNQQ"
FT   gene            complement(348318..348590)
FT                   /locus_tag="ASAC_0346"
FT   CDS_pept        complement(348318..348590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18753"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B5"
FT                   /protein_id="ADL18753.1"
FT                   /translation="MPDREGSAVHKKLYRIYYTTYYDSEHEEVKRKLKEKYGVEPADIK
FT                   SSVLPEFRFLELPIAKGGLEKEISELVSSIIGSKYVKVDWIDTGV"
FT   gene            complement(348668..349726)
FT                   /locus_tag="ASAC_0347"
FT   CDS_pept        complement(348668..349726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18754"
FT                   /db_xref="GOA:D9Q0B6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B6"
FT                   /protein_id="ADL18754.1"
FT                   /translation="MYDCAYDIREGPKVYNRALYKIYRNFPLMGHIAFGVIERGSNVIQ
FT                   VRPSTLCFHNCIFCSVDAGPGSKHRRAEYVVYDVEWLAKWAGEVARAKGGDVEALIDGV
FT                   GEPLTNPRIIELVKLLKQEKGIKRVAIETHGGSLSVELGKRLYEAGLDRINLSIDAVDP
FT                   ELARRMAGASWYNVESVIQTVRKLVEETKLDIVLTPVIVPGLNDKELPRIINLARELKL
FT                   GVRSGWPTGVLAQKYEEHKYGRRPPGVKPWGWGKFYAYLKDLEAKTGYKLIPSPAELGF
FT                   SQAPRIDKPYRKGDKVTLMVASEGWLKNEMLGVDPECSRVFSIVGVRAPIGSKVRVKVI
FT                   EDENNIYIARPE"
FT   gene            complement(349736..350725)
FT                   /locus_tag="ASAC_0348"
FT   CDS_pept        complement(349736..350725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18755"
FT                   /db_xref="GOA:D9Q0B7"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B7"
FT                   /protein_id="ADL18755.1"
FT                   /translation="MPPLCSRCGLRQAEVYQPQSGESLCRECFFEDITARVKREVERWN
FT                   MIEPGDVILLALSGGKDGYTLLDVMSRIYKSDRLIGLNIIEGIHGYNKEEDARYLVMTA
FT                   KEFGIDVIVTSIKEYTGLSVDEIMYKAKERSTRVSACTYCGIARRRIMNYYARELGANK
FT                   LATAHNLDDESQTAVINILRGDFESLLRQHPLAELVRDPMLVRRIKPLRKIYEWETATF
FT                   TFLKGYHIQETECPYIYQLPTLRAKVRRELYRYESEHPGALLRFIESLDRMLEPIAAGI
FT                   KPRSDLGRCVRCGEPTPSGKALCKLCELLEGIGVASPLYSVRRLRVRV"
FT   gene            350820..351320
FT                   /locus_tag="ASAC_0349"
FT   CDS_pept        350820..351320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0349"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18756"
FT                   /db_xref="GOA:D9Q0B8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B8"
FT                   /protein_id="ADL18756.1"
FT                   /translation="MSSQRPSAAVLVLLWGSPRHVLLERKNCSLKSRFACDVALPGGLI
FT                   RKGETPEQAALREAWEEAWVHPRLVRIHGRLGTFSTLSEPKIYTEAIVAELNGPVDPRP
FT                   RDPEVDAVFWVNINDLKEPGLVEHRRRGTVRGILLGNDLVLWGLTLRILEKLKETSWVN
FT                   ESY"
FT   gene            complement(351333..353762)
FT                   /locus_tag="ASAC_0350"
FT   CDS_pept        complement(351333..353762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0350"
FT                   /product="glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18757"
FT                   /db_xref="GOA:D9Q0B9"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0B9"
FT                   /protein_id="ADL18757.1"
FT                   /translation="MDANTIEDASRSRYLAIFGHFYQPPRFNPWTGEIDYDPSVKPYHD
FT                   WNDRITRECYESNAMAKLEDEHGLVEDFFNNYLYLTFSFGPLLLDYLAKRYPNVLSSIV
FT                   EADKESVVSRSGHGNALAQPYAHIIMPLASREYRETAIAWGIKYFEKYFEREPEGFWLP
FT                   EAAVDNLTLEILSDYGIKFVLLGPNQAKAVGTPGGPKKPVDEQSVNTKVTYKAVLPSGK
FT                   EIGVVLYNKWLSGLVAFGDALKSGELILRKALEAFDPNSQTPQLVTIAVDGETFGHHKR
FT                   GGEVELARAFSLAPSYRVSLTNVSEFYSKISPPAYEIEIAENTSWSCPHGVERWRSNCG
FT                   CGSDIRPGWTQAWRTPLRTAVDLAASEIMSSYLKIGGEVFIDPKKALLDYGFVLTEDSS
FT                   SEAAAEFLKEHLRVGDERSKSLALRLLEMVRQSLLMQSSDAWFFEDIYRPEPIQAMLHM
FT                   RRALELLRETSGSDIEPKVLEVLDTAKSNDPSAGTGKDIYMKFAIGATMTPEKMAAMLA
FT                   MRLLFESMPQETDFYSYRVIIERLSPLKLGRFRALSGVATLISKVTWTYHHVMFAAIYY
FT                   GWYDVFGGAKTISSMQEYEKVEKDISNMFSKGMMPDLVSYLSSVFGDGFIDLQRSLKDE
FT                   QRILLNHVMESATVDLSHQFDVLYDNYMPLMQYVRMLGMDYPRVFEHLVEYFVEKSILQ
FT                   LLTESPLNASIIMELSRWAANSSLKVNHEVPRAYTFRMLNLLKTLQEDPLNEQAMNDLS
FT                   LLLSSYKTLGLSEDYLHPVQAEFVKLRNKVLRSIKLPQQVNDLYKVIALNLKVKYP"
FT   gene            353901..354533
FT                   /locus_tag="ASAC_0351"
FT   CDS_pept        353901..354533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18758"
FT                   /db_xref="GOA:D9Q0C0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C0"
FT                   /protein_id="ADL18758.1"
FT                   /translation="MIIMARGPGDEDLKIAFLFAIPYLLFFLSFRVFASRFLYAMAAST
FT                   VAMAALSLKLFPTIKNFYRFSAKNVVMSLPFAGLAYLLFYLGWIGTVYLGLSRGVYFIY
FT                   DVVPREPFSLLALTLIGLSEEPYWRGFVQRVFVEKRLKLEWPFAALFYGIVHLVTGDLV
FT                   LPLAAFVFGIVMSWAAERYGLVTSSVAHVVWLYVILYVIPVIRLPLP"
FT   gene            complement(354525..356090)
FT                   /locus_tag="ASAC_0352"
FT   CDS_pept        complement(354525..356090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0352"
FT                   /product="glycine dehydrogenase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18759"
FT                   /db_xref="GOA:D9Q0C1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C1"
FT                   /protein_id="ADL18759.1"
FT                   /translation="MSYRQSAWSEPLIYELDRGRRGLLFSSLVEEFKKLVGDAPIPQEV
FT                   AREKEPELPEVSEVEVVRHFTRLSEMSYGVDNGPVPLGSCTMKYNPRIGLKYAFDERLE
FT                   MVHPLMPEEKIQGLLRLLYELQEWLKAITGMDVCTLSPAAGAQGEFTGILIIKGYHVAK
FT                   GQADVKNEIIIPDSAHGTNPASAAMGGFKVVEIPTADDGNLDYEAFRSALGPQTAGLML
FT                   TNPSTLGLFEQRILDVARDVHNVDGLLYYDGANLNGIIGRARPGDMGFDIAHLNLHKTF
FT                   STPHGGGGPGAGPVCIKDRPVSGSLRLSDLLPGPVVYYDDEKQMYRVRWRGSNSPGSIR
FT                   PFLGNVPQLVWAYTYILSLGPQGLRRAGEVATLNTNYFAARVLKETKLFSLPYASSRPR
FT                   KHEIVISAEPLLNETGVTAEDVSKYLLDAGLYAPTMYFPLIVKEALMFEFTESETKENI
FT                   DKYVEKLKEVEELARSNPEKLKSTPLNTSVGRVDVVKANHPRSVTPTYRVLRARASGKD
FT                   LVLR"
FT   gene            complement(356087..357481)
FT                   /locus_tag="ASAC_0353"
FT   CDS_pept        complement(356087..357481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0353"
FT                   /product="glycine dehydrogenase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18760"
FT                   /db_xref="GOA:D9Q0C2"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C2"
FT                   /protein_id="ADL18760.1"
FT                   /translation="MSYPWIPNSSDSIIKEMLSTVGAKSLDDLYSDIPRELLIDESKWN
FT                   SMPIGAGRPLSEVEVSRIIDKLLDRNAKLRVPPFAGGGLRPHYVPPVVKDIVTRGEFLT
FT                   AYTPYQAEISQGLLQALFEYQSLMADLLEMDVVNSSMYDWASALGEAALMAVRVKGAKR
FT                   VLVPDVINPFHLSTLKAYTWPQGIEIDFYSTDKETGYADVEDLKTKLGKGKASAVYLEF
FT                   PYTFTGVVDMNAKEVSGIAHDSDSLFIVGVDPLALGIYKSPGELNADIAVGEGQPLGLG
FT                   LYAGGSTLGIMAVRWDGSLIKQMPGRIIGLTTSKDGNSRAFTMILQTREQHIRRSKATS
FT                   NITTNAALNAIAAAVYMSLLGPKGIKELAEAIRYRAHYAALVVSRHGFKLPLKGEFFAD
FT                   FIIEAPEPYYNLWRLLLDKGIMAGIPLSSHVTWAKDSWGLLSFSEVHSKEDIDLLANLL
FT                   GEVVRK"
FT   gene            complement(357578..359527)
FT                   /locus_tag="ASAC_0354"
FT   CDS_pept        complement(357578..359527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0354"
FT                   /product="Glucoamylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18761"
FT                   /db_xref="GOA:D9Q0C3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C3"
FT                   /protein_id="ADL18761.1"
FT                   /translation="MARGQELTLLARGLGLFLIGLLAVTLAVPATRAIGPGPSTVNLSP
FT                   SFLLLSNWVNTSFLVFTGIPIPNASVNGLSNYEPTVANFYVGPLGLLPITMKFETGFSA
FT                   RAFLGVNNSIIIYNNYGELQLLAPPYSNLLLALVSSKAPFTVYVNFSTESSVSLNGDIA
FT                   RIFMHRYNFYVELCSNDSLSALHDINYTLISVNVSKGTSYIGLSLNSSCSSNVKEIINY
FT                   NELKVNSWLFRSKRPVGLNSNSLAREYYISLLILKDDQNPYLGTFAASPSPLYLYSWVR
FT                   DSSFAAMALQESGHLDSALKYWLWLLNATQYKSGVWFTRYDFYNGEPDQSFGIPELDSV
FT                   GIVEVGIYQYFLLTHNITFLETMLPLINRSVDAQLSWILNSKFHLVPEDLSVWEDRLGY
FT                   HFWTQAFNLIGLLDSAHLLSYLGYNVSRIYYAASLLNESIYEYFWNGSAFYSDLSPVVL
FT                   YTPSGSKTALNPQPPLISSSALLPLSFNVTLWPQDVVRENVHTILEGLWNGKVGGLARF
FT                   YGDDYHYNEDLFDSSGPMPPWIITTLFLGLYYSDTGNYTAALSLMTWAYDHSQNGLLPE
FT                   AIDPNTGLPLPTTSPLTWSSAMYIILALSIKPKAANNNIIYYAVSAIALAAVLLVAYLL
FT                   QRASARRIRSLEVT"
FT   gene            359672..359956
FT                   /locus_tag="ASAC_0355"
FT   CDS_pept        359672..359956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18762"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C4"
FT                   /protein_id="ADL18762.1"
FT                   /translation="MFKEKGPLSPGDVSQQLNMPKYKALAMVSCLSSMGLLEPLYIKGS
FT                   YKIYKISLVGQQFLERAEKAGTAAAAMEDLLLAQQPANESQQGKEAATA"
FT   gene            complement(359946..360227)
FT                   /locus_tag="ASAC_0356"
FT   CDS_pept        complement(359946..360227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18763"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C5"
FT                   /protein_id="ADL18763.1"
FT                   /translation="MASYAIVMPIYRYFESGLVYYFIQTTYRDYYKYYGIPIIYYFCSK
FT                   PTEDEQRYKYVLLKVDESGEKVELSDRSRPGWAAIPIINLKSKPPFMP"
FT   gene            360367..360454
FT                   /locus_tag="ASAC_R0013"
FT   tRNA            360367..360454
FT                   /locus_tag="ASAC_R0013"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            complement(360574..360906)
FT                   /locus_tag="ASAC_0357"
FT   CDS_pept        complement(360574..360906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18764"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C6"
FT                   /protein_id="ADL18764.1"
FT                   /translation="MSKGAQFTYYKALLELLGLRELDVYRYSRKGQVSDVIRVLEPASH
FT                   KVVNVDLGTARESLSYEEFLNRVKESLERNGIKISDRVWSSAIYKVKSLESKVQAKAQP
FT                   PGEPAK"
FT   gene            360969..361247
FT                   /locus_tag="ASAC_0358"
FT   CDS_pept        360969..361247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18765"
FT                   /db_xref="GOA:D9Q0C7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C7"
FT                   /protein_id="ADL18765.1"
FT                   /translation="MKYLKVSISVDFVAGIIRSLGKNYVTPKDLSEAMGISTKTAGRIL
FT                   RALESKGYVARYSNRAYRVLRGSLPSGDECHASTLIVRYPEDPPIPY"
FT   gene            complement(361427..362788)
FT                   /locus_tag="ASAC_0359"
FT   CDS_pept        complement(361427..362788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0359"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18766"
FT                   /db_xref="GOA:D9Q0C8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C8"
FT                   /protein_id="ADL18766.1"
FT                   /translation="MFGLSEAPLIRVEPPGPVARGIIERDSKALVQSYVRWVPLVVKEG
FT                   HGAVVEDVDGNKYIDLNAGIAVMNVGHSHPKVVQAIKEQAEKLQHYSLTDFYYESAVTA
FT                   AEKLLTVSPVNNGRVFFTNSGTESIEGSLKFARYFFGGSRQYFIAFLGAFHGRTMGSLS
FT                   LTASKAHYRKGFGPLMPGVIHVPYPYPYRCVFRTDDPKECGEAVLGYIEDWIFAKLVDP
FT                   TEVAGIVVEPIQGEGGYVVPPDNFLPGLRRIADKYGILLIDDEVQAGMGRSGKWFAIEH
FT                   WGVKPDIMALAKAIGGGLPLGAVVARGDVAATLTKGSHANTFGGNPIATAAMSAVIDVI
FT                   KEENLLDHATKLGNEVIKYFNDLKDELEIIGDVRGKGLMIGVELVRNRRTKEPATKELA
FT                   NVIEKSFKRGVVVIGSGLSTIRIAPPLVISDELMMRAVEIIADVLREENRNLTA"
FT   gene            362836..363054
FT                   /locus_tag="ASAC_0360"
FT   CDS_pept        362836..363054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18767"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0C9"
FT                   /protein_id="ADL18767.1"
FT                   /translation="MPKYEFELVEEYFLEGEHRYRLKVKGTNLIVNVAADTLEEAASKA
FT                   AGILEHSGAAEFIKLNRVEAKQGDKTS"
FT   gene            complement(363081..364340)
FT                   /locus_tag="ASAC_0361"
FT   CDS_pept        complement(363081..364340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0361"
FT                   /product="sugar-phosphate nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18768"
FT                   /db_xref="GOA:D9Q0D0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D0"
FT                   /protein_id="ADL18768.1"
FT                   /translation="MGRIPEVKKAAIPIGGLGTRLYPFTVDTSKPMVRFLNRFVIDFIL
FT                   DELALQGVGEVFLGVSGFYNYRDVYDHLGERFSVRSPDGKRLVLKLRYQPNVTSVGNAH
FT                   SISILADYYDINDDVLVVQGDTVVSLNVGDLAKFHESNGAFMTIALKRVDDRESLRQLG
FT                   LAKLKDDWSIESFVEKPADPEKAPSNLANTGIYLLSHDMVKFLRSDEFASLVKQGRGDF
FT                   GRDIIPYLIAKGYKVVGYPLNGYWFDIGTIENFVKASFYLLESLPPERLGVATVYHDTI
FT                   YMMGFSSRSKKDHLDLVERSAQKRIDLSGRVLIGRHVTVEDGASITDSIIDNYVIVKSG
FT                   ARVTKSIVMDRSIIGDNSTVESSIVGRHVAMGSNVKIINSYIGNDVIIGDNAVIIDSQI
FT                   WPHRSIESNAEISNRRGPPS"
FT   gene            complement(364433..365857)
FT                   /locus_tag="ASAC_0362"
FT   CDS_pept        complement(364433..365857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0362"
FT                   /product="Alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18769"
FT                   /db_xref="GOA:D9Q0D1"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D1"
FT                   /protein_id="ADL18769.1"
FT                   /translation="MTSHIALFFELHQPLRLKRLSLYSPSNLPTSFSDVIDVMGNSEIL
FT                   SRVVSRTYLAATKILYEASQKVKDFKMTMSISGILLEQLKKEHEEVIDLLRKLVDKGLL
FT                   ELAAQTYYHSLAWFVDRAEFEDQVKAQVELVRETFGVNPSIAENTEFIYNNDIGCELQR
FT                   LGFKGVITEGVDWLLGWRSPNYVYKNPLCGVKLLLRNYRLSDDIGFRFSNRQWSEYPLT
FT                   ADKYASWVASTPGDLVVIALDYETFGEHHWPESGIHEFLRWLPVELSKRGVTFLKASEA
FT                   LNLEPRDYLDVPPWSTISWADERDLSAWLGNGMQRKAFDVLRRYYYFARALGGTYLRSW
FT                   RLLSVSDNLYYMATKPGGEGEVHRYFSYLGDPYDSFLTYSYALELLGLMIRNGLKENPC
FT                   AAIKVKLPDDLCFRFYNSGGAEVAKACSVPDLATALSTLPKEVVSKAVSASYLNRWSQE
FT                   IFGLNLDALLGLIRRC"
FT   gene            complement(365854..367428)
FT                   /locus_tag="ASAC_0363"
FT   CDS_pept        complement(365854..367428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0363"
FT                   /product="Glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18770"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D2"
FT                   /protein_id="ADL18770.1"
FT                   /translation="MAPRSIKRAWILTFELSPLVKVGGLGEAVFRYAKYLSKKGVEVTV
FT                   LMPSHGRHLDLGIRTKYNLRPLDFAVCGSRKGLDGNSYNYCLGAEEALMEGFRVVMFKG
FT                   LDYSTGVIFDSWNPYAYVEEKAALMARAVKAFSWIEVQPDIIHVNDWHTVLAGISLRDE
FT                   LEKRGYAVPVLYTIHLSGSPSFPWHYASPEWSGLDDEPHLVWRVYRHEPVSNRAVWDSV
FT                   GGNVEAFGVIEADAVQTVSYSYLNEELKKRYGDWIGGKSCVAYNSTEWSVKEVERWIES
FT                   NYGNVDHQVLFELIDKYVRPGSWLDKMDESLAVFIVAGRLTSQKGIDIAIRALDYAPSA
FT                   SLVVLGVPVGDYGYEQYIKRLAEERRGRVLISSNRVPDYAYKAIIRLAAATLVPSRWEP
FT                   FGLVAVESLAVGTPVIASAVGGLKEIVVDLRSGRGDGLLTRPEDPYELGLAMESLSHIM
FT                   WDHDLDRVPIEQLRSMAKRNPTLENDIREFAISDVDKRFRPESTAEQLLQCYEKARQMA
FT                   YYRAISS"
FT   gene            complement(367483..368223)
FT                   /locus_tag="ASAC_0364"
FT   CDS_pept        complement(367483..368223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18771"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D3"
FT                   /protein_id="ADL18771.1"
FT                   /translation="MLGQPDADSLVKECGSLKRWILDTDGIPTSLKLAIDDQEAFKDEL
FT                   PRLAATSRHLIDVLINKYRAEVEIPRNVDPVSEFKVTAWPDLVNEELGLVGLVLYSWFP
FT                   FSIYRGDNKAEYEPIELVFARNNDNDYRLLFAYARVHYDLCEYNLAGLSKVTIRFLYHG
FT                   HTPFIDGLGYIRLKCPKVKSSARRVGRKYWDRIWLGTALTFEKIVKGTRMPLSLLLKLG
FT                   TLTIMQCPNHSTANPFRSPITIRI"
FT   gene            complement(368207..368953)
FT                   /locus_tag="ASAC_0365"
FT   CDS_pept        complement(368207..368953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0365"
FT                   /product="Threonyl/alanyl tRNA synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18772"
FT                   /db_xref="GOA:D9Q0D4"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D4"
FT                   /protein_id="ADL18772.1"
FT                   /translation="MVRLLYQEDSYVKEFEATVTRVDQNKIYLDATAFHPGPSGGLDAD
FT                   TGLLVLPSGSTVRVVNVIEDGDDVAHITEAPVQLSPGDKVKGVLDWERRYSMMRLHTAS
FT                   HVLAAVLYNKYGAKITGGHIKPDEAQDDFDLSGVENWRQAILTAVDEANNVLSRCIDVK
FT                   VYWLERDRALQIPGIVKLAGRLPPAVDKLRIVEIPGVDIQADGAPHVKNTCEVGHIEVV
FT                   SVENRGKTRKRVYYRLSQVPAGARTA"
FT   gene            complement(368971..369075)
FT                   /locus_tag="ASAC_R0014"
FT   tRNA            complement(368971..369075)
FT                   /locus_tag="ASAC_R0014"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACG"
FT   gene            369242..370474
FT                   /locus_tag="ASAC_0366"
FT   CDS_pept        369242..370474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0366"
FT                   /product="Multiple substrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18773"
FT                   /db_xref="GOA:D9Q0D5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D5"
FT                   /protein_id="ADL18773.1"
FT                   /translation="MIDVASKFSSGVKSLRPSEIREILALTENKKVLSLAGGLPGPEVF
FT                   PKEELAAIASRVIEELGDSALQYSPTLGVMPFREAVADFVRGKGVKVTDNDRVAVTTGS
FT                   QEAIYLLAMTLINPGDGIIVESPTYLAALNVFRYYGANFISIPLDENGMRTDLLEDSIK
FT                   KAKEKGINVKMIYTVATCHNPTGVIMSDDRRKELMEIASKYDLLVIEDDPYSFFVFDDD
FT                   VNFTHLKTMDDEGRVIYLGTFSKILAPGLRLGYMIADRQLVRAVELAKQMVDLHSSTLS
FT                   QYIALYAIKEGVVDRTIEKARKSYREKRDVMIEALEEYMPDGSHWFRPRGGLFAFIYLP
FT                   EGVDTSDMLQMAIDRGVAYVPGRSFFSDGSGANAMRINFSYLPPDKLREGIRIIANTAV
FT                   DYLKAKGKVAS"
FT   gene            370779..371747
FT                   /locus_tag="ASAC_0367"
FT   CDS_pept        370779..371747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0367"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18774"
FT                   /db_xref="GOA:D9Q0D6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D6"
FT                   /protein_id="ADL18774.1"
FT                   /translation="MSVKFLVTGGAGFIGSHLVELLIEEGHDVTVVDNLSTGRLEFLKD
FT                   VMGSPHLRFIRADLTSPEVAREVTKGADAVVHLAANPEVRIGSQSPESIYLQNVQMTYN
FT                   VLEGMRANGVKAIAFASSSTVYGEARVIPTPEDYGPCYPISVYGGSKLASEGLISGYAF
FT                   TFDWTAVSYRLANVVGPRSTHGVIYDFINKLRRDPTRLEVLGDGSQSKSYVHVSDTVRA
FT                   MYQLFMKALEKGVRYEAFNIGTPDRISVLEIAKIVAETMGLSPQIYTTGGVDGGRGWRG
FT                   DVKVMQLSIEKAVSWGWSPQVGSSRDVVRRAVTEVLSGFKA"
FT   gene            371777..371851
FT                   /locus_tag="ASAC_R0015"
FT   tRNA            371777..371851
FT                   /locus_tag="ASAC_R0015"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            372910..374472
FT                   /locus_tag="ASAC_0368"
FT   CDS_pept        372910..374472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18775"
FT                   /db_xref="GOA:D9Q0D7"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D7"
FT                   /protein_id="ADL18775.1"
FT                   /translation="MDFSTLLTIIRLTMIKESKRNALLSLIVQLAVAYFIAYGISLFSP
FT                   QFLHNLWALDILIVTSLLLIVISADIVMRECIDSFINVFLKSMNKEMNKEEFREGFFNA
FT                   LNVLKDPNNIGKLDDLLNEYFVRGDFFKEYKEEVKRRKSCSILARIDANLAYTLLLPAV
FT                   FGNLAYALLLPIVFILINNLHQGIFSNVDIRVLIILVGITAYSLFVRNKIIASREKEYQ
FT                   SRYEEIIVSYISSLLLEQIINSRYIKIKNRYNRVLHLLLTYVGVPLNMYTVFNSLSDSG
FT                   DNTTNSQETTTASLIYIIDEKVLNKSYLGRPQSKNEKEDVDEKRLKIEEDIMSFLSLAK
FT                   EALGAKSLMMMDKREFTEFVCRLAEEAGMRKESPFNDLCNDSGNKDNNYNETKNNENKD
FT                   LIPYDIGEIEMSAPPYIPLPSPYIPYINSIYKLQKLLRISETNDALKPPHSIIFLIREG
FT                   KSVSVNLLIMLRATLSIKDKIIDPKDLALSDTKDQSSKKCRAKCKIKPVDYSYDLNFAI
FT                   FLS"
FT   gene            374925..375013
FT                   /locus_tag="ASAC_R0016"
FT   tRNA            374925..375013
FT                   /locus_tag="ASAC_R0016"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   gene            complement(375022..376032)
FT                   /locus_tag="ASAC_0369"
FT   CDS_pept        complement(375022..376032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0369"
FT                   /product="Sulfate ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18776"
FT                   /db_xref="GOA:D9Q0D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D8"
FT                   /protein_id="ADL18776.1"
FT                   /translation="MRQGGGPGLASALRLEGLVARVGNFTLGPINLELERGEVALIFGP
FT                   NGAGKTTLLKTVLGFYRPVKGKVIINGADSTYMPINRRNIGYVPQSLALFDNMSVRDNV
FT                   EFGLKVRGVPGRERERLVKEMAERLRISELLDRRVTELSGGQMQRVAIARAVIARPTLL
FT                   LLDEPASNLDPTSVEELIDTIRYVTKEFGITTIIVSHSISKLLRVASRLLFMSGGKLVD
FT                   LGDVETAVRNPVKAEAAVYLGYDNIIPCNAVDPRPCDDGKAMAARYNFVLIGDPECDGI
FT                   TLDGIVEQLYVGLDGVRRAVARVGGLRVVGLAGDHVRLGEAKICIRREGLAVVDL"
FT   gene            complement(375986..376816)
FT                   /locus_tag="ASAC_0370"
FT   CDS_pept        complement(375986..376816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0370"
FT                   /product="Sulfate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18777"
FT                   /db_xref="GOA:D9Q0D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0D9"
FT                   /protein_id="ADL18777.1"
FT                   /translation="MARLRLNLFIVLFVIIGGLLLLFFSYPIAVLLLVGSSGLEEALRV
FT                   RSFELALLVTIITSTIAAVASVIFGVPLAYIMSRYNFRGKSLVESLIDLPIAIPHIIVG
FT                   VMIVLAFSWYVGLGPIFHRLHINVVDTILGAAMAVTYVSATYSVRVVESAISMLDPELE
FT                   LTAMSLGASRARTFISVVLPKIKRSIAGGALTSWARAASEAGALFIVAYEVYLGKSLVY
FT                   PAPVAIYEAYVGIGIIEAAKFSAAMLVVVLGIFVLARILLEARRGSRAGLGAQA"
FT   gene            complement(376823..378034)
FT                   /locus_tag="ASAC_0371"
FT   CDS_pept        complement(376823..378034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0371"
FT                   /product="Sulfate ABC transporter, sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18778"
FT                   /db_xref="GOA:D9Q0E0"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E0"
FT                   /protein_id="ADL18778.1"
FT                   /translation="MSSKGASLWIYLVVGLVIGLVVGAGAGYVAAPHRTVTVTAPATTS
FT                   TYTTTTTTTYTTTAPVSTSPFTVGAAGTLKFSFGQLLSMLNQYNPSITEGQPLFAGSGE
FT                   VAQKEATTQVFSLVASADTTTIPSVLFPKYANYEIAFGVTQMVIIVDLETPAGKEVYAL
FT                   WKQAQTEQPFSAQWNQTWEKIFDIIAVNSSTVVGVSNPFTDPSGYQAQCVLKLAGLAFM
FT                   HNASYYWGAVYNNPSKYQMRNTEIDLLTLMYANNSVQFVLSAYTSNAIPQTEAYQQKGF
FT                   NMTYITLPPFINLGNLSYVNFYHQVNITWTELGVTKTFACNPVVYTATIPYSAPNPQAA
FT                   VDFLLLIFSPAGQKVLESYGINPIVPGVVYGNYSAVPAPLKPFTVPLSNASYLSSIFPS
FT                   SSSS"
FT   gene            complement(378102..378272)
FT                   /locus_tag="ASAC_0372"
FT   CDS_pept        complement(378102..378272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18779"
FT                   /db_xref="GOA:D9Q0E1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E1"
FT                   /protein_id="ADL18779.1"
FT                   /translation="MPADRSLRIITFKLDVDTLMKLDKLAVAEKRYRSEIIREAIEAYL
FT                   SSKVSSRPSVY"
FT   gene            378424..378531
FT                   /locus_tag="ASAC_R0017"
FT   tRNA            378424..378531
FT                   /locus_tag="ASAC_R0017"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            complement(378605..380044)
FT                   /locus_tag="ASAC_0373"
FT   CDS_pept        complement(378605..380044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0373"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /note="NuoN and MbxH - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18780"
FT                   /db_xref="GOA:D9Q0E2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E2"
FT                   /protein_id="ADL18780.1"
FT                   /translation="MWEIGTIKFLLYVTLAASLLAPLTSPSGRRDNVAPLVMAAIGVGS
FT                   FAVAMGISFYAASLGRPLSFYHGLVVQDSFTSLMLLGASLASAIFLLAVGTDGLGWSSS
FT                   PSLYSLVPMTLFGAFFLAGATNALVILASWLLVSVISYIIIAAPDSKNAKAAGVRYIFV
FT                   GMVATLALVGSLAFISVSSGAYTFSITPVSGLSTDARGLMALAVLLLLAALGFKVGLFP
FT                   FHWWLPSVYGRGDGRTVSFVAAVVKLSFLAILTRVLVIIASGGQLHTIIAITLAALAVA
FT                   TMTYGNFAALTTRDLQVILAYSSMAQVGYIFAAIAAASYFAGVGNEYMLRLSLFAVALQ
FT                   SIAYAVAKAPLFAFAGEVGGSLDSLRGLMKSSPLSAVTASVLLYSLLGVPPLLGFWGKL
FT                   YMFLAAVGFSVWLALAALINSGVSSVYYIIASREMLRKDYEATPKPRARYAVALLIASL
FT                   LIVLLGLVAPLTFRGIISIYI"
FT   gene            complement(380051..382111)
FT                   /locus_tag="ASAC_0374"
FT   CDS_pept        complement(380051..382111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0374"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /note="NuoL and MbxH - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18781"
FT                   /db_xref="GOA:D9Q0E3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E3"
FT                   /protein_id="ADL18781.1"
FT                   /translation="MTVVHAYWLTWSWTWLAPFTGAGLLALLWLAGVRREQVYSIISVL
FT                   SVLASALVSTAALYYVLADHEVIYATSAWYWDSLLRVHVGVYLDGLSAIMATVVSWLSF
FT                   LIDLYSVEYMKGDWGVQRYFFFISFFVGSMMLVVTASNLILMFVGWEGTGLASYALIGH
FT                   WYTDEEEYWVGVPRSTALGKPMYFEPSTSGVRAILFTRVGDVGFIIGMTGLFALVGSMS
FT                   IPAIASSAGSWMAFLASRGLLAIFLFVFTLGALSKSAQFPFFEWLVTAMTGPTPVSALI
FT                   HAATMVKVGVYYMLRFAPIFFVGALVAASLGAPAAVAQVHEYFLLVASLAAVTLFMMAT
FT                   MAIVNHEFKLILAFSTAEYLGYMILAVAAGGLAVVTGNYAAMAYAEMAGLAMLIAHAVF
FT                   KAALFLVAGYALHASESRFIDDMGNFWRYMKATGISTWLAGLSLAAVPPFLGFFAKELV
FT                   LGAVERTAVYSLYALAVIAVVFTAAYITRLIVRVFHLPPLNKEAEGKHYHEAPALMLIP
FT                   YAILGLASIVLGAAWFYVGYWVASGVGETLDIRVTPPFMPSIDLTTIVITAVVIIDILG
FT                   VALLYMRRHSLVYLLQKSDALKAIHSFLFNRWYVNSAIYYLFLDSFAGLSWLLNVVNRG
FT                   IDLFYHYVLPKAGELASRGLRGLLRGRTDYILTLYLFMMVIIGILMFMAWR"
FT   gene            complement(382111..383679)
FT                   /locus_tag="ASAC_0375"
FT   CDS_pept        complement(382111..383679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0375"
FT                   /product="NADH-quinone oxidoreductase subunit M"
FT                   /note="NuoM and MbxH - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18782"
FT                   /db_xref="GOA:D9Q0E4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E4"
FT                   /protein_id="ADL18782.1"
FT                   /translation="MILPYPLLWITVILPVLLGIIAWPLRSRSGLHALFYLSAASLIIP
FT                   LLIIVYGYASGALETGSLVDPLYFNLTRYSVGTIALGIDGLSAPVIIGLSIVTSFVAIY
FT                   SIKYMETRISEMEESGERPPSLGTYLLLYNIFAATMLGLAYSTNLVEFYVFLEGSLISS
FT                   FLLIAFYGYGDRRRISLLYFVWTHIGAVVFLTGVLYLGYLTHSFDYLTLLNGQLVSVGS
FT                   VEYIGSAATLIAALLLFGLFVKMAVFGVHMWLPYAHAEAPTPISALLSPNLIGLAGYAI
FT                   ARFVIPLFPTQMESWRDFLLGLAFTTIIYAGLVSLRQTDFKRFLAYSSISQMGYMLLGL
FT                   ATLNEYGIMGAMLIYLSHAIGKALLFMSAGVFITEAHGLRDITKMGGLARRYPLVAALA
FT                   LFGFMNLAGLPPSIGMWSEIFVVLGVVKSLLFINLATMFGLSLLLIVALTITAAYSFIT
FT                   MRRVFYGQPRSKVEARERVDGFKLAMLAVAVFGVVFFLAINPLTTGLSAAISHVVLLSG
FT                   FGGGP"
FT   gene            complement(383687..384001)
FT                   /locus_tag="ASAC_0376"
FT   CDS_pept        complement(383687..384001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0376"
FT                   /product="NADH-quinone oxidoreductase subunit K"
FT                   /note="NuoK - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18783"
FT                   /db_xref="GOA:D9Q0E5"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E5"
FT                   /protein_id="ADL18783.1"
FT                   /translation="MILVDSFVGATLFVTSAIIMAIGAYGLTASNNLLRQLLSVEVIFN
FT                   GLLLLVIPLLSGFAALAAYFGIIVISVVSVEVVVVVSILIAFLRQYRSLSSSDLEESEV
FT                   "
FT   gene            complement(383998..384495)
FT                   /locus_tag="ASAC_0377"
FT   CDS_pept        complement(383998..384495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0377"
FT                   /product="NADH-quinone oxidoreductase subunit J"
FT                   /note="NuoJ - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18784"
FT                   /db_xref="GOA:D9Q0E6"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E6"
FT                   /protein_id="ADL18784.1"
FT                   /translation="MSGESIDLPLYAIVLSIMAIASAMLVVRLKDLVYASITLAILGSF
FT                   TAALLAVAGFGLVSAYLVLVYVGAAVMFIVISISMIGPQGQESFDSFRGLTVAAALATF
FT                   IITVVVISELYRLFTVPPSLSASAAAAGALREYLPVLALIFIGQAATVVEAISIAKRGG
FT                   RK"
FT   gene            complement(384492..385082)
FT                   /locus_tag="ASAC_0378"
FT   CDS_pept        complement(384492..385082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0378"
FT                   /product="NADH-quinone oxidoreductase subunit I"
FT                   /note="NuoI and MbxN - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18785"
FT                   /db_xref="GOA:D9Q0E7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E7"
FT                   /protein_id="ADL18785.1"
FT                   /translation="MPARPSLKRVPRATFLGRAIAGNLGALIVGVKYFIDPNRITLLYP
FT                   HEYIKLRQGYRGYIVLIFDKCISCASCARICPARAMKMVTMEVKDKKLNRAMKKKYPVI
FT                   NYNRCIFCGYCVDVCPTEALYHVPYHDLVYLNMQDMILNVEEFQKEPEFVTAKEGVPVT
FT                   YVFDEKRGLVKVSVEESSNQGSSSQPAGGGGSS"
FT   gene            complement(385094..386152)
FT                   /locus_tag="ASAC_0379"
FT   CDS_pept        complement(385094..386152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0379"
FT                   /product="NADH-quinone oxidoreductase subunit H"
FT                   /note="NuoH and MbxM - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18786"
FT                   /db_xref="GOA:D9Q0E8"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E8"
FT                   /protein_id="ADL18786.1"
FT                   /translation="MITATRVLYDIGWGILHYIIFYPPVYQFVIIPGLVAALVVVIFII
FT                   WFERKAAARVQMRYGPLEISPRTGGAPQLIADLVRYMMQEIIVPSAVDFMSYILAPNMS
FT                   MILSLLPMVAVPMTSIPSYWPIPMSYSLLIAVALSTLSPIFVVMMSWASNSKFSVLGGL
FT                   RESFIVVAYELIAVISLLSVVPLLHTFDLVTIVDYQFSGRWLGLLNPLALLDAFIAVLM
FT                   STSGFPFEIPDSESELVAGPYTEYSGLLYGLNMGGAYIRRWAFSVLIALVFLGGWAPYR
FT                   PEPGIVLGYLVPSLIVVVKAVIIMAIMSFLRAVYGRYRLDQALSLAWEVLIPIAIAAFG
FT                   LSVFEAFIGVHP"
FT   gene            complement(386159..387364)
FT                   /locus_tag="ASAC_0380"
FT   CDS_pept        complement(386159..387364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0380"
FT                   /product="NADH-quinone oxidoreductase subunit D"
FT                   /note="NuoD and MbxL - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18787"
FT                   /db_xref="GOA:D9Q0E9"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0E9"
FT                   /protein_id="ADL18787.1"
FT                   /translation="MEVRPVERNVYEVQIGPAHPGSGHMRIIVELDGDVMVRVDPDIGF
FT                   VHRTMEKLAEGRDWIKNIPLFERMAILDACNITLPYVEAVEKLLDIEPPERAKYLRTLL
FT                   CEINRIASHLYGMGIFGVFLGHSTLYMWAFGDREVFVQLAEDLTGARLTHSYPVFGGVR
FT                   RDMPDDFPENARKAVRYMRNRLNEYAKIFLNNPNIRKRLEGVGVISKTRAAELGIAGPN
FT                   ARASGIKYDVRLVEPYEAYPELDFEIPVFEEGDSLARAWMRVEEIRQSLNIIEQAVDWL
FT                   EKHPREGFMHDKFWKAAPKLYKDVYEGNIPYAGKYRVKLMPLFATLKVPAGKAAARVEA
FT                   GRGEMFYYVESDGKDVPYRVRVVSPSFRNVIAFKYVMPGHRLMDLPTIYGSFDYFPPEW
FT                   DR"
FT   gene            complement(387413..387928)
FT                   /locus_tag="ASAC_0381"
FT   CDS_pept        complement(387413..387928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0381"
FT                   /product="NADH-quinone oxidoreductase subunit C"
FT                   /note="NuoC and MbxK - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18788"
FT                   /db_xref="GOA:D9Q0F0"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F0"
FT                   /protein_id="ADL18788.1"
FT                   /translation="MVTAEELQKSILEALKDYKPQVEPSKGYIDVVVPVEHLVDAARKL
FT                   KDMGFDHVISVGAVDYLTKKQLKIMYHLTSYLNEDLSRFMVSLSTYVSRDNPHCPSLTP
FT                   VWLSAEFHEREEYEMFGITFDGHPDLRLLLLTPVVAALKPLRKDFIVKEESDNIEADYE
FT                   GFKATKWW"
FT   gene            complement(387915..388547)
FT                   /locus_tag="ASAC_0382"
FT   CDS_pept        complement(387915..388547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0382"
FT                   /product="NADH-quinone oxidoreductase subunit B subunit"
FT                   /note="NuoB and MbxJ - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18789"
FT                   /db_xref="GOA:D9Q0F1"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F1"
FT                   /protein_id="ADL18789.1"
FT                   /translation="MEGLEMAQVQERAKEGKAYIGNLEVAAQLAKESLIKGTIAKVVDW
FT                   ATAFSLWPVHLMTSCCGCEIGAAWGPRFDNERYGSLPWVSPRQTNLIIIEGTVTKKMAC
FT                   TVRITWEQMPFPKFVIAMGACSLDGGIFYNSYNIVRPWQVVPVDIYIPGCPPRPEAVAR
FT                   SIVELQKIIRSRGVASKWVVEGVRKDLKYILPKEDLCGWRGEGGGYS"
FT   gene            complement(388535..388912)
FT                   /locus_tag="ASAC_0383"
FT   CDS_pept        complement(388535..388912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0383"
FT                   /product="NADH-quinone oxidoreductase subunit A"
FT                   /note="NuoA - like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18790"
FT                   /db_xref="GOA:D9Q0F2"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F2"
FT                   /protein_id="ADL18790.1"
FT                   /translation="MLAANSFIIVPTIILAVLVGTILLLRMLLRPAGYIESKEPYKYRL
FT                   FESSNPPRGVGKSRLSYQYFGYLIMFLAVEPAVVLLTFLASAPSEYSRDLLLLYLVMVA
FT                   VFAPLLAYGAYVSRRIEEWRD"
FT   gene            389088..389462
FT                   /locus_tag="ASAC_0384"
FT   CDS_pept        389088..389462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0384"
FT                   /product="Prefoldin subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18791"
FT                   /db_xref="GOA:D9Q0F3"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR012713"
FT                   /db_xref="InterPro:IPR027235"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F3"
FT                   /protein_id="ADL18791.1"
FT                   /translation="MPPEAEVKYNKYLQLRDTYNAIVQQRLAAESSLSEIEKVIETLNG
FT                   LSDSAEVYKMAGFVLVKSTKGDLLKELQDRKENLELKIKALKNQENLVKDELDKVAGEL
FT                   QRLLQGAVGGGGAAGPAGGS"
FT   gene            389466..390482
FT                   /locus_tag="ASAC_0385"
FT   CDS_pept        389466..390482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18792"
FT                   /db_xref="GOA:D9Q0F4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F4"
FT                   /protein_id="ADL18792.1"
FT                   /translation="MRAGPGSPGSQELYEELTKLVKGSGVKVLMHGNADLDAVASALLV
FT                   CRLLEGVSSSCCLYSPQGLSKQSRELLTSLSLDIPLCDSLDNQQAGVLITVDASNISQL
FT                   GVNGDALRGAKLVVIDHHSPGSLHTMATLLISDESAPSCVEVVLSLAAPGILKLKPTEA
FT                   TLLLTAILEETSFLERASISTFRYIVKLMEMGADYAFAVSFLRQSNDEPIDKRAARLKG
FT                   LSRAAVSVVCGQLAVAVTHVGSFEAEVARSMISLGADVAAVINDERVSLRVSRRALKLN
FT                   IRASELAAFIAERLGGEGGGHDGAAALRLKSPNQTTIDKVLGLAVNFVRQRCGDASG"
FT   gene            390469..391227
FT                   /locus_tag="ASAC_0386"
FT   CDS_pept        390469..391227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0386"
FT                   /product="Repair endonuclease XPF"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18793"
FT                   /db_xref="GOA:D9Q0F5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F5"
FT                   /protein_id="ADL18793.1"
FT                   /translation="MPVVEGSATKRTRVYADVREEASGVPSLLESLGVLVIRKQLPEGD
FT                   YIIPPDIVVERKNAKDFVSSLFDGRLFDQASRMRNDYEEVFYIIEGDFSRELRYWSDKE
FT                   RQLIGALATLVASYNVKLLWSGSARQTAEYLASLASKYLTKGRGSRPVIINKKPSAQSL
FT                   REWQLYIVESFPGIGAKTAERILEKFGSLESFFNASLAELASVEGVGESKAARIKELLK
FT                   APFKGERRVTTLDKFYGNPAGANSSSDNDK"
FT   gene            complement(391236..392168)
FT                   /locus_tag="ASAC_0387"
FT   CDS_pept        complement(391236..392168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0387"
FT                   /product="Geranylgeranyl pyrophosphate synthetase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18794"
FT                   /db_xref="GOA:D9Q0F6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F6"
FT                   /protein_id="ADL18794.1"
FT                   /translation="MKQEYSEEEFRAILSKWESTRTMIEPELNSIVSRLEMAGLEGLAS
FT                   YIVKGGKMFRGFMTMLFAEAAGGNLDRAKDAAIAVELVQGASLALDDIIDKDAERRGGP
FT                   SAWVLYGIGKSAMASLLLVPTALKLVEQYGPLALSYSITAWESMVRGEIMDAYSSLNLE
FT                   PVEYLQLASLKTGSLFSLASTLGVIAANHEEYAERAWNYGNIVGTAYQLADDITDFANY
FT                   ARGAKDKLDPSERLFLRWAETELKARGEDEVIEKGVEYLNDILKRSISSLSFLPPGPAT
FT                   KMIAELPWFMASKMLESANLSLSKFDQQP"
FT   gene            392243..392950
FT                   /locus_tag="ASAC_0388"
FT   CDS_pept        392243..392950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18795"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F7"
FT                   /protein_id="ADL18795.1"
FT                   /translation="MKEQWETVTDGSLLLGVAALVLDLVEGYYTAEGSLLDAKVSSKIL
FT                   DVTSIREGLSRGSLELYINADWVEPQELDFRGAKISIKATDASQGGLLPLRQLYEELPR
FT                   ELVRLDYFPLYSPLASRTDRDGTEYIIVYTADGRAFVFEGERFRVSLPGLRQSPAVVHT
FT                   HPAGHCGLSRKDLESGLDLMMDRGLIMGAVTSDRCAAIMYRLGLLEEDDVIGVKEGRIE
FT                   NLRSLRFTRISII"
FT   gene            complement(393015..395210)
FT                   /locus_tag="ASAC_0389"
FT   CDS_pept        complement(393015..395210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0389"
FT                   /product="Elongation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18796"
FT                   /db_xref="GOA:D9Q0F8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F8"
FT                   /protein_id="ADL18796.1"
FT                   /translation="MVSEIEKIMSNIEQVRNIGVIAHVDHGKTTTSDALLAGAGIISER
FT                   VAGEALALDYLNVEKERQMTVKAANASLYHEYNGKGYVINLIDTPGHIDFTGMVTRSLR
FT                   VLDGAIVVVDAAEGVMTQTETVLRQALEERVRPVLYINKIDRLIKELRLTSSQLQDRLV
FT                   EIIKDVNNLIDMYAEPEFKDKWKLNPAAGNVAFGSAKDQWGITVPIASKKGINFQQIID
FT                   AYSSDDKDKIAALTKKAPLHEALLDMVVKFVPNPKEAQKYRIPKIWKGDLNSDLGKAML
FT                   EADPNGPVVFYVNAIHVEKAGLVATGRVFSGTLEPGKELYVVSQDVTGRVLQVSLYMGP
FT                   FRELTQRVTAGNIAAIMGIDNLRAGETLVESQYKSQGAPFEQLHYIAEPVVTIAIEPAK
FT                   VQDLPKLVDSLRKLTIEDPNLVAKINEETGEYLLSGMGQLHLEIALWMLKEIYGLEVKA
FT                   SQPIIVYRESVREKSQVFEGKSPNKHNRFYLSVEPLNDETIDLIHRGAVREDQDSRDRA
FT                   KILKEQAGWDYDEARRIWAIDENINVFVDMTSGVQYLKDVKDTIIGGFRIAVKEGPLAA
FT                   EPVRGIKVVLHDAEVHEDPVHRGPGQIYPAVRNAIWAGILTSRPTLLEPIQKLDIRIPM
FT                   EYLSAVTTIIVKKRGKIIDVENTPSGTRVLAEIPIAESFDLAAELRGSTAGKALWGTEF
FT                   SRWAPVPDSMLDDLIRKIRERKGLPQKLPSLSDLLGP"
FT   gene            complement(395314..395781)
FT                   /locus_tag="ASAC_0390"
FT   CDS_pept        complement(395314..395781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0390"
FT                   /product="hypothetical protein"
FT                   /note="DUF371 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18797"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0F9"
FT                   /protein_id="ADL18797.1"
FT                   /translation="MSELASRWFHFRAKGHVNVTARHRTTIEITKEETLTPRGDCIIGV
FT                   SSEASASSLPDWLRDELRNPNNAVLVVLCSSGLCDAVIGHGDPRITASNNMKIIIRKSD
FT                   YVEGSTIMVRSNKAAADLNRELISRLAHGDDLHVYITYLPLITSNSHKNNI"
FT   gene            395864..396535
FT                   /locus_tag="ASAC_0391"
FT   CDS_pept        395864..396535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0391"
FT                   /product="Protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18798"
FT                   /db_xref="GOA:D9Q0G0"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G0"
FT                   /protein_id="ADL18798.1"
FT                   /translation="MAGLKQDAFEVARRKLVDDLKLRGYLKSQAIERAMLSVPRELFVP
FT                   EGVRDRAYEDRPLPIGYGQTISAPSMVAYMTELLEVSEGMKVLEVGTGSGYQAAILAMI
FT                   VGDRGHVWTVERIAELASRAKETIESLGLGGRVTVIVGDGSLGYPPAAPYDRIIVTAAS
FT                   PKVPRPLVEQLAEGGLMVIPVGSKEEQVLTIVRKREGQVFQQSDIEVLFVPLVGAEAWD
FT                   H"
FT   gene            complement(396692..398140)
FT                   /locus_tag="ASAC_0392"
FT   CDS_pept        complement(396692..398140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0392"
FT                   /product="Prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18799"
FT                   /db_xref="GOA:D9Q0G1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G1"
FT                   /protein_id="ADL18799.1"
FT                   /translation="MVKTKRERWHNNFSEWFDWILDRAEIYDYGRYPVKGMGVWMPYGF
FT                   QIRRRVTDLLRKLLDETGHEEVLFPLLIPDWMLAKESEHVKGFEDEVYWVTHGGLEELD
FT                   QKLALRPTSETPITYYESLWVQSYKQLPRKFYQIVSVFRYETKATRPLIRVREISMFKE
FT                   AHTVHESFEDAESQVKEAIDVYRKFFDSLGIPYIISRRPDWDKFAGALYTIAFDTVMPD
FT                   GRTLQIGTVHNLGQNFTKAFSFRIQTRDEKFDYPWQTSYGVSDRVVATLIAIHGDDMGL
FT                   VLPPDIAPTQAVIIPIPSQSEEDSRKVLEYSRGVLSTLLSSGIRAKLDDREDTTPGDKY
FT                   YYWDAKGVPVRVEIGPREASGNTVTIVRRDTLEKRTVPLSEAVGSIKKTFDEISAYLIE
FT                   RARKFLADHVSRVSSLDEARKAINEKGGVIEVPWCGSEECAVKVMNELQVKSLGTPWPY
FT                   ERAEGTCPVCGRPAVTYMRFSRQY"
FT   gene            complement(398203..398613)
FT                   /locus_tag="ASAC_0393"
FT   CDS_pept        complement(398203..398613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0393"
FT                   /product="V-type ATP synthase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18800"
FT                   /db_xref="GOA:D9Q0G2"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G2"
FT                   /protein_id="ADL18800.1"
FT                   /translation="MVSRKSYLEGLSLVLREAWSRPKYRAVLILVALVSLAAAIATGLA
FT                   VSHAQAAATADQASPYYMSVVGKAIGAGLAVGLAGIGGGYAVAVAGASAISAVAEKREI
FT                   FGTAFLFVVLGEGIAIYGLLVAIIVVFVLPTA"
FT   gene            complement(398720..399271)
FT                   /locus_tag="ASAC_0394"
FT   CDS_pept        complement(398720..399271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0394"
FT                   /product="Probable deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18801"
FT                   /db_xref="GOA:D9Q0G3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G3"
FT                   /protein_id="ADL18801.1"
FT                   /translation="MILSDRDIETLIRAGELGIEPLDDEVIRENGLDLRLGSTYCEFRS
FT                   TGTVLDPRSPGDPGEFYDCRDAGEGGSFIIAPHRHYLLHTAEYIRLPPYVAGLVNLRST
FT                   WARTGIYIPSTVVDAGFEGQLTIEVIGSEFPVKLYVGDRFLHLVLVKMETPSTRPYSGR
FT                   YRGQKGVRLPQFFGEMQAKT"
FT   gene            399444..400202
FT                   /locus_tag="ASAC_0395"
FT   CDS_pept        399444..400202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0395"
FT                   /product="hypothetical protein"
FT                   /note="DUF1614 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18802"
FT                   /db_xref="GOA:D9Q0G4"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G4"
FT                   /protein_id="ADL18802.1"
FT                   /translation="MDRDEIQNRKVLITYPTHPMFLWAYLAVALILAVLFSRFPLYVAE
FT                   VSYSSDSLELASIAIALIVLSPILSFINLVIKKLNTGVIASEIELNYVEFFGIPIPIPR
FT                   LRMREVKTLLAMNVGGALVPITTSAIFSYLLVNSPYKGMFVASAAIDVIVVAAVTYALS
FT                   RPMPGVGIVVPAFIPPLIAAFVAIATSGFGVPAAAAAYIGGSLGSLLGADVIRLSRSYR
FT                   NLTATVLSIGGAGVFDGVFMSGVLAFLLAI"
FT   gene            complement(400199..401254)
FT                   /locus_tag="ASAC_0396"
FT   CDS_pept        complement(400199..401254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0396"
FT                   /product="Predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18803"
FT                   /db_xref="GOA:D9Q0G5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G5"
FT                   /protein_id="ADL18803.1"
FT                   /translation="MASEYHDCIAIKLTDADRTLKMLRLAGLLTNLKPRRLGSDELAVP
FT                   VNNVERAISALLTEGISARPCKETFDVKGRPSKLSDEVPGLSGFLIIGSIVLLNYNSSV
FT                   GIPAYVRAAEAISRMYPRVTSVFLKLGTTGELRLPQLVLIYGDGNTITITKESGLRLYV
FT                   DVARTYFNPRLSGERLRISSLVESGERVLDMFCGVAPFSLLIASRRRASVIANDLNPYA
FT                   AALAGANARLNRKLLKGNVTITRSDASALPSLLKGGFDRIIMNNPTSSPKFIEAACQLS
FT                   LASGSILHVYYLAESEDLAIRAIAEEASRTCKEFTVVSSRKAIEYSPSKSIYVVDLEVK
FT                   GYARRPNSLSL"
FT   gene            complement(401227..401349)
FT                   /locus_tag="ASAC_0397"
FT   CDS_pept        complement(401227..401349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18804"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G6"
FT                   /protein_id="ADL18804.1"
FT                   /translation="MRGRGRPWRPLSQMPPKYRRRVIASASQVLLTWPVNIMTA"
FT   gene            401671..402537
FT                   /locus_tag="ASAC_0398"
FT   CDS_pept        401671..402537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0398"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18805"
FT                   /db_xref="GOA:D9Q0G7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G7"
FT                   /protein_id="ADL18805.1"
FT                   /translation="MTEREAVGIVARPSSGIAEGLALKAAEVLRQLGVEPLVEAETAAA
FT                   YSNTLGKLGTFNIERDPPHKVIVIGGDGTLLRAAIRSGSNEVVFLAVRAGKRGFLLDVD
FT                   ESVLSERIRDFVNDKYELVLHQRIKAYVNGNQLPCAVNDVVIFTSEGSMVRLDVYHDEE
FT                   KLRERVMGVDGDGLIISTTTGSTAYSLNAGGPIVDPRLDVIIITPLNPVQLFLRPVVMS
FT                   RSNRLSIIMRDESGPAYLVLDGQVKVNLRPGDRVNIYPCEVPLKVARFEWWSNYYERLF
FT                   ARLLSYW"
FT   gene            402554..402955
FT                   /locus_tag="ASAC_0399"
FT   CDS_pept        402554..402955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18806"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G8"
FT                   /protein_id="ADL18806.1"
FT                   /translation="MLDTAALLASVQLHLPLTCVTTEEVYEEVRDEESRAALDLSAGAG
FT                   KLLVITPSAESRSKALEYARAAGVLGKLSAADLSVLSLAIELRDCGNRVSVVTDDYALQ
FT                   LASVHAGLDVVRVRYRGIKELRKGKANLR"
FT   gene            complement(402942..404255)
FT                   /locus_tag="ASAC_0400"
FT   CDS_pept        complement(402942..404255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18807"
FT                   /db_xref="GOA:D9Q0G9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0G9"
FT                   /protein_id="ADL18807.1"
FT                   /translation="MKVSVGSTTKYYIETYGCALSEFDSEIMRSILRGAGYEECKDPRE
FT                   ADVIIVNTCAVRLDTEAKIVKRLKELNGLSLQGKKLVVSGCLSKARPSLILRTAPAASL
FT                   VSPQNVTRILDAVTLDRPIYMLDGERDVNFLPKPPTRDSVATVMISEGCLENCSFCETK
FT                   LARRYLKSYPPRAIVSIVRDLVQGGAREIRLTGQDAAAYGVDLPGKPRLPDLIADILDK
FT                   VPGEYRLRIGMMTPNQAMEIIDDLLDVYRDGRVFKFFHIPVQSGDDRVLKIMNRRYTVA
FT                   EFKELHSKVKAKYPSSLFATDIIVGHPGEDEGAFMNSVRLVEELKFERVYLAQYSIRPR
FT                   TASASMPQVPEPVKKERSLRIQEVIKKIGVEIYGSYVGGRFRGLLASRGFREGFSTVRL
FT                   DNYFPVAVPASTLRSYGEFVDVKITGATYFDLRGVIVS"
FT   gene            complement(404290..404766)
FT                   /locus_tag="ASAC_0401"
FT   CDS_pept        complement(404290..404766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18808"
FT                   /db_xref="GOA:D9Q0H0"
FT                   /db_xref="InterPro:IPR019287"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H0"
FT                   /protein_id="ADL18808.1"
FT                   /translation="MMQILYYLIASIILAELIIIVVQTVRLALAQRSLKTLEMNIDKLA
FT                   DARAREMAAAIVDRAREDAAKRSSAVTAGKIYEQLAPILPGFKFNPKDVRFLGSPVDFV
FT                   VFDGLEDGKRVYVRFVELKSGDSKLTDREKAVKDAVESCRVSFEVVKAEDLLRR"
FT   gene            404839..406449
FT                   /locus_tag="ASAC_0402"
FT   CDS_pept        404839..406449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0402"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18809"
FT                   /db_xref="GOA:D9Q0H1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H1"
FT                   /protein_id="ADL18809.1"
FT                   /translation="MPETKYVFITGGVMSGIGKGIVSASTGLLLKSRGYRVGIVKVDPY
FT                   LNVDAGTMNPYAHGEVYVTEDGGETDLDLGHYERFLGENLSKKHNITTGQVYYNVIMKE
FT                   RKGEYLGKTVQIIPHITDEIKQRLSSVARETGVDVLVVEIGGTVGDIEGLPFLEAARQM
FT                   YVELGSNNVAFVHVAWAPVLSTTGEQKTKPVQHSVYELRRIGIQPNMVVVRSPRPLEAE
FT                   SRQKIALFSNLSPSDVISDHDVDYVYEVPLLLESQGYAARLLSRLGLQDREPDLEAWKS
FT                   FVDRLKSIEKTVNIAMVGKYTKLRDSYLSIVEALRHAGVAVGVKPNLVWVEATEVEEGK
FT                   IKVEDVLSTVDGAVVLPGFGKRGAEGKIRAIKYLRENNIPTLGICFGLQLSVVEFARDV
FT                   VGLENANSTEIDPSTPYPVVDLLPWERDVKELGGTLRLGASQINLVKGTQLYDLYGRDV
FT                   IYERHRHRYEVNPKYVEKLVEAGLIVSAWSPQGLVEAAELPRKEHKFFIGTQPHPEFKS
FT                   RPLSPSPPYVGLLRAAQTK"
FT   gene            406570..407160
FT                   /locus_tag="ASAC_0403"
FT   CDS_pept        406570..407160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0403"
FT                   /product="transcription elongation factor NusA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18810"
FT                   /db_xref="GOA:D9Q0H2"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H2"
FT                   /protein_id="ADL18810.1"
FT                   /translation="MQIPLDKICVKSGVLCDKCKAKIDSGKYQGWEVDVMRALLNLESN
FT                   FRELKNASYRKSVIVGDTLYIVLDNVTVVSRQLARALEKELSSLNIRRIFVVPGSNDPR
FT                   KLIESLLPSQVLSVNTYYAPDGSTYYIAKLPSNERWRISELEQSTKAVFKSLSGSDLYI
FT                   EYENVTVPGRPRDLEESKIDKTKLSDVLRRIGS"
FT   gene            complement(407349..408401)
FT                   /locus_tag="ASAC_0404"
FT   CDS_pept        complement(407349..408401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0404"
FT                   /product="flap endonuclease-1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18811"
FT                   /db_xref="GOA:D9Q0H3"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H3"
FT                   /protein_id="ADL18811.1"
FT                   /translation="MGVNIRDIIPDQARREVDLKALKGYVIALDGYNMLYQFLSAIRQP
FT                   DGTPLKDSQGRVTSHLSGLFYRTINLVEEGLKPVYVFDGKPPEMKRKEIEERVARKKEA
FT                   AEKYAKAKESGSIEEARKYAQATSELSSDMVSEAKRLLDYMGIPWVQAPADGEAQAAHL
FT                   AQKGDAWAAGSQDYDSLLFGAPRLVRNLAITGKRKLPNKDEYVEVKPEIIDLNAMLKAL
FT                   GITREQLILLGILVGTDFDPDGIKGYGPKTALNFVKGVKDVTKALESIKSQLPGDVDPF
FT                   KIFDYFAKPPVSSDYRILFKEPDVEKIKELLVREHDFSEDRVVKAAERLAKAFKENLRG
FT                   KQSRLDMWFG"
FT   gene            complement(408439..408687)
FT                   /locus_tag="ASAC_0405"
FT   CDS_pept        complement(408439..408687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18812"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H4"
FT                   /protein_id="ADL18812.1"
FT                   /translation="MYETLREMTSDGKVPVTDEEVLSYLIKNGYSISLADLTKILLKLE
FT                   IMGLVRVSSSTKEDRQIEFVGRHGNAEEAKSVEEQQT"
FT   gene            complement(408894..411116)
FT                   /locus_tag="ASAC_0406"
FT   CDS_pept        complement(408894..411116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0406"
FT                   /product="Cell division control protein 48, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18813"
FT                   /db_xref="GOA:D9Q0H5"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H5"
FT                   /protein_id="ADL18813.1"
FT                   /translation="MAENNSNQNQQRPPSKEVVLRVSETKPRDSGRKRVRIDIDIMKEL
FT                   GVEAGDIVEIEGKKKTAAIVWPALPEDAGLDIIRMDGSLRRNADVNIGDKVIVRKAEPK
FT                   QAIRVKLAPTIHSISIDDSFKKYVKKKLIGLPLVENDIVQIPVIGQAVQLVVIDTKPRG
FT                   VVVVTEKTAVDVLEKPITTSFPKVTYEDIGGLHEVIARIRELVELPLRHPELFSRLGIE
FT                   PPKGVLLYGPPGTGKTLLAKAVATESDAYFVAINGPEIMSKFYGESEQRLREIFEEAKK
FT                   NAPAIIFIDEIDAIAPKRDEVIGEVERRVVAQLLALMDGLEGRGQVIVIGATNRPNAID
FT                   PALRRPGRFDREIEVPVPDKQGRLEILQIHTRHMPLADDVDLEKLAEMTKGYTGADLAA
FT                   LAKEAAMHALRRYLPEIDIDQEKIPTELLERMVVTMQDFLAAFKEVTPSGLREIEVEVP
FT                   EVHWSDIGGLEDVKQELREIVEWPLKYPNSFSRLGIEPPKGVLLFGPPGTGKTMLAKAV
FT                   ATESGANFIAIRGPEVLSKWVGESEKAIREIFKKARQYAPAVVFFDEIESIASLRGTEE
FT                   DSNVGERIVSQLLTEIDGITNLENVVVIAATNRPDLVDPALLRPGRFEKLIYVPPPDEK
FT                   GRLEILKIHTRNVPLAEDVDLAELAKMTNGYTGADLAALVREAALTALREDINSPIVKF
FT                   KHFEQALNKVRPSVTKYMIDFYLRWLETARQISVSSQRPSQPSLSL"
FT   gene            411279..411524
FT                   /locus_tag="ASAC_0407"
FT   CDS_pept        411279..411524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18814"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H6"
FT                   /protein_id="ADL18814.1"
FT                   /translation="MQQKKFTLDINSYHIIRWDPKVQGEDDLRKMLADSLKKGAKRVAI
FT                   IVKSDDVDYMVKAREVIAGFIAQTIVIFKEKEVEIA"
FT   gene            411536..413032
FT                   /locus_tag="ASAC_0408"
FT   CDS_pept        411536..413032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0408"
FT                   /product="predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18815"
FT                   /db_xref="GOA:D9Q0H7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H7"
FT                   /protein_id="ADL18815.1"
FT                   /translation="MITTDRSMMTDHHHHEFLGFMTTGPAFGVPEWVWRWIAAPKPKVD
FT                   SLGRPKVAPYGLRKIEAALVDAGFNAAVVDPDHISKHLDTMKVLMIGHHDFFAYGPPSS
FT                   EWWTITGREPFNRVSFRRFMESPAVREAKRRGVKIIVGGPAAWQWLWSTDEWKKWGVDT
FT                   VIDGEADRVVSEVVDRAIKGQELPDYIYVGPYDTPATADEIPKIKHASVNGLVEIMRGC
FT                   PRGCKFCSVTLRPWRFIPVDDVISEIKVNMSEGEKGIILHSEDVLLYYADGIKPRPEGL
FT                   LKLHTAVRQLTDEPIGWSHASLAAIKYAEDNYKLISKLTEIMFSSEKQRYLGVEVGLET
FT                   GSVKLARKVMPAKSAPYPTEKYPEVVEDAFAIMHEHNVIPAATLIIGQPGEEPDDVVAT
FT                   TELVEKLRPYRSLIVPMFFVPMGAFKNMEWFRRNMVRPEHVELLRATLRHSAYWARDIV
FT                   DRFYLKGTRYFLVRAAVKWIIGYIERKAEEAARAVEQRGA"
FT   gene            413022..414011
FT                   /locus_tag="ASAC_0409"
FT   CDS_pept        413022..414011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18816"
FT                   /db_xref="GOA:D9Q0H8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H8"
FT                   /protein_id="ADL18816.1"
FT                   /translation="MEPKVNGSGSAKRYLVFIVILFALLVLAIFNIVGGGLEHVVYYLS
FT                   RSYDAVLIAAAIIFLEESLKSVRFVIAARSRGLRLSPLRAWEAHFSSLFIGMLTPAFSG
FT                   AIPTATAIIGSATGAPPPEALSVALSATFIDSVVPAAVSLYFAWSLMPRSVVVLLISIT
FT                   IIVIWAMVISRRLTTWFLSEVSRRLNSNAARLIEGEIENMRDSLSHIIASRRSMIPMLL
FT                   VSAASYIIEAFSIYVLTLGGLHGFLIDLEALMMSYVGGNVPTPGGEGGVEYSLALVLKG
FT                   VDAVLWRTAYIIVAMVPIVLLGKIVSGYVDYGSLVYSHYRAMLRGRGG"
FT   gene            414055..415353
FT                   /locus_tag="ASAC_0410"
FT   CDS_pept        414055..415353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0410"
FT                   /product="Asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18817"
FT                   /db_xref="GOA:D9Q0H9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0H9"
FT                   /protein_id="ADL18817.1"
FT                   /translation="MMSVSFMSSREVVASSEGSRVKLRGWVYRKRDLSSKIFIVVRDSE
FT                   GIVQCVVDRSNEELSKAAEKVTIESSVEVEGVVRSDQRAPGGKEVNVERLNIVGLADDF
FT                   PIKGGESVDYLLDIRHLWLRSRRLTQIMRIRATVLEALRNYFISNGWWEVSPPILTQSA
FT                   VEGGATLFPVDFFGRKAYLSQSAQFYLEVMIFSLERVWSLTPSFRAERSRTRRHLYEYW
FT                   HLEGEAAWMDMHDMMKFVEGLVKSAVKAVLDKRQEELQFLRRNQEPLEETLKSSFEEVT
FT                   YDEAIERLQKRGFKIKWGDDIGADEEKALTQDLSVPFFLTMFPKHLKSFYMKTCDRRPE
FT                   VVLGFDLEAPEGYGEVVGGSQREDRYDVLLQRIKESNLNPDDYQWYLDLRRYGSVPHSG
FT                   FGLGVDRLVMWIAGLDHIRDSIPFPRLRERIYP"
FT   gene            415350..416129
FT                   /locus_tag="ASAC_0411"
FT   CDS_pept        415350..416129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18818"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I0"
FT                   /protein_id="ADL18818.1"
FT                   /translation="MKVCGLLSGGKDSNYAFYMALREGAEVSCIVSAAPAREDSWMFHR
FT                   PLVEFVKLQAEAMGFGDRYHTIGVSGVKESEVSELREGLRKLKAMYGFDTITVGGIASR
FT                   YQYERFRAIAEDLGVKVYDPQWGMDPEEYMKELVRKGVVFVISQITTEGLDMRMLGVPV
FT                   QELSQVEEILRLSRRYGFHPAFEGGEAETFVVMAPHFKKGICLRASREKIAEYQYVLSV
FT                   SSAQLCDDVAISVDSEVYHVFRRRDELASTAFRSSSS"
FT   gene            complement(416790..416918)
FT                   /locus_tag="ASAC_0412"
FT   CDS_pept        complement(416790..416918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18819"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I1"
FT                   /protein_id="ADL18819.1"
FT                   /translation="MPGPVETSVASLKGLLAVGAVESKLKAFKYSPTERSGDALVL"
FT   gene            416933..417010
FT                   /locus_tag="ASAC_R0018"
FT   tRNA            416933..417010
FT                   /locus_tag="ASAC_R0018"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            complement(417027..418085)
FT                   /locus_tag="ASAC_0413"
FT   CDS_pept        complement(417027..418085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0413"
FT                   /product="Peptidase family M50 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18820"
FT                   /db_xref="GOA:D9Q0I2"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I2"
FT                   /protein_id="ADL18820.1"
FT                   /translation="MDYQHDPAYQVAIKYMDLTERAELEGGAVKYKVIGVKGDLTHSFK
FT                   SLYKELVRIGLAPALRKESDGSLTLIVTKYSRGSNLALLIGLAAFTIVTVYVSGMALTG
FT                   LPGGGGLTPLLYMVGLLGPLLIHEAGHWAFMRRFDVPRSPPYLIPAPPLQLGFLGTLGA
FT                   VINMKWIPATADELALIGVAGPLAGFLAAIPVALLGLHMSALVPAAAVPPSSSLPAVPV
FT                   IMDLLLAFIHTPSGYVVEMSPLSFAAYIVFFVTFLNLIPVGQLDGGHVLRAALGERGHM
FT                   LISLVFVVTLLIAGLYLPTLGLFGIIALFLLLLTRGRHPGPAIETSRLSWPGIVAIIIY
FT                   GILLALTLPIPA"
FT   gene            complement(418152..419006)
FT                   /locus_tag="ASAC_0414"
FT   CDS_pept        complement(418152..419006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0414"
FT                   /product="Probable diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18821"
FT                   /db_xref="GOA:D9Q0I3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I3"
FT                   /protein_id="ADL18821.1"
FT                   /translation="MLILVGSGLRESQLTREAEEAIKGADIVIVETYTMPSSKWLPTAV
FT                   RKLNSNVREASRSELEELSSNIVELAFKLKVVLVVPGDPLIATTHSSLVVEGLKRGVEV
FT                   KVVSGISGPCSVESLLGLHFYKFGRTVTVPGPWRGVGAEEAALGLLGNLCHDLHTLLLL
FT                   DVSPEGLSLSPSRAVKELKESLRRLIGTKLDELMNMMVLLVSVGENTIVKHFTLGNADS
FT                   IPDVDVGSLVVPSRLHVSEREFLRYAYSVPEDIMMSHNKLLQGFDACSAYSEALRVMYS
FT                   SSA"
FT   gene            complement(419072..419572)
FT                   /locus_tag="ASAC_0415"
FT   CDS_pept        complement(419072..419572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0415"
FT                   /product="Putative transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18822"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I4"
FT                   /protein_id="ADL18822.1"
FT                   /translation="MTEAEEETKGAVRYRDTLIWFMLFILSEKPMHGYEIIKRIRELTM
FT                   NQWKPAAGSIYPLLSYMKDLGLVDIANIEENKVRGGKKITYTLTDKGWEEFRELLLKKS
FT                   DLYMNFLSFIVKNSIRRLREHGYNEDASLLCNRVSNWTKELIESAQSECGDLKAANQPN
FT                   KAQ"
FT   gene            complement(419735..421798)
FT                   /locus_tag="ASAC_0416"
FT   CDS_pept        complement(419735..421798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0416"
FT                   /product="V-type ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18823"
FT                   /db_xref="GOA:D9Q0I5"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I5"
FT                   /protein_id="ADL18823.1"
FT                   /translation="MIIANRLEEVLIAIPNEQYDRAVAALASLGIFHVEEPSGDLSRYV
FT                   NRSYRRLMTESTELKSRLEGFFKTAGLAPSSNINVTIKVSSWEETFNSVVKVHVNLEKD
FT                   LEKLSARATELTARIAELQNIALALEPFKGLSSDVRSAWEGGNIKASAGIVSAAQLDNA
FT                   ISIASRRGLLYAIELIGKDTAIFAVAGEPGQVRDATAELTRSLGWRQLVLPPELPGSPS
FT                   QAASQVSDELSKLSSELEDIKSDIKKRLPELEEYYAEVSALSEVFKILSYSAKTETITF
FT                   IHGFVDTKDSKKLRESLDACCNGSYMVLSLGFKRGESYVPSKVELPGYFRWFQSIVDMY
FT                   GTPSNNEIVPTLFLAITMPIIFGLMFPDIGHGLLVLLFAALYILPRDRNLGKVVVVLGA
FT                   AGMVAGFFAGEFFGPIPAHFVGLDSLWRSLGFKVPPLESPVAEAYEHPSSNYTMLLFDE
FT                   ILDLSFWIGGFMLVFGNALGVADDLISHDYEDLVARRAPLLLLFLAADLPFLAYFNAYR
FT                   AGYVIELAVFDLGRGGPMEAFVFYGGIASVIWLVLGDGLYKASVGEGFRLDPYESFLGV
FT                   FEGLIMALGNTISFLRIMGLSLAHAGLMVGFTVLTYVVLTAHPTPYTITAAAVIYIIGN
FT                   LLTAGLEGIVAFAHDLRLHFYEWFNKFYRGLGVPFNPIRVPGVTFVILPTSS"
FT   gene            421967..422275
FT                   /locus_tag="ASAC_0417"
FT   CDS_pept        421967..422275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0417"
FT                   /product="Putative V-type ATP synthase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18824"
FT                   /db_xref="GOA:D9Q0I6"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I6"
FT                   /protein_id="ADL18824.1"
FT                   /translation="MSAGEESNVVVVGDKETLPLFRMIGMDVVEANDQRSAEEAVRQAA
FT                   SKGTRLIIVLKHLVSDEDSLRKVARQYDATLLVLPTKWAKSEPINIEKLLAEALGLG"
FT   gene            422281..422880
FT                   /locus_tag="ASAC_0418"
FT   CDS_pept        422281..422880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0418"
FT                   /product="V-type ATP synthase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18825"
FT                   /db_xref="GOA:D9Q0I7"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I7"
FT                   /protein_id="ADL18825.1"
FT                   /translation="MSMSGNPDKVATDIVKKKLASFNSMLSEAEGAAEKLLLSAYSDAE
FT                   RRLRNSIEAKATELKERLRSDMAAADLQVKLKEDEIKDRAISEVINEAISRLRSDRGEW
FT                   YTRYIKSVIEELAEESKEYGGFIIQVNNDDRKLVSDMIKAYPTLELSEKTADITGGLIA
FT                   ISKDGSLRVDYSIDQFIKENFSSLRGLASRALFGSE"
FT   gene            422883..424688
FT                   /locus_tag="ASAC_0419"
FT   CDS_pept        422883..424688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0419"
FT                   /product="V-type ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18826"
FT                   /db_xref="GOA:D9Q0I8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I8"
FT                   /protein_id="ADL18826.1"
FT                   /translation="MVVRGRIYRISGPLVIAEGMTGAQMFEVVRVGEEGLIGEVTRIRG
FT                   DMAYIQVYESTSGLRPGEPVEGTGAPLSVDLGPGLIGSIFDGVQRPLPSIVATIARTNP
FT                   ARSIFVERGVTVPPIPRDKKWHFTPSDRVKPGDKVGPGDIIGVVEETQIIQHKILVPPN
FT                   VEGTVKWIAGEGDYTIVDPIAEIDVGGGEIKQLYLYQRWPVRQPRPYVQKLEPTEPLIT
FT                   GMRIIDLLFPMAKGGTGMIPGGFGTGKTVTLHNLAQWSSANVIIYIGCGERGNEMTEVL
FT                   DKFPTYKDPWTGRPLMERSILVANTSNMPVAAREASIYVGITMGEYYRDMGYDVLLVAD
FT                   STSRWAEALREMAGRLEEMPAEEGYPSYLASRLAEFYERAGRVRTLGEPSRFGSVTVIG
FT                   AVSPPGGDFTEPVTTHTRRFTKVFWALDTALAYSRHYPAINWITSYSAYSDTVAEWWHK
FT                   NVDPRWSEYRQEVMNILIRENELREIVRLIGTEGLSEQDKLILETARLIKEGLLKQNAF
FT                   DPIDTFTTVQKQMALMRMFVEFYRAASDAVRRNVPVNKIKDSLGRMYSYMMRARFTIPN
FT                   DKIDEIDKMTRDIVNIINNIGGGQA"
FT   gene            424685..426088
FT                   /locus_tag="ASAC_0420"
FT   CDS_pept        424685..426088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0420"
FT                   /product="V-type ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18827"
FT                   /db_xref="GOA:D9Q0I9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0I9"
FT                   /protein_id="ADL18827.1"
FT                   /translation="MSVLGAREYSKISEIRGPLLIVEGVSRVAFDEIVEVELSSGERRR
FT                   GRVLEVAGNTAVVQVFEGTTGISTTGARVRFLGRTLEMPVSADMLGRTFDALGKPIDGG
FT                   PDIIAEEKYDINGSPINPAVRAYPEDFIQTGVSAIDGMNTLVRGQKLPIFSGTGLPHNE
FT                   LAAQIARQATVRGEEEEFSVVFAAIGIKYDDYMFFRKFFEETGAMKRVAMFVNLADEPA
FT                   MLRLVTPRAALTLAEYLAYENDMHVLVILTDMTNYAEALREISAAREEVPGRQGYPGYM
FT                   YSDLASIYERAGRVHGRKGSITQMPILTMPNDDITHPIPDLTGYITEGQIVLSRDLYNR
FT                   GIYPPINVLMSLSRLMKEGIGAGKTREDHAQVSDQLYAAYSRGVELRSLAAVIGEESLS
FT                   ETERKFLRFADLFEKKFLSQGLRENRSIEQTLDIAWEILAELPEDELTNIREEMIKKYH
FT                   PKYRSQGAS"
FT   gene            complement(426160..426849)
FT                   /locus_tag="ASAC_0421"
FT   CDS_pept        complement(426160..426849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0421"
FT                   /product="Probable uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18828"
FT                   /db_xref="GOA:D9Q0J0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J0"
FT                   /protein_id="ADL18828.1"
FT                   /translation="MSERKVAVVKLSGSLVSPPSPLYLRRLRDSVERARSSGWRLGIVV
FT                   GGGATARSYITALRELGVPESILDEVGIESAVLNAMAVASALYPYSPIEIPRNVREALT
FT                   VFEEGLIPVLGGLQPGHSTNAVAAVLAETIGADLLLNLLNGVAGVYAGGAPGEPGARLL
FT                   RAATYDELENIVRDKRSLAGTYELFDSVAVSVVRRSHIKVRFVDGRDPEVIQRILLNQE
FT                   DLGTLVG"
FT   gene            426983..427378
FT                   /locus_tag="ASAC_0422"
FT   CDS_pept        426983..427378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18829"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J1"
FT                   /protein_id="ADL18829.1"
FT                   /translation="MTLEVDMGKYKSVKVPLDVAEKLIVDVSKRLNIESKDVMESLRIV
FT                   RNFDEFYEFQQKKFKDYVVPDKDISDMIKGAVVVDSLKLIKEGSSKEVVVTFDRRINES
FT                   VIIDSLRSLGFDVEVKRFDLMQFLKAK"
FT   gene            complement(427432..427818)
FT                   /locus_tag="ASAC_0423"
FT   CDS_pept        complement(427432..427818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0423"
FT                   /product="V-type ATP synthase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18830"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J2"
FT                   /protein_id="ADL18830.1"
FT                   /translation="MSEDQEESKETEEVTTEESSEAESEKTSEEAETLEYKVSSPELLQ
FT                   IMLDAFDILEEAEEGKITVDEAKALYLEKVEDALKKVGESVKKRRRRGSRSKSIAKKSS
FT                   TRKRRKGSKSRGESESQKEPGASS"
FT   gene            427911..428198
FT                   /locus_tag="ASAC_0424"
FT   CDS_pept        427911..428198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0424"
FT                   /product="DNA-directed RNA polymerase subunit K"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18831"
FT                   /db_xref="GOA:D9Q0J3"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J3"
FT                   /protein_id="ADL18831.1"
FT                   /translation="MPEQVKLHPTSKEEIVIGPPYLTKYERAKIIGLRALQLDSGALPL
FT                   VDVDKINVRRDSVEIAAYELDHGLLPISIVRYTPSGAVQIIPVKLLLQDQ"
FT   gene            complement(428173..428289)
FT                   /locus_tag="ASAC_0425"
FT   CDS_pept        complement(428173..428289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18832"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J4"
FT                   /protein_id="ADL18832.1"
FT                   /translation="MTASGRSINEGSCSMYLPALKELSARFRSETIDPAVGA"
FT   gene            428416..428715
FT                   /locus_tag="ASAC_0426"
FT   CDS_pept        428416..428715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0426"
FT                   /product="50S ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18833"
FT                   /db_xref="GOA:D9Q0J5"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J5"
FT                   /protein_id="ADL18833.1"
FT                   /translation="MVKAPKGYRHRTRKLLTKDVREKGAIPRASVMFYPYKVGDKVAIK
FT                   IDPSFHKGMPHRRYHGLTGTIVGVRGRAYVVSVPVGDSVKTIITYAAHLRPLKA"
FT   gene            428734..429090
FT                   /locus_tag="ASAC_0427"
FT   CDS_pept        428734..429090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0427"
FT                   /product="DNA-directed RNA polymerase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18834"
FT                   /db_xref="GOA:D9Q0J6"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J6"
FT                   /protein_id="ADL18834.1"
FT                   /translation="MLRRIESRRYLTYAEARKILEDRIAESGGALNPTQDRTWQYLKLF
FT                   GTTDPAAAREAVDSLVKEGLDEYLAVQLVNMCPNEDGYINAILSSKEGLEIKEELLAKV
FT                   KETLSKVCTQSPSK"
FT   gene            429262..431301
FT                   /locus_tag="ASAC_0428"
FT   CDS_pept        429262..431301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0428"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18835"
FT                   /db_xref="GOA:D9Q0J7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005739"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J7"
FT                   /protein_id="ADL18835.1"
FT                   /translation="MRSSRDCNIPQYYDVIIAEKPKAADKIAHALGSPFRCAIGRVPIY
FT                   ILNVNGTNIVVVSSAGHMFGPSTGVEGLPVTMIRWEPLWRFDRRSKYLRPYYEVLSRLV
FT                   PKARYFINACDYDIEGSTIGYKIIEAFGDKSRAKRMKFSSLTAAELRQAFRRLQPLDVN
FT                   NAMAGIARAELDWLWGINISRLLMKSYREVTGERLSLSAGRVQTPTLAEAIRRWVKINT
FT                   HVPIPQPSLTARLLHKGVEFTAYPLGWSVSTVKEAREVAKEVKEGMYMEVISLSRASES
FT                   VRPPPPFNLTDLQKEAARIYGLSPYKTQEVAEDLYLAALISYPRTNSEKLPPTLNYREV
FT                   LDSIGRQPKYRGLVGDLLRETGGVLRPREGPADDPAHPAIYPTGEQPTRLDRVHETVYD
FT                   LIVRRFMAAFAPPATLSTVSAVLTDVKARRWEARGLNVAERGWLKYYPFHKFDESQLPT
FT                   LNRGDRPLVRSITVKVSWSGPGLRLSRLSLLEWMEANDLGTKGTRARIIETLYKRGFIT
FT                   SRGSHAEITNLGYAVYKVLSEVAPELMSVSLTRDFERMLDEISMGKASREEVVSRAKKY
FT                   ISELVERQLNSNNIKVMGTYLAEFIGKVRPRSRCAICGRPTDGQSLCELHLAAKSNLEK
FT                   SIDEVARRLGVSKEEALRRISNNRLAGKWVRDVAALMISGKERP"
FT   gene            complement(431298..431834)
FT                   /locus_tag="ASAC_0429"
FT   CDS_pept        complement(431298..431834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0429"
FT                   /product="Signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18836"
FT                   /db_xref="GOA:D9Q0J8"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J8"
FT                   /protein_id="ADL18836.1"
FT                   /translation="MSQSPKARREGLEAAPLGLVALIVVIVALTSLIAYWHVAYGLQAV
FT                   VVDGRSMLPTLQTGDVVFIEKVNPVDIRVGDVVVYKFTGNFYGIYLNDALIIHRVIYKY
FT                   YHNGILCFVTKGDNNPFPDPGYPSICGTVDINGYEVGGTPYFYVKGVVIGGQHPLVIPY
FT                   IGGLSLMFHPSSQQP"
FT   gene            complement(432052..434985)
FT                   /locus_tag="ASAC_0430"
FT   CDS_pept        complement(432052..434985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0430"
FT                   /product="predicted ribonucleotide reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18837"
FT                   /db_xref="GOA:D9Q0J9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0J9"
FT                   /protein_id="ADL18837.1"
FT                   /translation="MSSDAKQLELIRASLTRPELEDEAKKLLLLDIYSEVRQAYSGRAP
FT                   NGGKVSELPACVNSICEDDMKFTYNAIRVLMSRYMTKDLRGRYIETPSMVMRRVALGFS
FT                   GRVDPDSLYRAMIEGRFMFNSPTLFNMYADGAKGALSACYVTPVYDDMRGIMDGLTVQV
FT                   MTFKYGGGEGFSFSELRPRGDVVAGTSGVASGPLSFMRLYDVSTDVVKQGGKRRGANMG
FT                   ILHDWHPDLYNPDYDPWKALASTLPPQVSAILEQYRKTLEQLEKDGYYEVDKTALEALT
FT                   RLTSGWQSPEEAGFIQAKRAPMQDAFLTNFNISVGTHDAFMEAVINGQEWWMVNPRYSD
FT                   EGDGIYRLHYSVSRATGEGRALRVLRESRIETPYMNVFEEVVERAKSRIPKDMDTSRRN
FT                   PHGWHYPARRLWEEIVRGAWEGGDPGMIFLDNHNKWVPTPWLGAVAATNPCGEEPLYPY
FT                   ESCNLGSLSLDKYIRDGKFDLDSFAKDVDLAVDGLDAVIDYNRQPDQRQDLVNKFTRKV
FT                   GLGIMGLANALAKLNIPYDSEEAVAFTMIAMAMIEAEAWKRSWELGSRLGHAPAFECRK
FT                   FDWKELKCVEKADPEEMVNLLTPALLKAAEVASIRDGYLTVKYHDVKLSDYIMSQLEGE
FT                   SARRVSADGSVKLLKLEALERVLRDVFGVTEETLSEAERMRPQELAASPRHMLAMAIYD
FT                   PARLWNALKDYGRSLGARAPRHTAVNTTAPTGTISIIAGTTSGIEPYFALVYLRRVTIG
FT                   ELWEVVREFRDRLYSAIAEAGAPAELGEKLLEAISRHKGSLRWALEDVEKAIRDAQLQE
FT                   VDGKIVKANWDAEKLISRIKELAKLFATSMDFDVWYHIAHQAAAQLYTDQAISKTVNLP
FT                   KDASVNAVATAYLTAWLTGLKGVTVYRDESKGVQVIYFGGQQRELNRVPVKLLKKPSMR
FT                   MALIKRSMNAEEALADEKLGGLFKIKKDSNIVEVESDENSTCKTCNL"
FT   gene            complement(435391..435540)
FT                   /locus_tag="ASAC_0431"
FT   CDS_pept        complement(435391..435540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18838"
FT                   /db_xref="GOA:D9Q0K0"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K0"
FT                   /protein_id="ADL18838.1"
FT                   /translation="MELDGENEVIGTANLLSSLAAALLRALAIDLSRSLKRHLSHNFSP
FT                   LEAL"
FT   gene            complement(436143..437000)
FT                   /locus_tag="ASAC_0432"
FT   CDS_pept        complement(436143..437000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18839"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K1"
FT                   /protein_id="ADL18839.1"
FT                   /translation="MWNLPRGRRKQRAEEPQDAAAAAQRKRRSSAVKRGTSEEDVKAIA
FT                   ESLSSRLIPALGLDLIGLQPADIKDLVYSIVSSLAESRSSKLTEEAAMKRIVAMKDNVL
FT                   KAVSASLLSKGQHLTREQLEFIVAYAPEMAGRAAPYLYREALRLKADDIIDSLRSLWSQ
FT                   YGNPTPVECPRCGFRAVTPDLTCMVCGAELSEGEIKKHIGLEKVLESLATRLHPRLIEE
FT                   IASAGYVVLDDDVKPPSLAPKQGYALVLHLSRSEREILQKLLNSQGRAQGAGDQQLPSG
FT                   SQVP"
FT   gene            437118..437900
FT                   /locus_tag="ASAC_0433"
FT   CDS_pept        437118..437900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0433"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18840"
FT                   /db_xref="GOA:D9Q0K2"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K2"
FT                   /protein_id="ADL18840.1"
FT                   /translation="MSQEGYDPLQRAEAVRRLVTREVNGVEQRLYYRFRADRWYGGIAT
FT                   GDVIGCDLSCGFCWSWRFRDNISLGKFMTPQQAFNAIYSIAKSKGFTQVRLSGAEPTIS
FT                   RRHLLDLIELFDERGITFVLETNGLLIGNDPSYAKDLAAHPNVVVRVSFKGTNAEEFHR
FT                   LTGARAEFFELQFRAIESLVSAGLEPGREVYAAAMIGFSDDNSIRDFVRRLASIDERLA
FT                   DVDWEYVILYRHVEEQLRRLGLRPRRAVTPDNIPVSMI"
FT   gene            437966..438289
FT                   /locus_tag="ASAC_0434"
FT   CDS_pept        437966..438289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0434"
FT                   /product="predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18841"
FT                   /db_xref="GOA:D9Q0K3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K3"
FT                   /protein_id="ADL18841.1"
FT                   /translation="MSYRDQLLSEANKCVYCGFCESVCPTQPFGPHRGYGPRGRVTLLR
FT                   ELLEGRASLSDEVLSSFYSCLLCNACSTVCPARIRVGDLMRMARAMLWGSPVISSNAAV
FT                   RTR"
FT   gene            438286..439230
FT                   /locus_tag="ASAC_0435"
FT   CDS_pept        438286..439230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0435"
FT                   /product="Heterodisulfide reductase, subunit D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18842"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K4"
FT                   /protein_id="ADL18842.1"
FT                   /translation="MRGLKISSVLRFMRTYTLLTGYPVPAPPGFASQWSRGLDLKRRGS
FT                   RYLLFTGALYQLVPYINATVRFLSLMESRGLSDLLDVAESLAKLRPSYLQGLVRPDPRE
FT                   VEEYNGILRSIASLLASSQVDFMYDPAVSNMYSGALLFDYGIADGLREHATKVAKAIES
FT                   EGEVEGVITIDPHTTLTLMHYRELVGFDIKVVNYLELVKPRLSTQIKATIHDSCIYARD
FT                   LGLADRVRSLLKGAGVSLVEPRNHGTRTSCCGGPVESLSPGLAEAIAVRRVRELREASD
FT                   MAIAMCPICLSNLRRAGGSVVDIALVLNGLVKQ"
FT   gene            complement(439216..441450)
FT                   /locus_tag="ASAC_0436"
FT   CDS_pept        complement(439216..441450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18843"
FT                   /db_xref="GOA:D9Q0K5"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K5"
FT                   /protein_id="ADL18843.1"
FT                   /translation="MNSRDFNKLLISLIGFNLTVLSVMVYGADGTDVNIGRFMGYPFPY
FT                   YVPYPAAVAIAFLLFAIGISMMLLSGVVVNRRLESKAVLTSVIIAGASAFMTFLTYLHG
FT                   KIIVSGGREDSYVIQLEAARELLKGLNPYLVNYSGVLLSRTAINKLTLIYQAGPPYNAS
FT                   HAVGFVSSLDYPAFSFIYYIPAVLLRIPGNVWDSAVLGAALAILYLRLRQAGRDLFPLV
FT                   VASGALYMIMDPATFDPITGWLAPAILMVTFADNPVIAGVMIGLAASYRQYAAALAFVY
FT                   FPLSLRRLGRSRTLKGVLSMLITAAIVNLPFLVGSPRVFVSDVLLPARLDLDLEGFGIS
FT                   SVYFISHLTLPRLWLDVTAVTTLIVGSAITYSFYDELEAAAFVFPALAFFIYPRPLYSY
FT                   WLWFPFVGLLASLTNVKGDGSPLIRSISLEGLGIASTIAAISIYASGVLSLLTIAVFSM
FT                   SLTMIILLPRAGDLLRSKESLDVMIATLVLPMGLGLVALAARSYISWPVVMASRAANGP
FT                   PALIYDLSSGLPLALGSFEYGTLWPSKAVGLPLTLALAASVTSAFALLSAMLFVSTRKD
FT                   SLTLLRAAALMDGAAAIPLLTSGPLTSLAALIVIIAMALYVSGEPRSVAASLMLGATTF
FT                   LTPAALSMWIISVTTKVRGRRNLMINAITYAVSAAIGIVIGVHFKVSWILELSSLPLAL
FT                   ISLILAVALPLAYITASRANRIAPLIAAIPSAVLGQGIIAVSLAMASLLD"
FT   gene            complement(441586..441663)
FT                   /locus_tag="ASAC_R0019"
FT   tRNA            complement(441586..441663)
FT                   /locus_tag="ASAC_R0019"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAG"
FT   gene            complement(441693..444590)
FT                   /locus_tag="ASAC_0437"
FT   CDS_pept        complement(441693..444590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0437"
FT                   /product="Putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18844"
FT                   /db_xref="GOA:D9Q0K6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K6"
FT                   /protein_id="ADL18844.1"
FT                   /translation="MGSSIDMLNPKLRAAIASLGYRGLLPIQEKAIPVILTGNNTLVIS
FT                   PTGSGKTEAAVFPVVSMMLERFTPGDGTVKAIYITPLRALNRDVTLRISRIVESIGFTI
FT                   SLRHGDSTSTIRRRFLQSPPDFMVTTPESLNLLLTVAKGRDLWSSVSFVIVDEIQEMLD
FT                   NKRGAELSVVLERLEEASRSRIQRVGLSATLSEKSKREAASLLAFNRPVNIVEDKGERR
FT                   YVITVDVVRGKGQDEFQEAARRIAEIGERESGSVLVFTNTRSVAEKLASLIGNIVGDDN
FT                   IAVHHGSLSRSVRETAEAKFREGKVKLMVATSSMELGIDIGSVNHVVQFMSPREVIAMT
FT                   QRAGRSGHVFGGTSRATIVTFDNVFEVLESTSIARRTEKGELEDLGFPRSPLDVLAHQM
FT                   TAMLVEGSADNIRRVHEIVARAAPLAHVSLDDVRKVAEHLDSVKVIRFDPETGEIKRSR
FT                   RTFKYLYEVSMIPDEINFKVYDLSSTNLVGEVSERFVEVAMLTSGSTKFRFTLAGKVWE
FT                   VVNIDYDSERIDAKPVGEAEGAIPIWEGELIPVSSKVAREVCSILSFSMMEPEKGLELL
FT                   KSKGIDEETANRIVRVAEESRKTWGTVLTYSEPVVEESKGVSILYACLGSKGNLMLALL
FT                   ISKALESRMKVWFDYIPYAIVFSSPSGVPAEAIKDALEKLKSLDQAELVAMSYDAVRST
FT                   PLYIARFLQVAKKLGVIDPDARISLEQGRKAMEAYRGSIVDEETLKEIAFDKLDPLAVH
FT                   EFLSNLREVHVASSSAPSPLFKEVINNPYLRRELATNIKEVAIDYIAEGLRRAALSKEA
FT                   LFLCTACGNAWRARVSDIGDSIRCPRCGAMMVAPLPATEWGEEAAAKYAAWRRGSLKKP
FT                   NNDERKLIKEVQERAILYINYASQGLGRYVIEALMTSGVGPRAAKKVMQEYFKGGEQAF
FT                   YKALLKAKEEYLVYKKFIDNNAGSKREQPQGHGYF"
FT   gene            complement(444740..446398)
FT                   /locus_tag="ASAC_0438"
FT   CDS_pept        complement(444740..446398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0438"
FT                   /product="Thermosome subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18845"
FT                   /db_xref="GOA:D9Q0K7"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K7"
FT                   /protein_id="ADL18845.1"
FT                   /translation="MAAAQGIPVLILKEGTQRSYGREAMRNNILAAQVLAEMLKTSLGP
FT                   RGLDKMLIDSFGDVTVTNDGATIVKEMEVQHPAAKLLVEIAKAQDAEVGDGTTSVVVLA
FT                   GALLEKAEALLEQNIHPSIIIDGYTKAMNKALEILDKIAMPVDVNNDENLRKIAYTTIG
FT                   SKYAGQGPEKDKMVDLAVNAIKIVAEPKPEGGFNVDLDNIKIEKKKGESLMDSVLVRGI
FT                   VLDKEVVHPGMPRRVEHAKIAVLDAPLEIQKPDITTKIRVSDVDQLDSFLDEETKILKD
FT                   MVDQIAATGANVVITQKGIDDVAQHFLAKKGILAVRRAKRSDIEKLAKATGAKIVTSVR
FT                   DLKPESLGYADLVEERKVGNDKMVFIEGAKNPRSVTILLRGANDMLLDEAERNLNDVLH
FT                   ALRNIMREPKIVGGGGAPEVEIAMQLRDYAATIGGKEQLAIEAFADALETIPSVLAESA
FT                   GMDPLDTVMQLRSLHSKKLTFAGVDVLNSKTAENMLDINVYEPLLVKKQVIKGASEAAI
FT                   ALLKIDDLIAAAPPKEEKKGKEGEESPSSGSSGSS"
FT   gene            complement(446540..446818)
FT                   /locus_tag="ASAC_0439"
FT   CDS_pept        complement(446540..446818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18846"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K8"
FT                   /protein_id="ADL18846.1"
FT                   /translation="MRDTLSWEVCDICERRVPTRLCRVDSRVLRVCDECLITLQGLLSC
FT                   GSVGGATAARKPRELSVNEELLSSLKESHGKEERKYTRRRAYHSRES"
FT   gene            complement(446877..447161)
FT                   /locus_tag="ASAC_0440"
FT   CDS_pept        complement(446877..447161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18847"
FT                   /db_xref="GOA:D9Q0K9"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0K9"
FT                   /protein_id="ADL18847.1"
FT                   /translation="MNTLQYYMLMFLIVLLAATTVMTIKQMNDIKKLQELRKRPKIVTV
FT                   EQCGGSTSTRDFREGDYVGLVTGSCSDGTPRRIIGIYAIKEESKKRGGL"
FT   gene            complement(447161..448273)
FT                   /locus_tag="ASAC_0441"
FT   CDS_pept        complement(447161..448273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0441"
FT                   /product="hypothetical protein"
FT                   /note="DUF1512 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18848"
FT                   /db_xref="GOA:D9Q0L0"
FT                   /db_xref="InterPro:IPR009995"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L0"
FT                   /protein_id="ADL18848.1"
FT                   /translation="MATNALATWITVGVNILWIALLFLWLTGLGNWIQVYWYRADIRSK
FT                   LNLLGGLADEAKKATLDFMNKNNAKDAASLLDRLTDFFTIDPVSVEPTDIISRMRHLLN
FT                   IRDMRFKDSFIEAMPNSDDVTRSIASTAAEITSALNFIYKYVRHLLLFSEKTKNWYLIL
FT                   QLEIFMPQIVQLAQTYRKALDDFLTKVPVGDGAGPMVALRLAGPDAKWREVTEDTVVTE
FT                   TNFEGRNIILVKAKGPASTVGRPGEAAEKVIREAIAQGRKVSLMITVDAALKFEGEATG
FT                   DVAEGVGAAIGDPGPEKIRFERVATEYNIPLRAVIVKMGMDEAILAMNQDIYNGVEKAV
FT                   ERVKQIIRSESREGDTVVVIGVGNTAGVGQ"
FT   gene            complement(448333..449244)
FT                   /locus_tag="ASAC_0442"
FT   CDS_pept        complement(448333..449244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0442"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18849"
FT                   /db_xref="GOA:D9Q0L1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L1"
FT                   /protein_id="ADL18849.1"
FT                   /translation="MISQEEISRILEAGRIGAEARELGASLVKPGASAREICDEVESLI
FT                   IRRGAKPAFPCNFSINEVAAHYSPGIDDDVKVPDKAVVKVDVGASVDGYLSDTAVTVAI
FT                   GSESFQQLALAAKSALDKVAEVMKPDIRVYDIGKTIESVIKSMGFKPVRNLTGHTIERY
FT                   TLHAGLSVPNYAERTLFYHRLRPGTQVAVEPFATSGRGLVVDGPKAYIYSATGNRPQRI
FT                   SETARQLLEYILSHYSTLPFAKRWLYPEWKREEIEAGLAELVKARALVEYPVLIEASRA
FT                   PVSQFEHTFVITHDGVIVATKL"
FT   gene            449350..450036
FT                   /locus_tag="ASAC_0443"
FT   CDS_pept        449350..450036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0443"
FT                   /product="predicted Zn-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18850"
FT                   /db_xref="GOA:D9Q0L2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L2"
FT                   /protein_id="ADL18850.1"
FT                   /translation="MGYLVYYGHSAFEVNVSGKKILIDPWVTNPLSPVKPSDITGVDYI
FT                   ILTHDHDDHLGDTFEIMKNNPKAKVVSTYEIANFIAEKIGDESRAIGGNMGGPMVLEGG
FT                   IKVALVPANHTSTHGSAVGAVIITGEGTLYHAGDTGITAEMSLIGELYKPDIAMLPIGG
FT                   HFTMDHNEAAKAVELIRPKVAIPMHYGTFPVLYGDPQEFARMVTSRGLPTKVVVLKPGE
FT                   RFEFKF"
FT   gene            450069..451874
FT                   /locus_tag="ASAC_0444"
FT   CDS_pept        450069..451874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0444"
FT                   /product="putative ATPase RIL"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18851"
FT                   /db_xref="GOA:D9Q0L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L3"
FT                   /protein_id="ADL18851.1"
FT                   /translation="MTRIAVIDSDECKPKRCSYQCISVCPINKSKKDVAIEADTKARAK
FT                   PVIHEDVCIGCGLCVKACPFDAIAIVNLPEELSEEAVHRYGVNGFKLFRLPIPKDGQII
FT                   GLLGKNGVGKTTALKILAGELMPNLGRTDVKEVPAEEVLRHFRGSELQTYLQKLYDGKL
FT                   TVAHKVQYIDLVPRYLKGTVGELLKRADERGVARDLAQEVGLDALWDRDVRNLSGGELQ
FT                   RMVIVATLSKDANVYMFDEPSSYLDIRERVRVSRLIRSEVKPGKYFLVVEHDLAMLDYL
FT                   SDNVHILYGEPGVYGIVSQPYGVRVGINAFLDGYLQSENMRIRSTPIIFSRSVQAAQQE
FT                   AEYKYLEWTQARVRLGDFTLDVMPGYINGGEVIAVTGPNGIGKTTFIRYLTGELKADEG
FT                   VPFSYRELKVSYKPQYIGPDFFPEGMTVADVLRSVNPEAITTGTWLYIELTEKLGLHRL
FT                   FDREARELSGGEMQKLAIAMSLSREADLYLLDEPSAHLDVEERLAVGKIIRRLTETRKA
FT                   AAFVAEHDIMMIAMISNRAMVFSGTPGVHGIASSPAPLRASMNELLSQLGITMRQEKES
FT                   GRPRINKEGSYLDRLQKARKVYFEV"
FT   gene            complement(451871..452608)
FT                   /locus_tag="ASAC_0445"
FT   CDS_pept        complement(451871..452608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0445"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18852"
FT                   /db_xref="GOA:D9Q0L4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L4"
FT                   /protein_id="ADL18852.1"
FT                   /translation="MALRLRLVAVGIEGPVNLGYIFRLSENFEVDELYLVSPTASVAES
FT                   LRWAAKASDMAWKATVVGSLKEALRDVELSVCTSDESSARDLLRSPVSPEQAAELMIAR
FT                   KGTVALVVGRESVGLTRDELAQCDLLCTIPASPKYTALNVSNATAVLLYEIYKARRKSP
FT                   EYEPPSRKTIALAEAYARSLAAAVGSSEDDPGLSVRRLLSKATAAEARHLLNLLSKACS
FT                   SLGCRDMARRKLEELCGGPCEEA"
FT   gene            complement(452612..453223)
FT                   /locus_tag="ASAC_0446"
FT   CDS_pept        complement(452612..453223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0446"
FT                   /product="6-Phospho-3-hexuloisomerase (PHI)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18853"
FT                   /db_xref="GOA:D9Q0L5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L5"
FT                   /protein_id="ADL18853.1"
FT                   /translation="MSSEHPAIKAMKEISEFAIRAAEVIDVSEVDKMVDMLTDVYRRKG
FT                   KALVMGAGRSGLVGKAFAMRLLHLGFNSYVLGETIVPSISKGDVAIAISGSGRTGLIVD
FT                   AADAAKKVGAYVIAITTFPESPLGSIADLVVRIPGRSKISKMDDYFARQILGLHEPLAP
FT                   LGTLFEDTAMLFLDGVVYYLMIKLNVSEDEMRSRHANVEF"
FT   gene            453524..453793
FT                   /locus_tag="ASAC_0447"
FT   CDS_pept        453524..453793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18854"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L6"
FT                   /protein_id="ADL18854.1"
FT                   /translation="MKKDREDSPEPPRGVIEVEGLAMNGLLKSFSVEDCGKPKGYQRIV
FT                   AETIDGRVIKTGCLEPDAARREVMVMNLYLRQWSKFIVRQDSGR"
FT   gene            453829..454206
FT                   /locus_tag="ASAC_0448"
FT   CDS_pept        453829..454206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18855"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L7"
FT                   /protein_id="ADL18855.1"
FT                   /translation="MSPTEAEGFCKGVSRPESQLVERLLRSLSSGPRAFIVDKKLDDYQ
FT                   SLLKIINVSGAGRLLQVSDLGNLVVIYIDRQRLEKACSYEECGAKSDPVERNLCAKECG
FT                   ARRISEVFHAIVRDLCEVLSS"
FT   gene            complement(454211..454540)
FT                   /locus_tag="ASAC_0449"
FT   CDS_pept        complement(454211..454540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18856"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L8"
FT                   /protein_id="ADL18856.1"
FT                   /translation="MGLYAMQSVYSETQGAEIISLDDINVSKIITISAKISLPESIAIN
FT                   AIAEICHVSKSSLVRAAIARLIRDFYAAAPESLADLNKGFMASAIIVDEQISRCLERLS
FT                   KKEPK"
FT   gene            complement(454598..455221)
FT                   /locus_tag="ASAC_0450"
FT   CDS_pept        complement(454598..455221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0450"
FT                   /product="Putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18857"
FT                   /db_xref="GOA:D9Q0L9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0L9"
FT                   /protein_id="ADL18857.1"
FT                   /translation="MAELRWADITTAAGRLRVALSRCVYEPSDDSLLAIDAMVKLKEMG
FT                   RTYEAVLDLGTGSGVLALASLLLFRPRRLVAVDISPYAVECARATLGPDAAVIQCDGAR
FT                   CLSGGWDLIILNPPYLPSSDIPHDECDFWEFMAWSEGANHERLCRDAAEAGNEVLIVRS
FT                   SLSSFNVDSCLRNEGLHMDEVLASRRFFMEELRVELWNRFSVKK"
FT   gene            complement(455194..455946)
FT                   /locus_tag="ASAC_0451"
FT   CDS_pept        complement(455194..455946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0451"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18858"
FT                   /db_xref="GOA:D9Q0M0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M0"
FT                   /protein_id="ADL18858.1"
FT                   /translation="MRYPRDLGQRFLVNKDGVSLFLEGLSGFEGLDVLEVGPGEGQLTV
FT                   SIANVARRVLAVEFDRELAARLVARVPYNVSVVVGDGARYALIARSPVLVSNTPFYLSS
FT                   SIITNAARNNNLELMVLGLQLEVAKRVTARPGSELYGRLSVISQAYFRTQIIGVMPSSW
FT                   FKPRPKVDAAVVRMVRIRRWDPTGEALEKVTRCLFSYRNKLVTKAALRCLGSVPEDFKS
FT                   LPSSTRVRDLAPEQLIGVAKWLSLGGQI"
FT   gene            complement(455943..456827)
FT                   /locus_tag="ASAC_0452"
FT   CDS_pept        complement(455943..456827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0452"
FT                   /product="hypothetical protein"
FT                   /note="DUF655 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18859"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M1"
FT                   /protein_id="ADL18859.1"
FT                   /translation="MAAPRGPPRRGEQQAEVSQIERKAVILDYMEAGYYLDPHRWHREK
FT                   PVAQAIGESRFTLLDGIPLQPVEPLEEVAVTKEVLETVEEPLDPVGRHTRKVSIPMACI
FT                   STGDSKRVCLPTAKVEQRLLDLLKVMAGDELEIVNSPAEFSRTLTNMGLPPKAIAAPRT
FT                   PLTYESLTEIAKRNLREAVKFIIKANERVFIEFFNKAEPINIRLHSIELLRGVGKKTLM
FT                   AILDARTKKPFESFDEIRKLIKDDPVEVLTDKVLEELEGRSKYNLFVMPSASGVPFLDY
FT                   LSVLEGARKEGRK"
FT   gene            456968..457330
FT                   /locus_tag="ASAC_0453"
FT   CDS_pept        456968..457330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18860"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M2"
FT                   /protein_id="ADL18860.1"
FT                   /translation="MSEEGGKGRRRMDLPKRREDLERISEEVEAREHSEMEEEHHHHHH
FT                   EEEVEDVVSVLELLVDSLNANYKSLESTVNIHSDEIIRIYKILAKIVEACGETDPSARE
FT                   KSLKEAVELLQPPVKA"
FT   gene            complement(457327..458472)
FT                   /locus_tag="ASAC_0454"
FT   CDS_pept        complement(457327..458472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0454"
FT                   /product="egghead-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18861"
FT                   /db_xref="GOA:D9Q0M3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027389"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M3"
FT                   /protein_id="ADL18861.1"
FT                   /translation="MQEIVSSLQIPQSEPYVKYAIAVDWGMLSVYLIVLLIALTAYSAK
FT                   RSPTKANNVALVIPSVADEKVRDSLIMSLNHNRFLNIPIYVVIDEGAPLEGYLKSLNWI
FT                   KVVVVPKDYRRDLFGKGRALRYFVENYVRPDMWYVFLDDDNLVLDDSFLYEIPYYERRG
FT                   FVAFNPILMPRRGRSYLTFIMDFTRFLDDISFFRLFTGLVKRPYVGLHGELLGVKGSFL
FT                   LKSNAFNVPSRVEDYMFAAEVLRLRGHTWQSRTRVSILSPNSVKDFIRQRSRWHAGILE
FT                   SWKRVPNSMKLMTFIKSFLRTVGIVGLWVLVPLTHSLLLLLLAAPTSAAYWFVYIYGVR
FT                   RAGKLRYLLAVPAFWMLEGFGFIYGILKLRSRDFVVIDKSI"
FT   gene            complement(458559..458912)
FT                   /locus_tag="ASAC_0455"
FT   CDS_pept        complement(458559..458912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0455"
FT                   /product="putative DNA-directed RNA polymerase subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18862"
FT                   /db_xref="GOA:D9Q0M4"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M4"
FT                   /protein_id="ADL18862.1"
FT                   /translation="MKFCPRCGTLMRPKSINGKLVFVCPKCGYEEEVPSKARVATPLSF
FT                   TERVAHTPKERIIVVDANAPPPTAQVLKGSVRCPRCGNDEVLAWMMQTRAADEPPTRFY
FT                   RCTKCGYTWREYA"
FT   gene            complement(458996..460099)
FT                   /locus_tag="ASAC_0456"
FT   CDS_pept        complement(458996..460099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0456"
FT                   /product="phosphoesterase, DHH family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18863"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M5"
FT                   /protein_id="ADL18863.1"
FT                   /translation="MNWGSAGAGGFRAAMSEQCPKILIVGDWDADGIIASAEMVYANEV
FT                   AKAFPIKGNKCPTELRPASPRTMSEAFKGGCWDYVIILDIPFTQEVEASLDQLTASGCR
FT                   PKIYYFDHHKITIEKSTYIEGKYSAVTFIGLSPTSVLVKVFLESIGVKLTPRLKDLVSS
FT                   AAVLEGGGWLSRNNRSATEGMVKLAASISKAINQSKDPELWRKYVQWASSVLPFEVSVV
FT                   PSARDYENLVSKGLEVSERSDKEIKEVATGLAMTAKAVGFLKLVDARGKWNKSGASALA
FT                   SALYKITRGTVALLVSKSDDTELLIIRSGHGEAMRIAEELFKQGVIEDLGGHENIASGR
FT                   VRKGISDKELEDAIRKASLAAFRFSGQ"
FT   gene            complement(460151..460726)
FT                   /locus_tag="ASAC_0457"
FT   CDS_pept        complement(460151..460726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0457"
FT                   /product="hypothetical protein"
FT                   /note="DUF429 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18864"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M6"
FT                   /protein_id="ADL18864.1"
FT                   /translation="MPSFVGIDLAASPKGVTGLAVVRGRSISTKSVHTDEEILNLVVTA
FT                   SPEVVALDSPLSLGKGPFRDFELAAMSKGFRLLPLTMRSMRLLAIRGMRIAHTLSSLGI
FT                   KVIETHPASAVKSSGCADVRDVIRSLDLEALPGSMSNRHEVDAAVAALVAMCYSAQTYY
FT                   SFKGLEGELVLLPEGLCKGTCDAVRPKL"
FT   gene            complement(460726..462120)
FT                   /locus_tag="ASAC_0458"
FT   CDS_pept        complement(460726..462120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0458"
FT                   /product="Aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18865"
FT                   /db_xref="GOA:D9Q0M7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M7"
FT                   /protein_id="ADL18865.1"
FT                   /translation="MQNVWSLSSLKICSPACDAGASVLKDSFISQVYDRANSLLGQKIR
FT                   VCGWVDNIRDLGGVRFVLLRDRSGVLQVVIKKGVTPETAIETSKELVKETVACFEGTLV
FT                   ESKSKLKYELQASGIQVLSKPVEPIPLEPATSTEAQLNVRLDYRWLDVRNLKVSAIFQF
FT                   ESWVANKFREFFRQNGFVEVFTPKIVAAGTEGGAEVFPVIYFGREAYLAQSPQFYKQMA
FT                   VIAGLERVFEVGPVFRAEAHHTVKHLTEFHGLDIEMGFIEGPEDVMNMLESFFRYLAKE
FT                   AEIDDSIETVRNYFDLALRVPSKVPRITIREAYEVLKERYNHQLPYMEDLDPQAERELG
FT                   DYALKEYDSDFIFVTEYPWKVRPFYTMRKPQEPEWTLGFDLLFRGLEIATGSQREHRYD
FT                   QLLANLRDKGLNPERFQFYLNFFKYGAPPHGGAGLGLERIVKQFLNLDNVREARLLPRD
FT                   PERLTP"
FT   gene            462159..463001
FT                   /locus_tag="ASAC_0459"
FT   CDS_pept        462159..463001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0459"
FT                   /product="Putative succinyl-CoA:3-ketoacid-CoA ligase,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18866"
FT                   /db_xref="GOA:D9Q0M8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M8"
FT                   /protein_id="ADL18866.1"
FT                   /translation="MGLMPSVKLTSLSEAAGLVRDNDEVTISGMTFFRNPMALISAIIR
FT                   AGVKNLSFVDREPGLGLDIMVASGAVNRVRAAMATFEHYGLAPTVRRKAEEGAISYLED
FT                   TCGAVIAGLRAGAQGVPFMPTRGVVGSDLLKIHEAAGTWKVIEDPFTGEKLVAVRSIEP
FT                   DVALIHVHVSDEYGNAMIMGPRFEDELKIRAAKMVILSAEKVVGSEELRKLTRDLGLTL
FT                   SATSLYVSAVVRAPEGAWPTGVYGLYEPDYGAIEAYYKAAKQGLAANWIRDNLLRRWQ"
FT   gene            463037..463747
FT                   /locus_tag="ASAC_0460"
FT   CDS_pept        463037..463747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0460"
FT                   /product="Putative succinyl-CoA:3-ketoacid-CoA ligase,
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18867"
FT                   /db_xref="GOA:D9Q0M9"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0M9"
FT                   /protein_id="ADL18867.1"
FT                   /translation="MASFIRDGDYVYHGLDSILPALAMVYAARYLKRDFVWHSVGESFM
FT                   PDPARVAVRPSTGDPSMEPDPVGFFTTIDSFDIAAKGRMDLMFFGAAQVDESGNINLTA
FT                   IGSYERPKVKLPGGAAAAYLFPLVRKIVVWARHEPRVLVHRVDFVTGSGEERLRRGLPL
FT                   YLCTNRALIEFTREGPVLRSLLYGFTVDDVLKSASMRIAVPDRVGVIPPLSEEELRVIS
FT                   EADRGGLRYEEGYG"
FT   gene            complement(463744..464535)
FT                   /locus_tag="ASAC_0461"
FT   CDS_pept        complement(463744..464535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0461"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18868"
FT                   /db_xref="GOA:D9Q0N0"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N0"
FT                   /protein_id="ADL18868.1"
FT                   /translation="MIRLQSGGDEAVIHEKGAYLAALRHRGRAVITEGDPSTPTKAGMA
FT                   FLAPFANRVKGATYVFDGIIYSLPRNSEGNAIHGLLLDREFKVVNSSADSVTLETVLSH
FT                   PGYPSQLNVQVTYSISEGLLTAEAVIRNLGPRRAPLVVGWHPYFAVGSLPWRVEAEAFR
FT                   CEAVDKIPTGKLYYYEFGDDGEYDDCFLVPSGLVKLIVNGREAVRVVSDSMKYFQIYTG
FT                   IKGSVAIEPMSGAPDAYHNRMGLAIIEPSQSVRVGFKAYYG"
FT   gene            464763..466328
FT                   /locus_tag="ASAC_0462"
FT   CDS_pept        464763..466328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18869"
FT                   /db_xref="GOA:D9Q0N1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N1"
FT                   /protein_id="ADL18869.1"
FT                   /translation="MRPRKLLIVDGYNDEPGGLGVPPYIDVYARYIAGAVFDVDKAAKV
FT                   HYITIDELRQRPNPAQLLRLYEAIIFIAGVVVPGKYIGGRPATAEELTSIASSLEGPLK
FT                   VLVGPAARWGMGPEGGSAGYPPSFFKAHGFDVLVTGDPEEYVYDLVKYGEEAASPRAIR
FT                   EDYSKVNRFAVLGASIVRFHPNFGKNLIAEIETYRGCARWVSGGCSFCVEPLRGRPIAR
FT                   DPMAIVKEIRALYEVGVRNFRLGRQADILVYNSSQLGSEEWPRPSPQELERLFHGIHTE
FT                   APNLEVLHIDNVNPGTIARYPEESTEALKVIVKYHTPGDVAALGVESVDPQVVKINNLK
FT                   VTADEALKAIEIINKVGASRGYNGLPELLPGINFILGLPGERRESYRLNREFLEEILRR
FT                   KLLVRRVNVRKILALPTTRVYNMRWGISRKLEAEAKSFTYFVRHVFDRTELSWVAPKGT
FT                   IMKSLWVEECELGYCYARQVGSYPLMVMIRGSYPRLQYIDAVRVEGVHSARAVEGSVIQ
FT                   PEPG"
FT   gene            complement(466306..466926)
FT                   /locus_tag="ASAC_0463"
FT   CDS_pept        complement(466306..466926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0463"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18870"
FT                   /db_xref="GOA:D9Q0N2"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N2"
FT                   /protein_id="ADL18870.1"
FT                   /translation="MVSLLGLLNYIGIVSFSASGALKGVRKGLDIFGVAVLGLVTSYAG
FT                   GIIAEVLLGMVPPLVLKDPLDLLMSIAVSIGVFYFWRALQRPSTAKALFVADAIGLADF
FT                   AVFGAYLATSRGLNVVAVAIIATLVGTGGGALRDVLVGEIPMVLRREIYATAAAAGGVV
FT                   YYLAQELSKVYASAFGLVTVLALRLVSYELGLELPRANQAQAV"
FT   gene            467042..468100
FT                   /locus_tag="ASAC_0464"
FT   CDS_pept        467042..468100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0464"
FT                   /product="Phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18871"
FT                   /db_xref="GOA:D9Q0N3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N3"
FT                   /protein_id="ADL18871.1"
FT                   /translation="MQGQDEEGEASSFIVKRKVQITGGSTYIVSLPKEWAKVLNIDKGS
FT                   EVLLELNPEGWIRLRSPNSASRSVERATEVVLRPNLSDAVLSMQIISAYLAGYDTINIK
FT                   FDTQMAEAAERIANFVRTKTIGLELLEESNDQLTLKTVVDLTSISAHTAVENMIRVVKS
FT                   MITDLSDVIEGLKQRDLLDAIIRRDDIVDKLYLYIFKQLNLALQGLMSPKELGMNALAE
FT                   AINLYTMVKSLERIADQVVSIAQWLLDYNGQLTPEIRQLFDKVKLSVLSSIDLINTLSQ
FT                   EQILLMYESLHREAVWVAELYSKARASGCANECYPIFDGARRIVAQTIDLLEAMMGLNA
FT                   LRSLENRRAFAS"
FT   gene            468142..468447
FT                   /locus_tag="ASAC_0465"
FT   CDS_pept        468142..468447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18872"
FT                   /db_xref="GOA:D9Q0N4"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N4"
FT                   /protein_id="ADL18872.1"
FT                   /translation="MQVPFGECSREELEELLRLLRLSRLSFEEDELQQLCVDVSNIRSL
FT                   LSRVSKYRDFRVEPLYNVWDETLSPPQQVAERRITITWLPEDRLKDGMVRVPWRGG"
FT   gene            468450..469889
FT                   /locus_tag="ASAC_0466"
FT   CDS_pept        468450..469889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0466"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18873"
FT                   /db_xref="GOA:D9Q0N5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N5"
FT                   /protein_id="ADL18873.1"
FT                   /translation="MKARTAASVLSEVLSGSKTPEEHVMEVYEAIERWEPKVKGFITLL
FT                   DRDVVIKRAKEVERELREGRKLPLAGLVVAVKDNISTSFAPTTAGSRILSGYVPPFNAT
FT                   VVERLLEAGAIIIGKTNMDEFAMGSTTELSGFWPTRNPWDLDRVPGGSSGGSAAALAYG
FT                   GADLALGSDTGGSVRLPAAYTGTVGLKPTYGLVSRYGLIPYANSLEQISPMARSVRDVA
FT                   LLLEVIAGHDPRDATSLTIDRISLSSTPSPNPKDFRICVPHEMIDGSDAPVRGTIIKLL
FT                   DRLQSEGVEVNYDVSLPSAADALPIYYTIALAEAASNLARYDGKLYPFAELRPNYTETV
FT                   TATRARGFGREVKRRIVLGVMALSEGYRDEFYVAAAKGRRLLRDEVLRLTRNCVVAGSV
FT                   SPTLPPRIGERITDPLKLYALDVYTVIANLAGVPSLAMPAGFYSDLPVGVQFMGGPLEE
FT                   AKLVALGELVESVTGLGGVMA"
FT   gene            469886..471343
FT                   /locus_tag="ASAC_0467"
FT   CDS_pept        469886..471343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0467"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18874"
FT                   /db_xref="GOA:D9Q0N6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N6"
FT                   /protein_id="ADL18874.1"
FT                   /translation="MSYLPFKIGLEIHLQLTEAGTKLFCDCRSNYRGMAPNSNVCPVCM
FT                   GLPGALPVPRRQPLRFATALSMLMNCEMPPAMIFTRKHYFYPDLPKNYQITQYQGGGGA
FT                   PICLRGRARYYDPDADGWREVTIRRINVEEDPGRTEYDGTITSSENAYIDYNRSGVPLV
FT                   EVVTEPELRSPRDARRFVEYLLLIMEYIGATNPRLDGAFRVDANVSVEGGERVEIKNIG
FT                   STLDLERAIRYELFRESKLVSQGGRVERETRGWDPVRKVTKPQRAKETEEEYLYFPDPD
FT                   IPPVPMKELIEEARPLTLRDPAKFMDVITAHGVPRRQAWSIVLYRPALSVYLSAVEKGA
FT                   DPLIVARMIAVDLKGLMKKQGVDPHEDSSWPSPETIAALAELISRGEYTYDEIKYNALP
FT                   QLAANPETPIERLLPPRLSDLSEVITAVLSKEKKAVKDYLSGREEALDYLVGSALKMRR
FT                   GYAVDPKLVRSVILKELRQLQGNNKDN"
FT   gene            471414..472565
FT                   /locus_tag="ASAC_0468"
FT   CDS_pept        471414..472565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0468"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18875"
FT                   /db_xref="GOA:D9Q0N7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N7"
FT                   /protein_id="ADL18875.1"
FT                   /translation="MEEKQDFVWPDYTTESNLYSVSCGLAEFFGVKRQCIGKSFEITGR
FT                   RLVLIYLDALSWDLFVESGVKVSGSVTRATTVFPSTTAAALSTLMTAQSPGEHGLVGYT
FT                   VFNKRLGGVINGIKYSYMAESGSGTIDYMPLQRAFPVKPWLAESSAKVLALMSSGAASG
FT                   ELTRTYLNTRPQEGLTKIKSHSNSFEMVASLREALEGEPYDLIYVYYDNPDHIGHGYGF
FT                   RSQHRDLILEELRLTLTHLDELAQKYKDRYTFLLLSDHGQVTVNNVYVFNNDEELLKVL
FT                   EVPPYGDSRAVWFRTRENIRDMLKSKYKLEVMSKQEVIESGILGRVDGFVADNILGDYL
FT                   GVATDPASKYHYSYRDDDPALRLRGNHSGMTPEEMYIPLVVWQ"
FT   gene            472614..473867
FT                   /locus_tag="ASAC_0469"
FT   CDS_pept        472614..473867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0469"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18876"
FT                   /db_xref="GOA:D9Q0N8"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N8"
FT                   /protein_id="ADL18876.1"
FT                   /translation="MAMAYSELEPLLMSVAVGAIVGLVNEYRKITGSRIFLGLRTSIFT
FT                   SMLGYVFALLYEKAGYLLLGVAFISITVIAATIYVERARATRSLGATTYVSMFLVFASG
FT                   ILVGMGMYLQGTVISVLVAVLSFYKTQLLNAISRIRREELLALLNLLVISLVILPLLPD
FT                   KFIGPLGIFNPYEFWFTVVVVAIIFFAQYVTLRVSKRGLLAFTIIGGLISSTTVTLSLI
FT                   QLSNERREASRSLALNTLLSNVPLALIQVLAAIYFTTYSAQLAAIVAVPTMLIALVLTL
FT                   LGAIKFKELSPTNIEPPSTPLPILRIVEFAVLLFIITSVAKAIGVLFPSLLPITIFVSA
FT                   LGNALGAVIAVGILYNRSIITLKVAAQLALLSLTAGVIEKAFLSLLSSSWSYRRLVIAG
FT                   SAALGAFTAVLMYLLGVA"
FT   gene            474020..475000
FT                   /locus_tag="ASAC_0470"
FT   CDS_pept        474020..475000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0470"
FT                   /product="DNA repair and recombination protein radA"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18877"
FT                   /db_xref="GOA:D9Q0N9"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0N9"
FT                   /protein_id="ADL18877.1"
FT                   /translation="MSEANASQAVKKPKDITELPGVGPTTAEKLVESGYATIEAIAVAT
FT                   PQEIAQATGIPLQTAQKIVDSARQALEIHFKTALELKKERMSVRKITTGSKALDDLLGG
FT                   GIETKQITEFFGEFGTGKTQICHQLSVNVQLPEDKGGLNGKAVYIDTEGTFRWERIEQM
FT                   ARGLGLDPDKVMDNIYWIRAINSHHQMAIVDQLFDMLDKDNIRLVVVDSLTSHFRAEFP
FT                   GRENLAARQQLLNRHLHQLMRLAEVYDVAVVVTNQVMARPDVFYGDPTAAVGGNVVAHA
FT                   PGIRVQLKKSRNNKRIARIVDAPHLPEGETVFAITEYGVRDAEEE"
FT   gene            475005..475655
FT                   /locus_tag="ASAC_0471"
FT   CDS_pept        475005..475655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18878"
FT                   /db_xref="GOA:D9Q0P0"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P0"
FT                   /protein_id="ADL18878.1"
FT                   /translation="MEWSSLSLSLLPWALAAIVSLPPAVLDFLYRSVPEHLWYIGGKVV
FT                   AVISFLIYLKIYPLRLLSMFYLESLVAPAAVGASVAMGLMGAGDLWASLAISLMLPAPP
FT                   LGSLMPPSLLVILLAATMELASRPLVTAVTAAKLGLRARGLSMSVPCDMAHRVRWWFPE
FT                   GASAVKEVPSESISRACQGGGEVRLQVGMPFVTFILIALPLALVLELTLFRVP"
FT   gene            475656..476195
FT                   /locus_tag="ASAC_0472"
FT   CDS_pept        475656..476195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0472"
FT                   /product="Hit histidine triad protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18879"
FT                   /db_xref="GOA:D9Q0P1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P1"
FT                   /protein_id="ADL18879.1"
FT                   /translation="MDWPKSWYSILWAPWRMTYISTIAGKSEGCFLCEAPRNPDERSAL
FT                   VLFKGKYSFIILNKYPYNTGHLMIAPYRHVASVEDLTEDEMREIGLLLKASVEAIRAVY
FT                   RPEGFNIGINIGDVAGAGVPGHIHVHVVPRWKGDANYITVVGGTKVISQALEDTYDKLR
FT                   PEVQKAARKYGVTAED"
FT   gene            476173..477234
FT                   /locus_tag="ASAC_0473"
FT   CDS_pept        476173..477234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0473"
FT                   /product="predicted phosphohydrolase, DHH superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18880"
FT                   /db_xref="GOA:D9Q0P2"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P2"
FT                   /protein_id="ADL18880.1"
FT                   /translation="MELQPRTDRRIVIITHNDLDGAAAAASYLRIVGVKPQDAVVLFAE
FT                   PYNVDQVIDRLTPYLEPHTTVAFMDIGFNSQSTPRAIDRLRSAAVKDLEVEWYDHHVWA
FT                   EEDVNAVQKLGARLFVDRSTCGAGVVIRYASKLYGVEVDDFMNRLEKAVCAADLWRWDD
FT                   PLAPKLFRASTSPPDTRNGQWKEKLVEKFFNGVLWDDELQARLEGYLKEELANSSAELK
FT                   NSYSASSNGCVIASVVRDSDLPSDSILGSMLVSRAHANAAALIKRKGFRRVSLSLRSRG
FT                   GANVQVIARRLGGGGHPRASGASIILPLHVALLGMISRKYIAKYVSQRLLEVAMATGAC
FT                   KSTADAGGQGNSM"
FT   gene            complement(477235..477642)
FT                   /locus_tag="ASAC_0474"
FT   CDS_pept        complement(477235..477642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18881"
FT                   /db_xref="GOA:D9Q0P3"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P3"
FT                   /protein_id="ADL18881.1"
FT                   /translation="MPVELLSVDDLVKVAQKALECRVKRVTRDGKAKIKVRTKRYLYTY
FT                   KVDPSQLNDVLSKLNCKKVVDVDQEIAEAKKRRAEERRKAKEEKAKAQQAAATQEAQPA
FT                   AAGGTQEAQASQGQQVQAQPAEEKKEGSPQQ"
FT   gene            complement(477718..478743)
FT                   /locus_tag="ASAC_0475"
FT   CDS_pept        complement(477718..478743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0475"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18882"
FT                   /db_xref="GOA:D9Q0P4"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P4"
FT                   /protein_id="ADL18882.1"
FT                   /translation="MNFLVNSVPFKLSAIRQAGAVSLLRSAKMLSLTAKFYRAYLMKRE
FT                   ISIGFIAAMAAFILRAYASGYLVPLSITNLVNYLQRGDGLGLRRALFMMALAAAIYGAT
FT                   EWLYRPFWVSIVKGISEIKLRLVNGLRKSGDPSDVVGRVANDVDFVMWNVGGMYTTFVP
FT                   NLLTAATAAVTVWELSPFIGALTVAAMPLSLAILEPYLAGVERARSVERKYYSDMIHRI
FT                   ETLLRGESPESEVLGSITKWQHGMVKQVHYDRVFWSLSLLYGYGLPALMAFVGVQQVRS
FT                   GRLSIGGLTGMIYALYNVFPPLINAMWGLCILGQSMVPIMRILELSGKGGVAETKALAA
FT                   K"
FT   gene            complement(478758..479699)
FT                   /locus_tag="ASAC_0476"
FT   CDS_pept        complement(478758..479699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0476"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18883"
FT                   /db_xref="GOA:D9Q0P5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P5"
FT                   /protein_id="ADL18883.1"
FT                   /translation="MGLSIRGLVKSFGKHRVLNGIDLDVHDGELFVILGYSGSGKTTLL
FT                   RCIAGLEKVDSGKIYIDNIDVTNLPPGRRSVSMLFQNYVLYPHKTVLENIMMPIEGEPD
FT                   ARKRAIDMAEELGIRDLLDRYPSQLSGGQQQRVALARALVRRPRVLLLDEPLSNIDAPQ
FT                   RISARRFIKDLQRREKITTIYVTHDQIEAMAEADRMAIMMEGRILQVGTPEELYYDPAN
FT                   KYVAAFVGDPPMAIIDGSVLGLKGTIGVRADDVIIGQGPYEGVVDAVEFIMGRYLVHIE
FT                   LGDYEVRGYSNQRLKEGEKVRFNILKFKTFEE"
FT   gene            complement(479793..479914)
FT                   /locus_tag="ASAC_R0020"
FT   rRNA            complement(479793..479914)
FT                   /locus_tag="ASAC_R0020"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(480032..481096)
FT                   /locus_tag="ASAC_0477"
FT   CDS_pept        complement(480032..481096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0477"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18884"
FT                   /db_xref="GOA:D9Q0P6"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="InterPro:IPR016742"
FT                   /db_xref="InterPro:IPR028564"
FT                   /db_xref="InterPro:IPR038459"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P6"
FT                   /protein_id="ADL18884.1"
FT                   /translation="MLETSDKVQQSLESRPSGALLKLMDAYGYDVLGSREWLEGDRLYR
FT                   LGFQYAAVEMLIREYFLGEETFKGKKAYETEWKGKNKSIVYGKGDVNADAVIVRKPSPT
FT                   EKTVPWRALLDYLPQPPLPLFVIDLSMKFLHTPEELSKLRLQLGVTLSVIREYLWDAHM
FT                   SITGADEETAKWINEVMGVNKVAIVNARPSEVLWGYDADKVIILRPDASTPLKPDDVMT
FT                   ADAFLIGGIVDKIPRPGLSRMLDSLVPWGVPRRIELKGSVIGVPERINRIVEVLLKSRY
FT                   LYGGDIEKAIITTMSKKDRIARAYREIVKYSNDKGTNRVNNDLYEQLRSWLPLTYDEFL
FT                   EAARRAHVEVVNSG"
FT   gene            complement(481099..481770)
FT                   /locus_tag="ASAC_0478"
FT   CDS_pept        complement(481099..481770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0478"
FT                   /product="Ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18885"
FT                   /db_xref="GOA:D9Q0P7"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P7"
FT                   /protein_id="ADL18885.1"
FT                   /translation="MSWIIGVDEAGRGSLVGELMLACFATKEENLGLLKDMGVRDSKQL
FT                   TPHSRETLYRSIVRLGEFVVVPIPPAEIDRENVNVLEERAALKGLKVLLSRLRPELVKA
FT                   IYIDKFGELRILPGELKRLGFRGRLVVEPKADANYVVVSAASIIAKVIRDRRIEVLRSM
FT                   YGVEGSGYPSDPLTVSWVMKVLSSGARPPIIRYSWGTLRGTNAFVRKAKSPRRTLEDFM
FT                   V"
FT   gene            complement(481813..482262)
FT                   /locus_tag="ASAC_0479"
FT   CDS_pept        complement(481813..482262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0479"
FT                   /product="Phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18886"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P8"
FT                   /protein_id="ADL18886.1"
FT                   /translation="MAENRAGPPKLKVSGDPELIKLVEDALKEVYDPEIPVDIFNLGLV
FT                   YEIEATKENGKPKVRVLMTLTAVGCPVTGSILGYVEQAILDRVPGISEDDIEIDVTFDP
FT                   PWSPDMVSEEGRELLKEVYGYDVVEEWKQRYQQMNEEQSPQQGNA"
FT   gene            complement(482323..482517)
FT                   /locus_tag="ASAC_0480"
FT   CDS_pept        complement(482323..482517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18887"
FT                   /db_xref="GOA:D9Q0P9"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0P9"
FT                   /protein_id="ADL18887.1"
FT                   /translation="MRRAVRDKLVLTFSIAAAGGALVAMSPRLGRAYLFLGAAIMLAAP
FT                   WISYLIVLWLYRDEVLRES"
FT   gene            complement(482498..483313)
FT                   /locus_tag="ASAC_0481"
FT   CDS_pept        complement(482498..483313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0481"
FT                   /product="competence damage-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18888"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q0"
FT                   /protein_id="ADL18888.1"
FT                   /translation="MALQQGPKAWLLTIGNEILIGRIVNTNAAWLARKLTFLGFSVERI
FT                   IVTPDDLEQIGDEIRRALSHGVRLVITTGGLGPTYDDRTLEAVALATNRRLVLNKEAYE
FT                   MVLAKYSQGGMQMTKEREKMAYMPEGAVALRNSAGTAPGSWLDLGSTIIVSLPGVPKEM
FT                   EAIFEEEVMPRLKAIAPQLSVVECGFKVVGVPESSLAPFVEEAERKNPGCYVKSHPKGV
FT                   EVGNPILEIKVLASGNTREEALTKAMSALEAVKVGAQKLGGKISEEGCS"
FT   gene            483430..483681
FT                   /locus_tag="ASAC_0482"
FT   CDS_pept        483430..483681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18889"
FT                   /db_xref="GOA:D9Q0Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q1"
FT                   /protein_id="ADL18889.1"
FT                   /translation="MTLEALQYAVNSVFGHFGGLQLSSAGNVLALVGIAMLLAIIVIGG
FT                   VVLIARGIKAIGNLTPGKFLAVLIGLAVAFIVVGALAP"
FT   gene            complement(483653..484324)
FT                   /locus_tag="ASAC_0483"
FT   CDS_pept        complement(483653..484324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0483"
FT                   /product="V-type ATP synthase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18890"
FT                   /db_xref="GOA:D9Q0Q2"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q2"
FT                   /protein_id="ADL18890.1"
FT                   /translation="MAIDVRSTLPTKINLIRLRREYATIRRIRRVLEEKRDVLLHYIRS
FT                   VAEDYNRYQKEVYSRLEEMFTEFYRGEASEGIQRTWAYADSVKSSLRIKAGVTVMFTVR
FT                   APVFQLIPTSVATPAIPPGSSPDLVESYVMLREEVPAILRLAQYEETITRLIEELKRTQ
FT                   RLINSLDYVIIPSYERAIKFISMVLDEREREDFVRLKHLKRMLTAAEESRAARAPTPQQ
FT                   L"
FT   gene            484403..485488
FT                   /locus_tag="ASAC_0484"
FT   CDS_pept        484403..485488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0484"
FT                   /product="pelota-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18891"
FT                   /db_xref="GOA:D9Q0Q3"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q3"
FT                   /protein_id="ADL18891.1"
FT                   /translation="MEVRLLDSKARYIEVLPRSEEDLWTLAMTLRQGDLIRTVVTRDVS
FT                   GRDAKSKERRPIEVLLRVENVEFQPFTGALRIFGVIEEGPDRFGVKGKHQSAYIGLNQW
FT                   VTLIRDGGWSQRIIEKLRASGPRGKAIILAVDYESYALAVLTPVGLRVLYENPLSLGSK
FT                   DDPRREANLEEAIDRIANELVEQASKESANVVVVAGPTAVKDEVASKVRLLARGLRVVE
FT                   DTVSSGGIEGVYEVMRRQSVLEALNEMNSVRAESILDEFMKLVSTSPDLVAYTLPEVKL
FT                   AAELGAVRSLVIIDSLLYSIDDSERETAQNIIESVESRGGEVVVITRESPASDTVASMG
FT                   GVIAILRYKVPRELREAQRPP"
FT   gene            complement(485463..486257)
FT                   /locus_tag="ASAC_0485"
FT   CDS_pept        complement(485463..486257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0485"
FT                   /product="Inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18892"
FT                   /db_xref="GOA:D9Q0Q4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q4"
FT                   /protein_id="ADL18892.1"
FT                   /translation="MSKEVEDLRSLVVKIAEGAARMLREEWCTESTKKVKGETIRADLE
FT                   SERAIFEDLKAQGLSFRMVSEESGVMGSGDYTFIVDPLDGSLNYENCIPWCSVSIAVIP
FT                   PGSRSLSDAVAGAVAPIGFGKTISFGRGEGCFEGSERVSPATSESEIVFVYVERPEEAY
FT                   RISRLFNYMPKLKVRSLGSSALEIAMVGLGRGLAFIDLRDKLRNVDVAAALGIARECGA
FT                   ATLNSRGDELSGDIDKVSVVGDVIVVRKERAGDIIRAVSEPP"
FT   gene            complement(486318..487418)
FT                   /locus_tag="ASAC_0486"
FT   CDS_pept        complement(486318..487418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18893"
FT                   /db_xref="GOA:D9Q0Q5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q5"
FT                   /protein_id="ADL18893.1"
FT                   /translation="MRRESVGFVLSAASIRFATASLQATAVAFLAITGVKTPLISYMVI
FT                   LMWASIAIGSLAATLAKRAKASSLVGLPLMALGLITLAVSPKLAVLSIIVAGFGSGMAG
FT                   SALAPSLHRLSPRERPMEGLGSYSLGLSLGLITATLVSSLMPPSKLWIVFIAAGAVAVA
FT                   SAAHVLLTPVPSHANVHIKLPGLSDVKRFFTTRRFTKAFYVNFLYSTIFPLVLSYWSLY
FT                   AIKVLGMSTGQAFGLLTAMFIISAAIRLASIRLKNVRAAEITALAALTVSTALLSTNAT
FT                   MLVTAGIILFGVPHALIYPVSLYESFESSPDSEIKASYVIALSSGAGEVLAPLVASLMV
FT                   TLGAIEHIYIISVPLAVVALSLALVL"
FT   gene            complement(487426..488481)
FT                   /locus_tag="ASAC_0487"
FT   CDS_pept        complement(487426..488481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0487"
FT                   /product="Glycosyltransferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18894"
FT                   /db_xref="GOA:D9Q0Q6"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q6"
FT                   /protein_id="ADL18894.1"
FT                   /translation="MTPLDELKVLLLSEYDRRIGKLRRGPLLRLLNPPPHVRYFALQRS
FT                   KMYEAPANYSELSPLELLRSLVRQASRVLRTPLGEGFDLVHSFFIDLTRTSVPWIHESD
FT                   ESPGQYLDEYVNVPDVAKNIITGALVDRLVDDNCRAVITWSKWAHEGFVRDGVPSSKVH
FT                   VIPPPVSVKSRRPHDAVNILIIARDPIRKGLDVSLKAFVRVHRHFNNVRLIVVGPNASR
FT                   LAKVGLKGVRAFDKVDDDTLHDVIMPTTDVVLAPSRAEAYNLTVLEAMAYGAVPIVTNV
FT                   GALPELVGEAGLIIERDDYDMLADSLEKLVSDQGLRESLSLRAQEVVRRDHDPEVIGES
FT                   LLKVYRQALEG"
FT   gene            complement(488478..489749)
FT                   /locus_tag="ASAC_0488"
FT   CDS_pept        complement(488478..489749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0488"
FT                   /product="Sulfolipid biosynthesis protein (sqdB)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18895"
FT                   /db_xref="GOA:D9Q0Q7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q7"
FT                   /protein_id="ADL18895.1"
FT                   /translation="MPQLKGPIIVFGGDGYIGWPLAMHLAMRTSDDVVIFDNMSTRLLV
FT                   KSVNSDSLIPIAAMAERLKAFKEYTGRDNLVFEPGDVRDPQRVDEVIAKYKPSAVVHLA
FT                   HQRSAPFSMIDQRHAVYTEVNNVVGNLNIIFSLARHAPNAHLLKMGSMGEYGTPNITIT
FT                   EGDIEIEYGGRKDKFMFPRMGQSFYHLSKIFDTYNLLLANEIYGLRVTDIMQGVVFGTR
FT                   THETTIAEELQTRLDFDSTWGTVINKYVVQAVLLKKLLIYGKGRQTRGFLSLYDSINAM
FT                   TLLLENPPKEGEYRTVNQLDMIYDTLTLAQMVAEVAREYGIDVDYERVEDPRVEKEEHF
FT                   YDVEHRILPSLGFHREKDMKDVIREIFEDVIKYRSRAESMKELIYPYARWKDSYIYDRQ
FT                   GFSLPREVERPLTVNEILKLAGFG"
FT   gene            complement(489844..490140)
FT                   /locus_tag="ASAC_0489"
FT   CDS_pept        complement(489844..490140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18896"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q8"
FT                   /protein_id="ADL18896.1"
FT                   /translation="MEQVLSRSPPRSRLKIYYDVLKSIADENGRARFSHVLSSANLPYD
FT                   RFIMYLSELEEKGFIIEERGNDGNYLVLTEKGMNFYRELRRMDYFLRGFGLSL"
FT   gene            complement(490125..490784)
FT                   /locus_tag="ASAC_0490"
FT   CDS_pept        complement(490125..490784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18897"
FT                   /db_xref="GOA:D9Q0Q9"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Q9"
FT                   /protein_id="ADL18897.1"
FT                   /translation="MAGGQLMLLRDFITLGGMLSLLSGVVALITSYIAFMYQRTVRASP
FT                   LNYISFGFLLLGIGLIIQGWLSMSLGLGIGNIYEDARLTYLAGVSYLLLQNVAYLVFAI
FT                   GYTKAAYWGALGALVIEPRQLREYFLLGHLVFDSSQVMSITLLSIVVFEGLLLESRGGS
FT                   KVSRLILLSFGFLLASHVIMLYSSAVRDPYFYIYGELVQFVSFALLALFLLRWSRY"
FT   gene            complement(490845..491663)
FT                   /locus_tag="ASAC_0491"
FT   CDS_pept        complement(490845..491663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0491"
FT                   /product="ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18898"
FT                   /db_xref="GOA:D9Q0R0"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R0"
FT                   /protein_id="ADL18898.1"
FT                   /translation="MRAIIVASPTLDRVRLPNGVVRLQAGGPALYAGFALRSLGYEVCA
FT                   LGTYGRLVSPTLKLESSLGIRRICCEGRGEGYVFAHYYDPGSPARRSTIESVSGPLTAD
FT                   DLYSALKECDPDLVIISPVYSEVPPELLGSSALRGRRVSVDVQGFSRSLGDGWWERLSP
FT                   EHVSLVHLSNDDAGESVAESLARKFPNVLYTVGPGGALIYVGGKVTAVPSPQGNELLED
FT                   RTGAGDVMLALVSHRFLMQGLPLDEAYLRSQEDFLEIMRRLSKAKVLGQS"
FT   gene            complement(491660..492712)
FT                   /locus_tag="ASAC_0492"
FT   CDS_pept        complement(491660..492712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0492"
FT                   /product="potassium channel protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18899"
FT                   /db_xref="GOA:D9Q0R1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R1"
FT                   /protein_id="ADL18899.1"
FT                   /translation="MVRTRSRLLLEVLEVLSAPYSVLSRLMPQMAALAVIIAITAYVFM
FT                   YFQHIDLVSAIYASVGLVTTIGLYTPSINAMPDSEKLFLTALVLASVATYTTIVMNIVS
FT                   TITKRTVWTDARARWRASHVKDHVVVLGDVPEVAAELDRMGIEYIMVTSNESLAASLQN
FT                   HRVIIGNPTSERELRAAGVESAAVVIIALESDSDSLTALIRVRRLNPKVRTVVMIHNED
FT                   LTDVFLDSGATQVVRLRRFIGRALAGMALSSNLGGVLLESTEGSSKALRQAGYGIGFFK
FT                   VEKGSKCDGMALRELPKGVIPVLVERNGVFTPYFSMDFKLKEGDGLVVLGDPTKFTGIR
FT                   EICSAGGGPS"
FT   gene            complement(492763..493398)
FT                   /locus_tag="ASAC_0493"
FT   CDS_pept        complement(492763..493398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0493"
FT                   /product="Putative transcription activator"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18900"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R2"
FT                   /protein_id="ADL18900.1"
FT                   /translation="MARASEVLRQSAGDLWNQYVRSRFVEMLRDGTLPRDAFRYYLIQD
FT                   SKYVEEMQRAVIRAASQAPLPEAVKVLLAVFANPERGAEVHSRLFSELNIGEVEVSSTG
FT                   MNLTSYAYTRHLNYYASLGWPEFLAAWAPCMWGYSEVGSYVMHSSDPLYRTWGEFYASD
FT                   DYNSRVRAVLEVLDQYSVTPEMQRAFVNSVRFEISFWESALRKDPTVY"
FT   gene            complement(493443..494654)
FT                   /locus_tag="ASAC_0494"
FT   CDS_pept        complement(493443..494654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0494"
FT                   /product="multidrug efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18901"
FT                   /db_xref="GOA:D9Q0R3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R3"
FT                   /protein_id="ADL18901.1"
FT                   /translation="MKAAKGSGDSFAVIAAIVILVTFGARASNNMIATTLPLLVKRLFN
FT                   FNGLAVGLIATAFMGSTFVSSTFINARLPAVSRRRFFVAAAIAYAALFPLYAFSSPLTV
FT                   WVLAVAAGMALGPIMPNIMTSAGSVRDLKARERLLTIYTLALSTSLLVGPAIDSVIVKY
FT                   VGLKASFIFFEPIAALVAVMAPLVRFPEEGHPSKGSTRPSVTSILANNGFIAASLNNLT
FT                   YSVPFAFITSFAGLYAEYRFHVSDSIALLLYSLFYTTSFLGRLVLAIRPPYNVVRLMIL
FT                   SSSLTLLGLIAAWASPTLLVYMAALLLLGIPHGLTYTLSVISISRTFEPRSLNAANSYF
FT                   FSIMMIIGSGLPAALGAIVTAAGYQTTILSIVPIVAVIFGATMFFARRASAVLVRPPMI
FT                   AEGP"
FT   gene            complement(494687..495028)
FT                   /locus_tag="ASAC_0495"
FT   CDS_pept        complement(494687..495028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0495"
FT                   /product="Methylated-DNA-protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18902"
FT                   /db_xref="GOA:D9Q0R4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R4"
FT                   /protein_id="ADL18902.1"
FT                   /translation="MNSLDERVYEVVKAIPRGKVTTYKAIAELLGVSPRAVARALKRNP
FT                   RPIEVPCHRVIMSDRSLGGYAFGGPEVKRLLLLSEGVRFDEKGKVLEDFIVRDLRSIDK
FT                   NLWVTSRNT"
FT   gene            495102..495614
FT                   /locus_tag="ASAC_0496"
FT   CDS_pept        495102..495614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18903"
FT                   /db_xref="GOA:D9Q0R5"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R5"
FT                   /protein_id="ADL18903.1"
FT                   /translation="MSEDNIKAAQLLGAALGAFVSSLLTALPASLEEIARQGGQSEGPS
FT                   SQIARWAVSTSQEISRVLDSKLPPQEVGKLVEELVVSFKGLASVAIELSKTLGDPQVAE
FT                   VIRRTSEGFKKSLNLISPSYYDPMAMVRAMSDPDVAYALGVILAILKAFGVALRVSADK
FT                   AVGGSKI"
FT   gene            complement(495687..495938)
FT                   /locus_tag="ASAC_0497"
FT   CDS_pept        complement(495687..495938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0497"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18904"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R6"
FT                   /protein_id="ADL18904.1"
FT                   /translation="MTIKVRIDPRDNCIADMVCVSLCGDVFEMSDVDGKSQIIAKWRAD
FT                   PNDINHGEVPDEFQDCVDAAAKSCPTQIIHYEGPNGSY"
FT   gene            complement(496053..496688)
FT                   /locus_tag="ASAC_0498"
FT   CDS_pept        complement(496053..496688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0498"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18905"
FT                   /db_xref="GOA:D9Q0R7"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="PDB:4FFK"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R7"
FT                   /protein_id="ADL18905.1"
FT                   /translation="MVSLKRYELPPLPYNYDALEPIISAETLRYHHDKHHLGYVNGANA
FT                   ALDKLEKYLNGQLTDIDVRAVSRDFEFNYGGHILHTLYWLNMAPKGKGGGTPGGAIGDA
FT                   INKFFGSFDKFKKLFGDAAKNVEGVGWAILAYDPVTGDLRILQVEKHNNVVTTNLIPLL
FT                   AVDVFEHAYYIDYRNDRAKYVDSWWDLINWDDVEARYQKALNTPKLIL"
FT   gene            complement(496744..497487)
FT                   /locus_tag="ASAC_0499"
FT   CDS_pept        complement(496744..497487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0499"
FT                   /product="Putative ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18906"
FT                   /db_xref="GOA:D9Q0R8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R8"
FT                   /protein_id="ADL18906.1"
FT                   /translation="MVSVAVKNLSYEVNGVHILNDISFTHSSGLLMIIGPNGAGKTTLL
FT                   RALAGLVKFRGSVELDGVRPEEYRRYISYVPAQPSLDLMARGLDVALAMNYRPPDGLWR
FT                   ERFLEVLGRFGLGGLANRPVISMSSGEQRLLLLAAALSRDPRLLILDEPTAFLDVTNRT
FT                   KVIELLQELAGDGVSVVVATHDIEYTAVADNVAVLKSGRLVSFGPPREALSEELLSDVY
FT                   GISIRRVDRNTPSYMPELLLKRFSK"
FT   gene            complement(497481..498470)
FT                   /locus_tag="ASAC_0500"
FT   CDS_pept        complement(497481..498470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0500"
FT                   /product="Putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18907"
FT                   /db_xref="GOA:D9Q0R9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0R9"
FT                   /protein_id="ADL18907.1"
FT                   /translation="MRAGQLRWLAPPILLALASLASVSIGPYSRVGLPQLVDLMVGHDI
FT                   PSTYFYIIVYRLTRTAAAIVLGVSLASAGASLQYTLRNPLVDPYLAGVASGALLGVTLM
FT                   IYLGRVGFLELYAAAMAGGLLTLALVTVVSSLAGGGASTFLITGVAASYLLSGLTMFLM
FT                   IDLGPRLPGALYWMFGSVAFVTANILEKSAAVAAASLAGLLLLARKVNTFMLGDEVARS
FT                   LGVNVSLVRALSFLLASSATSAVVAMSGPVGFIGLVSPWLARRMYGSNFTTVLPAAATI
FT                   GATLTVLSDIAARLVIYPSEAPLTAVTSVFGAPLLVYILLKSRSEGSW"
FT   gene            complement(498451..499722)
FT                   /locus_tag="ASAC_0501"
FT   CDS_pept        complement(498451..499722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0501"
FT                   /product="Putative ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18908"
FT                   /db_xref="GOA:D9Q0S0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S0"
FT                   /protein_id="ADL18908.1"
FT                   /translation="MSLGGAKGSASTVLLAATLIIMVVLVGLTAYSMYQVQVINRKLSD
FT                   ISSSVSNINSTVMSEVSSRLANESEYLGELLSQLNTSVSSQVAKIRGEVSGLEASIGFP
FT                   VAIVDALNQTVYVPSMPHRVVTLDPASTEIALAVGAAGQLVGVDNDSLVYLPPPFNYTI
FT                   NKLYQNGSVASIGSTWSSPSVEAILALRPDLVIGTAGWGYNNYIASVLSQYGIPVLLLP
FT                   SSSSLSDVYKSIIMVGEATGHVKDAVSIVENDSAIVDSLESRLHGLPEVRVAIILWVNP
FT                   TYVAGGGTFQDNLITLGGGVNAFANSSGWPVVTAEELLEVNPQVIILMSNGGLFNESYL
FT                   IQWLNSSIGPAYKNISAIASGRVYLVEGWYESVLSEPSVLAPYGALLIAEILHPQAFNI
FT                   SSLPSVISPSTLGVPGVNLEGGPA"
FT   gene            499849..500733
FT                   /locus_tag="ASAC_0502"
FT   CDS_pept        499849..500733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0502"
FT                   /product="Putative translation initiation factor eIF-2B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18909"
FT                   /db_xref="GOA:D9Q0S1"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S1"
FT                   /protein_id="ADL18909.1"
FT                   /translation="MLESIRRAVLEVSSEQIRGASWSAETLARAVIDDFSGGRASCDNV
FT                   DSISGLLISANPTMGSIDSLVWALKEACYSGRTLKDGAEAFLDYMKWSREEVVRHAVDL
FT                   VKGQPISVITISYSSNVVDVLTSLQNMVRKVYVLESLPGGEGRNAAAELRSRRLDVELI
FT                   VDAAASSYVGRTDMVLIGADNVTSDGCIYNKVGSKNLAILAGYFGKPVIAVFEPYKITE
FT                   DSQCGGVKLVERSYQADPWGEVSYKVFDELTRDLVDAVLSVRGLTDNTPAQISSLRRSF
FT                   EEWVMSRIEGRQR"
FT   gene            500714..501097
FT                   /locus_tag="ASAC_0503"
FT   CDS_pept        500714..501097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18910"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S2"
FT                   /protein_id="ADL18910.1"
FT                   /translation="MKEGSDEDNEAPLTELEKLILAHIYKYGPDSPWYMARRLMGASGW
FT                   APKYSEDEIEQACNDLEAKGYLTRFKGQLKREVTSSVKPWLKFKSREMGHKPNGVYYDL
FT                   TKAGRKLASTIYKAMRQEGTHDI"
FT   gene            501233..502138
FT                   /locus_tag="ASAC_0504"
FT   CDS_pept        501233..502138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0504"
FT                   /product="Mechanosensitive (MS) ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18911"
FT                   /db_xref="GOA:D9Q0S3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S3"
FT                   /protein_id="ADL18911.1"
FT                   /translation="MLYFLLLSALVVVIVILVGYVLIKLKLIPTGFEDYVYGVLWLIAS
FT                   VTVTQLIAIALRNRLASTVGPANASSVAFIVRLSGYVIAFVVFLAIIRVGVTEALAAGG
FT                   FAGLVVGLASQFVLSNIFGGIVIILTRPFKVGDRITFSTWQYGLIVPSYPPKFFSTDYL
FT                   IPGYTGVVQEINLMYTVILSDDNVPVKVPNSIMAQAAIFVHSDNEVRRVRTRYEVPKDL
FT                   DPETVIERLKKELSSLPIVADVPTIRVIETSQSTYVIAIDARCKTMFEDEARHNILITV
FT                   MKTVKAIQEEQKRAKPAGQP"
FT   gene            complement(502135..503223)
FT                   /locus_tag="ASAC_0505"
FT   CDS_pept        complement(502135..503223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0505"
FT                   /product="Putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18912"
FT                   /db_xref="GOA:D9Q0S4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S4"
FT                   /protein_id="ADL18912.1"
FT                   /translation="MSFIVMAFNSLYQYSWSVLSPLIASGLHINFLKVSVAFTLFAIFS
FT                   TASQLAVSPLVDRRGPRLIAPLASLLSAMGFLGTAFSTSLIEFYAFWSAGSVGEGVLYG
FT                   IASNAAVKWFPDRRGLATGLVSLGFGLGAAVANPFIGLSRSFREASLTIGVVELAALTV
FT                   ISSLIEYPRGLRGVDLTTTVRSPSWWLLYVTFVLSLVPLVSFSSSLGRLTDLKGYLFGV
FT                   AASLFPLSSGLGRPALGALSDKLGRPRTILASLLIIAFSSALALYGPALAKVVAVSLVG
FT                   FFNGAQIPLFFSIVGDLYGEAFSTSNNAAMYTGKAFSGLLGGVVIAALIEGGYGAGALV
FT                   VGSPLLASALMLAAVEARRRGR"
FT   gene            503413..504150
FT                   /locus_tag="ASAC_0506"
FT   CDS_pept        503413..504150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0506"
FT                   /product="Sugar-specific transcriptional regulator, TrmB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18913"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S5"
FT                   /protein_id="ADL18913.1"
FT                   /translation="MNELETTIRSLLGVNKYEAAAYLALLKLGKAKPQDIAKESSVPSQ
FT                   RIYDVLRSLESMGLVTEFDGVYQPIEPRQAINAIAESEIMKSLEKANRLRELGDMLSRT
FT                   YGASIKEGARVSLVRGLNNVFGAAMSYGSSCSSRPIFMAFKVFDRLAELLPELRKLVAS
FT                   LPSGALVIVPKGSLERYGQLADEFKRLGIEFVESEAAFIDLMVSCNAVIIGLPHGNDAV
FT                   AVVVVDKDFSEAMYRRLSEFISH"
FT   gene            complement(504147..505022)
FT                   /locus_tag="ASAC_0507"
FT   CDS_pept        complement(504147..505022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0507"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18914"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S6"
FT                   /protein_id="ADL18914.1"
FT                   /translation="MKVIDVSPGELRGYISSFVIVDEKVAVVDPGPESAYDKLRSGLEA
FT                   LGVKPDLIVVTHVHLDHAGSAAHLLKDFPSAIVFSHPRGVPHIVDPSKLYDASFKVAPI
FT                   LPRTYGKPLAASPERVFPAEDGKVLELGSSRVRVIYTPGHASHHMSLLLEPDGIIFTGD
FT                   SAGVIFTVKGHEVMLPTTPPPFKPMMYVESIDKMASLKPRSIAPTHFGIHGDAMAWLER
FT                   AKSQVTLWLKLIKGSSDHSYGVLEDLLAKNDDHVRSLLSDGEEFMIKGFLENTIDGLVD
FT                   AVKRGEPLPA"
FT   gene            505192..506025
FT                   /locus_tag="ASAC_0508"
FT   CDS_pept        505192..506025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18915"
FT                   /db_xref="GOA:D9Q0S7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S7"
FT                   /protein_id="ADL18915.1"
FT                   /translation="MAVMAVSFSSAAILVVLSGAPGPVAATWRLIISSAIVAILAWARG
FT                   SISSLLKLSRRDLMIALAGGLFLAMHFDLWMTSLRYISVAVSVTLVDSYPAVLIVVGLA
FT                   FFKEKYRPLEVLGSAIAMVGVALLSLSDPGDSFAIGVLLSLGGMAAMVLYLSVGKSMRT
FT                   RLDTFSYVTAIYAPAAAFSAAASLALGYNLLYYSVKTWLCFLGLALVPMMGGHTVMNYL
FT                   IGRRNFIASTIAMMAEPVGSAVLAYLILGQSILFIQYVYMAVTLAGIGLAVVPQG"
FT   gene            506125..506397
FT                   /locus_tag="ASAC_0509"
FT   CDS_pept        506125..506397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18916"
FT                   /db_xref="InterPro:IPR005354"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S8"
FT                   /protein_id="ADL18916.1"
FT                   /translation="MSAAQVSTEEKIRLAMTILTTIVNDAGVPRNIRRAAATALTYLRD
FT                   TKLSPAVRAANAVGALDEISQDPNMPLHARTKIWQVLTTLETIRD"
FT   gene            complement(506394..506984)
FT                   /locus_tag="ASAC_0510"
FT   CDS_pept        complement(506394..506984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18917"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0S9"
FT                   /protein_id="ADL18917.1"
FT                   /translation="MLSEGPYDLLWRPGGRAACVALVEDWPMVTLSVASGRPSITDPLG
FT                   LLKDAGEATAKVRRPGDLRVIGEATLADGDVESLRAPVRGWALVDVLDLEEAVAWIARL
FT                   VASAKPTFIYLVRGFTSPASVEASSLIVNARLPLIVPGLKGAKEISSLWRRGPRVIVGL
FT                   NKQISEDKKWALEEGLEEPRLMDIMLGLSGLGC"
FT   gene            507148..508827
FT                   /locus_tag="ASAC_0511"
FT   CDS_pept        507148..508827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0511"
FT                   /product="Acyl-CoA ligase (acyl-CoA synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18918"
FT                   /db_xref="GOA:D9Q0T0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T0"
FT                   /protein_id="ADL18918.1"
FT                   /translation="MSLPEEVPDRPGSELTITRIYERAKYLFPDQEIVYRTRRGVFRYT
FT                   YSDFADRVERLASALSSLGVKGLDRVATMDWNTHWHLEEYYAVPMMGAVLHPVNVRLAP
FT                   QEIVYTMNQAEDSVLIVNADFLQLAEAVVPNVKSIKHVIVVDADSVPSKVGGVQAYHYE
FT                   DLLKERGGRFEFQALNERRPAFMFYTSGTTGLPKGVYHSHRQVVLHAFSILSSVAGFGA
FT                   GPKGIQITSRDVSMIVVPMYHVYAWGFPFSSIMSGQKTVLPGRFDSKAYLELIKQEKVT
FT                   YFAGVPTILYMLLTDPESEKYDLSGVIFINGGSALPEGLALMAERRGMKVFVGYGLTET
FT                   APVLTLALPPSRLQDKLSDRELFYIKLRTGYPIFFVDIAVVDQDGKPVPKDGKTLGEVV
FT                   VRAPWVTYEYYKDPEKTEAAWRGGWFHTGDLAVWYPDGSILIMDREKDVIKSGGEWISS
FT                   LRLEDAISQHPGILMVTVIGAKHPKWGERPVALVVPRRGWEGKLTTEEINRFLTENFVN
FT                   RGAIPKWWLPDKVIEVQSLPLTSTGKADKKVLRAQYSDVLAK"
FT   gene            508957..510312
FT                   /locus_tag="ASAC_0512"
FT   CDS_pept        508957..510312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0512"
FT                   /product="Malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18919"
FT                   /db_xref="GOA:D9Q0T1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T1"
FT                   /protein_id="ADL18919.1"
FT                   /translation="MAEEEEGTEEWYKLSTELHRFYGGKIEVLPKVPVRRLKDFAIWYT
FT                   PGVAQPSRLISSDPDLSFELTSRWNTIAVVSDGTRVLGLGKVGPEAAYPVMEGKALLFK
FT                   YLGGVDAVPIVHRARDAAKFVELLQLIEPSFGGINLEDIEKPKCFTILDEARSKLQIPV
FT                   WHDDQQGTATAVLAGLINALKVVGKKLQDVRIVLFGAGASNVAFYRLLKALGHNMHNVV
FT                   AVTTKGVLHPEMKDIDKLMLTDPYQYQIAIETGGGGLPPNSPIEKAFDGADVVIAASVP
FT                   GPGVIRPEWVSRMNRDAVVFALANPVPEIWPSEARRAGARVVATGRSDFPNQVNNSLVF
FT                   PAVFRGVLDVRARTITDTMAIAAAVELAKFAEERGGVGEERILPTMEEWEVYPRVAAAV
FT                   AVKAVEEGVARRTTTYREELERATEIIGTVRQKIQLLWGNGIIPKPPVDYQG"
FT   gene            510318..510797
FT                   /locus_tag="ASAC_0513"
FT   CDS_pept        510318..510797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0513"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18920"
FT                   /db_xref="GOA:D9Q0T2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T2"
FT                   /protein_id="ADL18920.1"
FT                   /translation="MYAETGINIRRAIKEDVKQLSELIYRFYSFNAEFDPSWAAVNNLR
FT                   ELANDRANKLVEDQESLVLVAVQGLEVIGYLVAYVEENDLLINGRQLVIKELYVKPEQR
FT                   RQGVATLLVNRARDEARKQGASLVTVEFPAGNKIAEDLYAKMGFRPYLVRYVKEV"
FT   gene            510800..511288
FT                   /locus_tag="ASAC_0514"
FT   CDS_pept        510800..511288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0514"
FT                   /product="Putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18921"
FT                   /db_xref="GOA:D9Q0T3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T3"
FT                   /protein_id="ADL18921.1"
FT                   /translation="MSIENIVIRNMTEADIDQVAELVVRLKGLNEELDPHFKVVPNIYD
FT                   VVKEYLARSLKDENTVVLVAEDTSNKVIAGIIRFVIEDRLFYEPRLKAQITDFYIRPQY
FT                   RRKSLGKMLIDKTFEEARKRGAGIVTAIYPAGNSIADSFYTRLGFTELNKELYKPCSI"
FT   gene            511276..511788
FT                   /locus_tag="ASAC_0515"
FT   CDS_pept        511276..511788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0515"
FT                   /product="predicted metal-dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18922"
FT                   /db_xref="GOA:D9Q0T4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T4"
FT                   /protein_id="ADL18922.1"
FT                   /translation="MQHLSCITDAYLMACVPQGLPTNSFYPSGKLKLRVLVTYTGSRPI
FT                   SPSLQEYLTAIYKRGGLNSWVRTTDVAADLGMTPASVTEAFRKLAALGYIDYIPYRGVK
FT                   LTESGASVAEPIVRREMQIRSALITMGISEAESERLACMLEHAMSDEAVEKLSDFVKRC
FT                   SGGGHGQ"
FT   gene            511790..512227
FT                   /locus_tag="ASAC_0516"
FT   CDS_pept        511790..512227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0516"
FT                   /product="Putative transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18923"
FT                   /db_xref="GOA:D9Q0T5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T5"
FT                   /protein_id="ADL18923.1"
FT                   /translation="MRFGVSLPDDLSRELDLLAAKVNVSRSELVEQALRNMLSDYIHYL
FT                   VPHDCDGVMVALCPESRGSEDIIEQYSDIAETYIHAHRNGKCFEVLMLSGPSQRISELH
FT                   GKLLAAGCGVRFLPSLSLESYFSMPESAAQPTRKGEERVTL"
FT   gene            complement(512229..513350)
FT                   /locus_tag="ASAC_0517"
FT   CDS_pept        complement(512229..513350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0517"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18924"
FT                   /db_xref="GOA:D9Q0T6"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T6"
FT                   /protein_id="ADL18924.1"
FT                   /translation="MSSEERIDPWGRPDIKDYRRLYEVFGIRPFSEILEKLKSMGVEPS
FT                   AFMRRGIIFGHRDMDVVLNAWASGEPVAVVTGFMPSGQFHFGHMLTGLQLVFYQRLGFR
FT                   VFVCMADAEAYAVRRVSREEAIKSALEEFIPNLLALGLDPQRTEFYFQTGREGPYHELI
FT                   QLFSAKVTFNEMEAIYGDLSPAKVMSALTQAADILHPMLKEYGGYKYVVVPVGADQDPH
FT                   IRLSRDIATRMKGEIELTPPAATYHKLIRGLDGGKMSKSRPEATIFLTEPIGEAVRKFK
FT                   VSLTGGRNTAEEQRRLGGEPDKCPVFDQYLYYLVPDDSELSSIESRCRGGALLCGQCKA
FT                   MGAEKLAKFLEAHQRSLEAYRDKAQSLVELPKY"
FT   gene            513463..514407
FT                   /locus_tag="ASAC_0518"
FT   CDS_pept        513463..514407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0518"
FT                   /product="Transcriptional regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18925"
FT                   /db_xref="GOA:D9Q0T7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T7"
FT                   /protein_id="ADL18925.1"
FT                   /translation="MLDQVDTDVMRAIADYGPLTLSELSRTLGWSKSMVLKRVRKLESL
FT                   GLIRVRDEGGVIIISPGGSRAKAPAVIGIVRASEYPYIMRLVKKLSERYGSVTVKVYDD
FT                   ALQEAMDLAAGRIQLAMAPAITLVTLNRLTAGSVHIVGGGSQGGAGIVTGRGELGHATS
FT                   RMSSMELCAEVSRLEPPRVYANSGDSILDMALRGQVREAVIWEPYLSIAERRGLKVEQC
FT                   DLETCCLLGANSSLEGEYDRIAKAMEEAVSEVREADLQAYANLVRMPYELVSESVRSYS
FT                   FLERPDREVLRRLLPYMRSVALPSSAVSEAVRA"
FT   gene            complement(514397..515743)
FT                   /locus_tag="ASAC_0519"
FT   CDS_pept        complement(514397..515743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18926"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T8"
FT                   /protein_id="ADL18926.1"
FT                   /translation="MSYVKGPSYAIRVVEGLATPKVNGREVTVGAELLRLDASLGVMGE
FT                   SLASLLLPAVDYSSDLASIVKSYRTRVVVEEASEAITRLGPLAGLAKVPPYFFPIARMS
FT                   KLSWLYSCIFNESTRNVDLLGEIYSDYAKLVGDLTPEGYVKLSESKVKGSVASLISGIV
FT                   KSVAAGISVAGAYMSFFMRSSECPPNVLLEDPYRTVVIPEGILFSSCRWTSHPVELEME
FT                   RATCRRSSLLYSSLLCEDGNSRAVIKDYGYGTFKWLFAGVVSITAYPFIQTPSGRASNE
FT                   YRRLLELRQYVRTPRVLALCINPMEASMVRDYVDGSDVLRSRDPAHWQEAGRVLATVHR
FT                   SGYALGDPNPSNVVIGRDGAWLIDVEQAGKFTPQRGAWDLAVFFYYSRFFGAPLDLVKE
FT                   SLRSYASSLEPSLWKKVRGQLFSARLAPFLASLPLLFFELRSAVESIKP"
FT   gene            complement(515740..516000)
FT                   /locus_tag="ASAC_0520"
FT   CDS_pept        complement(515740..516000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18927"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0T9"
FT                   /protein_id="ADL18927.1"
FT                   /translation="MTKRRSVIRQVINRALMSGRPQDYVIVYVDRDPQAGQRLAELNAS
FT                   RIAAVSEWALTLDDGDTVIPLHRVVEVRGPNGEAWRRGLKS"
FT   gene            516060..516548
FT                   /locus_tag="ASAC_0521"
FT   CDS_pept        516060..516548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0521"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18928"
FT                   /db_xref="GOA:D9Q0U0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U0"
FT                   /protein_id="ADL18928.1"
FT                   /translation="MPEDDAFCKIARGESKAYVVYSDDKVMVILDRSPICRGHMLVISK
FT                   DHFTAVEDVRPDVVSRAFLVAAAIVKYLKRELKAPGVNIVTNSGSQAGQVVFHFHVHII
FT                   PRWADCPPPIFSDEGANITRVAQRHRLTEAEAAEVLNMMSGVINYIEEYVREEQNPGR"
FT   gene            516661..517350
FT                   /locus_tag="ASAC_0522"
FT   CDS_pept        516661..517350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18929"
FT                   /db_xref="GOA:D9Q0U1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U1"
FT                   /protein_id="ADL18929.1"
FT                   /translation="MGFLACRAELHSHSRASDGKPTPEEVVIRAAQLGLSAVALSDHNT
FT                   FRGSALAQASAKELDLDITIIPANEVRTSRGDVLVLCPSLPDEDPPKGIEPPELRKWSL
FT                   ERGCIMIAAHPFQPGRKGVGRYLFSHYTEFDAVEVWNARGLPPLNWLAERFARSKGLPM
FT                   TSGSDAHVISELGEAPTVVFAEGCTAEQIIEAIKKGMCRPTKGRMGFKALREAVEWSVG
FT                   RRLGRAY"
FT   gene            complement(517344..518843)
FT                   /locus_tag="ASAC_0523"
FT   CDS_pept        complement(517344..518843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0523"
FT                   /product="hypothetical protein"
FT                   /note="DUF2139 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18930"
FT                   /db_xref="InterPro:IPR016675"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U2"
FT                   /protein_id="ADL18930.1"
FT                   /translation="MLHDHPPSYAPEWGSGGIFGLKYYRGVLYYTLAFDAIANFVTDSG
FT                   VERYRFEQVGPLPTSGGDTYNAVDAVDDNIYFGGWVHAPAVYEGSEASLRGTISFVNKY
FT                   SHVHFYDVEDRRVSLLWKEGAARKDEWAGEVSEIIYNPVQDELLVARGDGTINLGVYGI
FT                   DRRTGEPRKLSERPALKGALVYEYACFDILERQIKDIHGVLFTKAVTGIQCVNLTNGKV
FT                   TYTSLGDISRRSVDGAPVSWPQTGPAASAYGRFFLFVKGGAFVGNPIDEGTEPVRFVRL
FT                   FDFGESGYFSRRTVAKPIGGGVMVAFNAYSESLVRPTNQFEEMVARATNTIVGPSVLLY
FT                   ITPPVARIVGAYGARITSFESVGDRLVIGANTMSNTSRYNALPLDIGYRGFIIEPISEV
FT                   LERGPPVRFSVPGALVKDKVFGGIPLTGYSRPRLVIRAGRSNRLHVYEYDFSLPAQDAY
FT                   EETYDITGGKNVMDLSGFGSSILSFRLEDPDPRARIVIDLQ"
FT   gene            519002..519670
FT                   /locus_tag="ASAC_0524"
FT   CDS_pept        519002..519670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0524"
FT                   /product="cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18931"
FT                   /db_xref="GOA:D9Q0U3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U3"
FT                   /protein_id="ADL18931.1"
FT                   /translation="MIDLTCEVYNGMPTYPGDPPFRHEFVLMGSREGEVTLSRLEAGSH
FT                   SGTHVDAPLHFIPGGLSVDRIPPERLVLPVDFVDLSYKRPKEAITSRDLEGKVHAGRAA
FT                   ALYTGFSGLRGSEDYLHAWPYLSRDAADYLAGVGVGAVVTEAMSVSGWAGAKGYPWPPL
FT                   VSEEDAAYVHVRLLSSGVIIVEGACNLGELAGCRDPLLVIAPLKVRGAEGAMARVLAIC
FT                   "
FT   gene            519777..521216
FT                   /locus_tag="ASAC_0525"
FT   CDS_pept        519777..521216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0525"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18932"
FT                   /db_xref="GOA:D9Q0U4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U4"
FT                   /protein_id="ADL18932.1"
FT                   /translation="MKVLLALPPDIHNLEIYKVTGMRAPPLGLAYIASVLEQAGHKVKI
FT                   VDSPTRKLNLKSWMAEVKAFSPDIVGISMQTPLAPKGYMAAKALRQEMPDVILVAGGTH
FT                   PTYMYDEALDAGFDFVVRGEGEFTMLELTSTLESKGKDYEALRSVKGIAFREGSKTVVT
FT                   PDRPFIEDLDKLPWPDRDLLDMDKYTLFNKPIRIAHVMASRGCPYGCMYCITSYYWGRR
FT                   YRYRSAKNVVDEIEYLVNRYRAREIVFTDDEFTANWRFVREFIAELKSRGLDVKFSCGS
FT                   RVDHVNKDIMKLLYDNGCNALYFGVESASQETLNRIGKKITIEQARRVFEWKRELKGFA
FT                   TGSFILGFPWETVDDMKRTAQLAVELSPDYAQFTALTPYPGTPLWDFAVKHNLIVDTNW
FT                   EHYTTVRPVMRGFHFTAEQLGRALIYAYRKFYLRLGFISQELRAGRLGDLMSVLARETL
FT                   SAFGDAVGRIFEPLRWGGEGE"
FT   gene            521203..522747
FT                   /locus_tag="ASAC_0526"
FT   CDS_pept        521203..522747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0526"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18933"
FT                   /db_xref="GOA:D9Q0U5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U5"
FT                   /protein_id="ADL18933.1"
FT                   /translation="MKVSEGFSPAGPDPDDGRRGNIGHLLAGVRLVFNNPVTRASLRLA
FT                   SRTVRVKYGDGTVKEAPLIYHALSRFVGEQIVECPLYARFLIPIIDKTIEFGIRMLHGD
FT                   VEDARKSISDPAIRRGVALVMKGLGLYGVTVPQKMPAPFLIVWNFTNMCNLRCIHCYQR
FT                   AGAPTPDELTLEEKLRVVDELDRAGVASIALSGGEPTIHPHFHAVLKAIASRGIHAAVA
FT                   TNGWVFANINELEKAKEEGLKYVEVSIDSASPEKHDKFRGVPGSWERAVKALENAVKLG
FT                   MDHGMAVTITKMNIDEVKELLDLAEDIGVKRVIFFNFVPTGRGLENVWLDLDPVEREKF
FT                   LRSIYQEMKRRPGLQIVSTAPQYGRVALQVSGGQEVAPTHFAVSGDPIVRAVAEFVGGC
FT                   GAGRIYAAIQPNGDVSPCVFLPVVVGNLRKQSFWDIWTKTPLFNDLRDRDKLKGYCRVC
FT                   PYRNICGGCRARAYGYYGDPLAPDPGCIYNFKEWQQLASKAPRVRVVNAKETSGRE"
FT   gene            522839..523384
FT                   /locus_tag="ASAC_0527"
FT   CDS_pept        522839..523384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18934"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U6"
FT                   /protein_id="ADL18934.1"
FT                   /translation="MRASAIAAIVIVIIAVAAGGAYLAVSRSQGSVYVYISDPGRGGNV
FT                   TTTGIYLTVTSIMVHSASTGKWLTITNRTITVLLSSVPQAVAQANLPPGVYNEVRLYVS
FT                   SVTVQLGSVNVSAKLPSNALKIPIVNGGLNVTAGRRAYLVISMGPHVTQAAGGYIVSPV
FT                   AVAYAYYAPPNTTTNTTA"
FT   gene            523642..524598
FT                   /locus_tag="ASAC_0528"
FT   CDS_pept        523642..524598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0528"
FT                   /product="GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18935"
FT                   /db_xref="GOA:D9Q0U7"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U7"
FT                   /protein_id="ADL18935.1"
FT                   /translation="MRYVRVFAPSHLHAGNLDLCGDMGRLYGTVGFTLEGPGIVVRVEE
FT                   SDILESNDQHALQALRTLRERFNLRGARVTVERSYPPYSGLGYVTGLYFAVAEGVSRLY
FT                   GLGLRLEDVALAVRRGLVTALGLYAAKVGGFIVEGGFRKDMAEREVPPLIFRGDIPAHW
FT                   LFIVALPYGPLPRIQRFRASSEDKALSEVREDCGLASRLSRLVLMKMLPGFVEGDIKEF
FT                   GESLTEFNRLLGLAWSSYQGGTYCCPLVEKGIEIMLKHAYGVAQSSWGPTFYGLTDDER
FT                   EAERAASEIEELLKANGGGEVLITRGRNRGIEVVDYG"
FT   gene            524699..525802
FT                   /locus_tag="ASAC_0529"
FT   CDS_pept        524699..525802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0529"
FT                   /product="hypothetical protein"
FT                   /note="DUF1464 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18936"
FT                   /db_xref="InterPro:IPR009927"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U8"
FT                   /protein_id="ADL18936.1"
FT                   /translation="MVRDPGAVLRRLKEIVREKGVDAVVASSGYGIPLKLAREASDEEI
FT                   ALATFISAEDAAKGHRILGLRRLLKMIKEEPELRDITYFTPGVVQLPTVPAYRKLNRVD
FT                   MGTSDKVYSAALAIARHAEAFNLSYNDVNLIVVEVGFAYTSAMAVSSGQLVDGVAGTAG
FT                   FPGYLGSGCVDGEVAYAISNVSRITKEMLFAGGAAYLGQGNPFTRPVEDFVSSGGDGYR
FT                   ALIESAAKDVMSLLVSTRPQAVYVSGRFSRIEGFVDDLGRAINGGLQGLWTGLRVVKLK
FT                   ASGRVAKEAAEGAAVIANGLAGGRYRKLVDVMRLRESSGSIFDYVTMFDREELRRAYSR
FT                   LLGVDPEPRAMPEGYQQSYGSGKGTQQ"
FT   gene            complement(525822..525908)
FT                   /locus_tag="ASAC_R0021"
FT   tRNA            complement(525822..525908)
FT                   /locus_tag="ASAC_R0021"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC"
FT   gene            526037..526567
FT                   /locus_tag="ASAC_0530"
FT   CDS_pept        526037..526567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0530"
FT                   /product="hypothetical protein"
FT                   /note="DUF84 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18937"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0U9"
FT                   /protein_id="ADL18937.1"
FT                   /translation="MAEGPCLDVALGSQNPVKVDGVREAFEAFYGCATVIPVSVSGLPP
FT                   QPVGLEQTRRLAILRASRALEAARAHVGVGVESGMFKVDSAWYVTTIACVMKGGKVACG
FT                   ASPAFEVPEDLARESMSSELDRAVEARYGIRDIGSREGIIGLMTKGIVVRKDLVRWASL
FT                   MALAGLNGLPRAP"
FT   gene            complement(526542..527777)
FT                   /locus_tag="ASAC_0531"
FT   CDS_pept        complement(526542..527777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0531"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18938"
FT                   /db_xref="GOA:D9Q0V0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V0"
FT                   /protein_id="ADL18938.1"
FT                   /translation="MSYADLSSAVKVVDGVYWVGVNDTRKVRFENMWPIPEGISYNAYV
FT                   IGTGGGYVLVDGVEEEYTDLYLAKLSKVVDDMDKVKYIVVNHLEPDHQGSLEETLRRAR
FT                   NAKVLISAVGARMIRDFYDVPEDRVVPVKDGDRLEVDGKILRFIYTPWLHWPETMVTLD
FT                   ETDSVLFTCDVFGSYVALRGGLFDDQLEMEHYIEEAKRYYVNIVGRYTKNTIDALNKLS
FT                   AVLDKVKVIAPAHGPLYRGDPRLPVKLYYDWALPRLEPEVSILYISMYGHTVDAVKRLS
FT                   DIVKSHGLRVRLIDAAEEHMSYALSYSNNSAAVLTVFPTYDASIPMPLNNILYTYQVKM
FT                   FGRGRAAGVVTSYGWGPVAKLAADTLTKAGFRVVEPLVTLRTRPRKEELEALDKLGERI
FT                   AEEALKALEGGH"
FT   gene            527977..528768
FT                   /locus_tag="ASAC_0532"
FT   CDS_pept        527977..528768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0532"
FT                   /product="Putative xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18939"
FT                   /db_xref="GOA:D9Q0V1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V1"
FT                   /protein_id="ADL18939.1"
FT                   /translation="MRVAYATMLYRTLPPAEAVVKLHNMGVDYYELSYDNFINRKGQED
FT                   ALLEETQAALKRQGLLVSSVHLPYDKPTLDMLAQGKEGAVTRMIRWMRAARDMGATIAV
FT                   IHTLPLKRSESAIAANVSVLGRLVKEARELGLTLAVENRLEGDLVGSSVDELIKMASSV
FT                   DGLKLCIDVGHLNVNTKSPPDEISKASQAGLIAEVHAHDNDGYADEHALPMTGTVDWYR
FT                   VAGALLHFDGQITYEVSCGGPEAKCDNYVRFLKMFNRNVFS"
FT   gene            528821..530227
FT                   /locus_tag="ASAC_0533"
FT   CDS_pept        528821..530227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0533"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18940"
FT                   /db_xref="GOA:D9Q0V2"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V2"
FT                   /protein_id="ADL18940.1"
FT                   /translation="MIHVSEVKFWAVEEAIDNPPDPPSKFEGKDCVVGFISVEEGDTPD
FT                   LAGQAAMEIAEHARRSGVKCAVVYPFAHLSPSLAPPDVAAEILRKVEDELKSMGFQTAR
FT                   APFGWYKGFTITCPGHPACELSRTITAPKGPWYLPGDGSQLGIREAIERGLLPKEVEVG
FT                   SPWDNESLGSQSKLGLTSGGLTSLGEVATGALSSWLAERLRLANVETRGGGPEQVYGIG
FT                   GVAAVVKSCLDAGRYAESGVRVRSPLPGADMIVAPTDVGDEAMVKMLEELEEGISKDTT
FT                   WIDVGTSKGFSIPYDIQYSLRLLAYRTRGGGLAALGLHGAVRDRQVTCFGPLRLIMSSL
FT                   IDFGLKLADSGKTPYLPFWLSPLQVAVIPVKDQHVEYARRLLQDLIDVGARAYLDPPTK
FT                   GLGARVRAAGKAWVPIIAVVGDKEVESNTVNIRRRWLQGQQEVVQAEALVEEVSQLLAS
FT                   GPGRSFQPPE"
FT   gene            complement(530228..530386)
FT                   /locus_tag="ASAC_0534"
FT   CDS_pept        complement(530228..530386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18941"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V3"
FT                   /protein_id="ADL18941.1"
FT                   /translation="MTKWRVRCTECGLERDLETGMDLSTLKGNRIYMYCPRCRRNTFHE
FT                   ILGRSED"
FT   gene            complement(530383..531120)
FT                   /locus_tag="ASAC_0535"
FT   CDS_pept        complement(530383..531120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0535"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18942"
FT                   /db_xref="GOA:D9Q0V4"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V4"
FT                   /protein_id="ADL18942.1"
FT                   /translation="MARLKLSPRFVLTFAWFYGWSSVKRGPGWVLSYMAWPLALLFMIY
FT                   MLSRGRLIDYAILGGVISTVTSNALSALGDTAFMKLEIKLQDLLVAADVSPIEYLVGIG
FT                   LGNLLYSFPGLAVFLALLIVFRVLTTPLEWAVLVVALLFLAVGGAGLAFLGGSRLRHVR
FT                   NSWGLASFLSIFLTMIPPIYYPYTALPRPALYALMLSPATPAAVFLQQLMAGDPPSFAL
FT                   LGIFIVENIAYAMLGLWLGRWED"
FT   gene            complement(531107..531970)
FT                   /locus_tag="ASAC_0536"
FT   CDS_pept        complement(531107..531970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0536"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18943"
FT                   /db_xref="GOA:D9Q0V5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V5"
FT                   /protein_id="ADL18943.1"
FT                   /translation="MDVIETEDLRKVYPNGVEALKGVSVRLSARVPCIIGRNGAGKTTL
FT                   VRILSTQLRPTSGRARVLGLDVVADREALRRRICSIPQEARPMGVASPYEHVVMYLVAR
FT                   GWSMSEAKQAARRVLKDVGLGNFMDIATDELSGGMKRKVFLAMALAAQAELTFLDEPTA
FT                   GLDPLSRLETWGAMRQLKSYILLTTHDMEEAQTLCEYLVLLDSGRVIAQGTLEELMRPL
FT                   QGKVRVEGYGDISIGGMRISYMTPEEARGLISDGLKVTIRPVNLDDVFIINGIRPLSED
FT                   EGNGEA"
FT   gene            532100..533422
FT                   /locus_tag="ASAC_0537"
FT   CDS_pept        532100..533422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0537"
FT                   /product="Fumarate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18944"
FT                   /db_xref="GOA:D9Q0V6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V6"
FT                   /protein_id="ADL18944.1"
FT                   /translation="MSSYAERARPYYLETGTRPPRRLIWAVAMIKAAAARANRELGLLD
FT                   AVKASAIESSALEVAKGAHDDKVTVDVFQTGSGTGINMNINDVVADLASGLCGCRVHPN
FT                   DDVNMSQSSNDVMPTALRLAAVAAINEDLLPAVRELVSALREAGSRFSDAVRPGRTHLR
FT                   DALPITLGQQMEAYAHMVERDLSAVTSVLGLLYEVPLGGTAVGTGANTDPRFAEVALKE
FT                   LSSLSGVSLRPSPSKSALMRSLSDVVALSGALRSLALDMLRISNDLRLLNSGPNTGLNE
FT                   VEVPVDVPGSSMMPGKKNPVTLEAVNQGAAQVLGYDQAIAWGASLGELELNMGIPVVAY
FT                   NVLKEVELLAEMARKLARTVSQVIPHRERMLQLAASSQALVTFLSPLVGYDVAAAISEA
FT                   ISRGASLEDAVRSAVKDEEKARKVVELLSDVRKLTGPVRLR"
FT   gene            533756..534550
FT                   /locus_tag="ASAC_0538"
FT   CDS_pept        533756..534550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0538"
FT                   /product="Oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18945"
FT                   /db_xref="GOA:D9Q0V7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V7"
FT                   /protein_id="ADL18945.1"
FT                   /translation="MRLCDKEASPLGLGTWGMGGGFWSPDHSRDDVYVNAIRYAYERGI
FT                   RVFDTAEMYGGGHTEELVGRALADVADDVIIISKVWPNHFHYDDLVRSAEASRRRLGVK
FT                   SIDVYLLHWPSRDVPLQESIRALEDLVDRGVIRCMGVSNFDRQLLEEAMSLARRHEVVV
FT                   DEVEYSVYNRWAERDLIPFARQAGVTIVAYSPLGRGSVSSDSRLARVGAKYGKTPVQVA
FT                   LNYLMRSSLPIPKASRKEHIDELLGAVGWSLSDEDYNYIRSL"
FT   gene            534663..536582
FT                   /locus_tag="ASAC_0539"
FT   CDS_pept        534663..536582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0539"
FT                   /product="Acyl-CoA ligase (acyl-CoA synthetase)"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18946"
FT                   /db_xref="GOA:D9Q0V8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V8"
FT                   /protein_id="ADL18946.1"
FT                   /translation="MSKVTEEIYSVRKLQALSSLASKDPAAFWAQQVDLIDWFQRPAKV
FT                   LEGSPPTERWFAGGLMNVSYNAVDRHLRDKADKVAFYWTNESLDYRAITFRELYYQVNR
FT                   AAYVLRQLGVKRGDVVSMIMPSIPEAVYFGLAVHRLGAILAIHYVGLSDDVMAFRLQDA
FT                   GSKVLVVASKGFRAGQEIRIKDIADRVLNNFKTPVEKVLVVSRGFSDFNVNGSRDVVYE
FT                   DIAPRGKVYVPPEPVDASDVGTIYYTSGTTGRPKGITQTQGGYAVALNWTFKALFNLGP
FT                   SDVWWTISELGWPVWPMANLYTAPVMGVTAVLFEGFVGQRPDLFAKVVERFGVTHVWSS
FT                   TTTLYTLKGLGSESVTGGDTSTLRIILNTGEPLNVGAWQWFRENLPNTYIGDAYWMTEH
FT                   LSPIAATPYGIAEIPFRPGSAGIAFSPTRVLIVDDEGKQLPPGNKGYIVLSPYTPALGK
FT                   MWNDPNYERYIKTYWSRFPGYFYTGDYGYMDEDGYLYVLGRADDVIATTGQRIGTMEVE
FT                   STIGTHPAVAEVAAASMPLPGGKGSALLAFVVLRPGYQPSDQLAEDIKAYARNAGYIVD
FT                   RVVFVRKLPKTKSGKIMRRLLRAALNQEPLGDTSTLDDPAAFEDTRRMIEQVREEFRKL
FT                   LQQS"
FT   gene            complement(536588..536986)
FT                   /locus_tag="ASAC_0540"
FT   CDS_pept        complement(536588..536986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0540"
FT                   /product="hypothetical protein"
FT                   /note="DUF1634 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18947"
FT                   /db_xref="GOA:D9Q0V9"
FT                   /db_xref="InterPro:IPR012861"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0V9"
FT                   /protein_id="ADL18947.1"
FT                   /translation="MPRNISFEDIIGWTLRVGVLISAVFIIFGIGLIYVHRGAGIYTFK
FT                   DLVAANSPVNTSILPVSYINSRTVMGLNGLAYVLIGLIILMATPVVRVAIGIAQFAHER
FT                   NWLYTFITAVVFINLMLAIFVIPALVVK"
FT   gene            complement(536999..537865)
FT                   /locus_tag="ASAC_0541"
FT   CDS_pept        complement(536999..537865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0541"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18948"
FT                   /db_xref="GOA:D9Q0W0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W0"
FT                   /protein_id="ADL18948.1"
FT                   /translation="MLHVPIDVFFALVVIVSIISGFLGALVGLGGGTFLVPLYTLFLGI
FT                   PIAYATGASLISTIATSSGSASAYVKDRITNVRIGMGLEIATTTGSIVGSLTAAFVYAH
FT                   HLEYIIYIVFGVVLLSQIYFQMERSRFELPKPIKPDWTTRVFQLHGEYYDEALKQEVKY
FT                   YGVRWWLGETIMFFAGFISGLLGIGSGALKVLGMDWAMNLPMKVSTTTSNFMIGVTAAT
FT                   GSAIYWAFGLIQPILAGFTALGVLLGSMTASKILPKITNRSIRYIFTAILAFLGVEMVL
FT                   RGVGIIH"
FT   gene            538059..538796
FT                   /locus_tag="ASAC_0542"
FT   CDS_pept        538059..538796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0542"
FT                   /product="Putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18949"
FT                   /db_xref="GOA:D9Q0W1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W1"
FT                   /protein_id="ADL18949.1"
FT                   /translation="MEELEEFAYKAVAVRIAGDIVLSDSPGAALRKWREYFKLSQQEVA
FT                   KYMGVSSSVLSDYEKGRRSPGAGFIRRFVTALLKVDAEKGTKRSENLVKALGIPTTGII
FT                   DMQEFSEPMTLEDIIITVDGILLYPDYPKGIVAYGYTVIDSIKAITELTSMQFYTMLGS
FT                   VPERVIVFTKVTAGRSPMVAVRVSLVKPSIIVIHGPREHVDYLSIELARLDRIPLVLST
FT                   LNSVDELVQRLRSRTGGRGFTIP"
FT   gene            complement(538783..539127)
FT                   /locus_tag="ASAC_0543"
FT   CDS_pept        complement(538783..539127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0543"
FT                   /product="Nascent polypeptide-associated complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18950"
FT                   /db_xref="GOA:D9Q0W2"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W2"
FT                   /protein_id="ADL18950.1"
FT                   /translation="MGVNPRELKRMLKRMGIEAEELEATRVTIEAKDKQLVVEEPQVII
FT                   VRGRNQPTMIYVVGEPKEVKPQQPAQPQVSEEDVKLVAEQAGVDLETARNALIAANGDI
FT                   AEAILKLKGS"
FT   gene            539226..540515
FT                   /locus_tag="ASAC_0544"
FT   CDS_pept        539226..540515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0544"
FT                   /product="Putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18951"
FT                   /db_xref="GOA:D9Q0W3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W3"
FT                   /protein_id="ADL18951.1"
FT                   /translation="MGSSDETPKVRILGSGREVGRAAIGVEHRGRMVLLDYGVNFDENE
FT                   QPIYPLHVRPKDVEALVLTHSHLDHVGAAPALFISVKPRLLATPLTLDVTRLLLYDMIK
FT                   LNGPNLIFDNSTVDDMLGVAESVDYERSFELDDFTLTLMSSGHIPGSASVLVDVNGRKV
FT                   LYTSDMNTIETKLMNPHKLTGVKADAVIIESTYSTVTHPERENTEKEFYESVEDVVKRG
FT                   GTVLVPAFSVARGQEIMCLLEEKGFGWPVWIDGMIRSVTDLYLAHSSFIKDPRLLAKAL
FT                   EDQKVVKGWGDRKKALKKPGVIISSAGMLKGGPSLYYYTRMVQNEKDAVFLVSYQAPGT
FT                   PGRQALEEGVFFDGERKLPVKARLQIFDFSSHTDWKGVLQTLKSLAGVRKVILVHGEPQ
FT                   GQMRLASKIKDELGDVEVLVPQNGDEIPVD"
FT   gene            complement(540617..541327)
FT                   /locus_tag="ASAC_0545"
FT   CDS_pept        complement(540617..541327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0545"
FT                   /product="Phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18952"
FT                   /db_xref="GOA:D9Q0W4"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W4"
FT                   /protein_id="ADL18952.1"
FT                   /translation="MPLKAVGSDVDGTLTVRRGDLRVSVHAIRGIRLLESRGVKVILVS
FT                   GNSLPVTAGLSVYLGSSGPVVAENGCVIMYRGQIYHVCSGRPPEGLLRKLQDLGLRPSW
FT                   QNEFRYHDMAFFMPRGVDENSKAELLRAVSEIAEAHGLRVLWSGYAVHINPGNGKGEGL
FT                   LRALELIGVSASEAAAIGDGENDLDMLSVVPISGCPGDAAPAVKVKVKFVARGRGGAGF
FT                   LEFARWLLAKGERN"
FT   gene            541418..543088
FT                   /locus_tag="ASAC_0546"
FT   CDS_pept        541418..543088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0546"
FT                   /product="Putative succinyl-CoA:3-ketoacid-CoA ligase,
FT                   fused subunits A and B"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18953"
FT                   /db_xref="GOA:D9Q0W5"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W5"
FT                   /protein_id="ADL18953.1"
FT                   /translation="MSDSVVSLIARKKIVNDPDFVLSQIKDGDVVAISGFNEITSPDYL
FT                   IERLYRLYLKTGHPRNLFIISDTFPGTPGRGLDSIAQMMYKRGDRDFIRGMLVAFYGWS
FT                   ETLQKMIKEEWFEAYAWSIGILAYWFREVGSGRPGVLTRVGLNTTADPRYDGTALNETA
FT                   KERRTVKVQLLNIDGKEYLLYTAPKPKFALIRGSTADEIGNLSLEDEVAYGTVLNIAQA
FT                   TKAMPEKGTVIAQVLRVARFGTINPKSVVVPGPLVDYVVVAPREYHRQSHSFDYDPIVA
FT                   GRVIPPADVMTAQMESGLDERKVVARRVALELARLVEKYGRPVVVNLGVGIPAMVGEVA
FT                   MEEDIQDLVVLTVESGTWGGRPLYGPDFGVSIGAFAVLSVPDQFTMYEGGVIDAASLGF
FT                   MQIDKYGNVNSFFTESKIPGPGGFPAIASGAPDIYYAGLFTAGRGTKYEVADGKLRIIS
FT                   DGNIVKFVNKVDKVGCSSKVMIENRKNVLYITERAVFRLTPEGLELIEVAPGVDLEKDV
FT                   LAKMEFKPIMKREPELMDPRIFMPKKMGMKEELVKAIRV"
FT   gene            543136..543414
FT                   /locus_tag="ASAC_0547"
FT   CDS_pept        543136..543414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18954"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W6"
FT                   /protein_id="ADL18954.1"
FT                   /translation="MGTCEVKARKGLIRVSSEVVGGVIARVSITGDFMVIPEDKVFELE
FT                   ESLVNTRFDRGEVSGVVRRVLQGSSLVGCSEEDFVDAIMCSGEGDAA"
FT   gene            543404..544222
FT                   /locus_tag="ASAC_0548"
FT   CDS_pept        543404..544222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0548"
FT                   /product="Biotin/lipoate A/B protein ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18955"
FT                   /db_xref="GOA:D9Q0W7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W7"
FT                   /protein_id="ADL18955.1"
FT                   /translation="MQLRVLLYETPDDPYMNLAFEEALPRARGCGISPDTLRLWRNRRA
FT                   VVIGYFQRAEEEVNLAEAERQGVKVVRRFTGGGAAYHDLGNINYAISLSLGERKVSNPV
FT                   DFIFTELIRAPVEALRSLGFEASVQNVNDIIVDNRKVSGTAATVSWGSIFFHGAMLVSA
FT                   DLSALASVLKVPLKKLIDKGVSSVKYRVTNLAALRPGTTVNDVASALASSFAKVLGYDG
FT                   VKYDLPTSEELEMAEILYTYKYSDRSWNMDRAPHRQFRRAEEELMRVCRR"
FT   gene            544280..544705
FT                   /locus_tag="ASAC_0549"
FT   CDS_pept        544280..544705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0549"
FT                   /product="Putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18956"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W8"
FT                   /protein_id="ADL18956.1"
FT                   /translation="MSSLSVWTSKVGDVARKNVVSATADATLAEAARLMYTKGTGSVVV
FT                   VSPEGKVIGIFTERDLSRVVADRVSYDSKLGDLMTKDPVTIRDDEPITKAVELLSTRKI
FT                   RHLPVVDREGKLVGIITARDIVDITERYLASTGFVSE"
FT   gene            complement(544708..545196)
FT                   /locus_tag="ASAC_0550"
FT   CDS_pept        complement(544708..545196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0550"
FT                   /product="hypothetical protein"
FT                   /note="DUF998 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18957"
FT                   /db_xref="GOA:D9Q0W9"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0W9"
FT                   /protein_id="ADL18957.1"
FT                   /translation="MSINPWFVFTKNAFSDLGGPRATDPWLYNYGLIAVGALIIAFASY
FT                   AVSVSSEKLEAVGASFMMVAGLFLALIGVFHEGTYPHVFVSQWFFAQMDMTSIVWGAGS
FT                   IVSGRAKRGAAEVAIGVIGPAGAIAFRWPSAATLEAYGIVLIDLFVILMTFDLRDLEG"
FT   gene            complement(545301..549332)
FT                   /locus_tag="ASAC_0551"
FT   CDS_pept        complement(545301..549332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0551"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18958"
FT                   /db_xref="GOA:D9Q0X0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X0"
FT                   /protein_id="ADL18958.1"
FT                   /translation="MQEAVLAAGAAAAAGAATYVAYRKRLLSRLLTSLRLKVNPDSIVE
FT                   VASSAESLGISRQQVSAIVRSLRSCPKGSERLAESLISLGLYEDVIYLASRGCSVPSVT
FT                   LRRARAYSLGLALSKWEAEASRLLQEQPKLSGSSKVMVAVCEGDYREVMVDGVVTEVPP
FT                   PGSSWRSPPPEEAMSSIAELSGAKLVISWGSCGLRGAVNARRLVRLAYPDVRPSLASIA
FT                   YNLGVNPMLPPSAVVLAAVESSVDILNRVGVEWEKMPEDVRGASEIVKYRDVVNSVVGQ
FT                   RGVKEQRSIVVTDRPRAYMPLWRPFSVSPSRAPQDDYVAATVIKALASRGGDPLRAIRL
FT                   SSLDGDEGRSIAKAIMASLVQTAAGPRPGSQVEPWDLACLDDIEVLLDCARTYDDCIPS
FT                   RPPPDEEELLRKLKVRCPGAKNIRLTANSYVPQRLAESLGMAAPNKGKVKAYGEPILGG
FT                   LRGASEAVSSAVAMASGASRPLIIVPTRALARAAASAHGGTFITAETIDSWFSRGGLGF
FT                   ISWDDYLAMPEAGGVADRSIIVFPERLIRAEPEDTAYGVHDRLVDSVIELVAKNGGLAV
FT                   SRALHAEAERRDDIELVAPARHEIDVELSDTDIMEEAENAFKRLWGANLSLRPYQGLAV
FT                   RVLAQMASSGRASALMVILPTGAGKSAIFQVTAKAFEDLGLGSTAIVISPLRALMHDQV
FT                   KNARSRGLRAAYIDSSVPPSRKREIIAAAREGLLDLVYVTPEGFSSGPASELVSTSGEA
FT                   SLVVLDEAHALSRWGLSFRPSYLYVARQLKDRASAGWPPIVALTASAPSDVVRDVLSEL
FT                   GYQDYEERRISLGPETAEVSYSGKPVVLRAPSLRPEISIDVVPARDGPDRLEDIAAHAE
FT                   ELTRWADSLGGPWVGIVFVPFVQSDSRPWLNAEEVAKFLGRRLGEDIAVYHGQLSDSER
FT                   RRVEEEIVSSSRTGRGPRIVVATKAFGMGVDIPNIRWTLHAAPSGSVEDLYQEIGRAGR
FT                   DGKPARAVILYNPSDMTVQSAMAKGEAIRPLSVHRTLQLIAEAMQYVKYRDGVIPIPIK
FT                   GREGEWGLVKYLDVLRVAGLIDYEVVRGPLLAYDLPREKVEEEAGWCIPMSDGTCISRA
FT                   VRGLEGRRVYFNICDNDASIGLKAQEACKSISYDGLVALVSVTSGWRRPRRYLDPELYA
FT                   ISLWLSLREGRKVKELSDLLEAAVAARARGGQQLADSQVKRAIEELLARGVRPPLGGVR
FT                   LGKVVRCDSLDECVDRAIKDVIEVEELVGEGSVVIGASPTAAPLVSARYLKLTGRSPSV
FT                   SPSYYRRLASLARRGELEKAMNMGYVVVVAKDSEKVNEVVKLVHGYPYASFYLYARSKA
FT                   "
FT   gene            complement(549401..550312)
FT                   /locus_tag="ASAC_0552"
FT   CDS_pept        complement(549401..550312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0552"
FT                   /product="Putative transcription initiation factor IIB"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18959"
FT                   /db_xref="GOA:D9Q0X1"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X1"
FT                   /protein_id="ADL18959.1"
FT                   /translation="MCPRCGSKLVDDNGVLVCPNCGYIYDGNELSDGPEWRSLSNGNVK
FT                   GVERASYSNDPLMHDLGIGNLRMSPARSRSPLMRVRNLRMRIGSSHPLLKGEAPLVNMF
FT                   SIAKKAASAFELSDSAKDALGQVLHAYAERAKKPIGRDVNKVVAAALEKVVEVYNLSIS
FT                   KGEIESFFEIDDNDLWDGLKKLNDVGALDMLKVVVASEGQGRVLERSFTYINRIASSLS
FT                   LPQQVVQDSLNFIRKSLGVAGKTPYGKKPEALAAAAVYLVARLNGYEISQSDVAKVVGI
FT                   KESTVRKLYRFLMDNMVVVVDV"
FT   gene            complement(550334..550618)
FT                   /locus_tag="ASAC_0553"
FT   CDS_pept        complement(550334..550618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18960"
FT                   /db_xref="GOA:D9Q0X2"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X2"
FT                   /protein_id="ADL18960.1"
FT                   /translation="MEGGAREVLRIGKVSGIVNGLAVVRADIDVRKFRQGSPVINPDRR
FT                   LVGSAADIIGNVNSPYLLVKLSPGASVKEGDELFLIFSPPRRRSHHRRR"
FT   gene            complement(550790..551461)
FT                   /locus_tag="ASAC_0554"
FT   CDS_pept        complement(550790..551461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0554"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18961"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X3"
FT                   /protein_id="ADL18961.1"
FT                   /translation="MVLQVTSRVYRVPVEETNGNIYFYVQEDGLIIIDTGIPGKDGLVL
FT                   DSIRSLGFSPSQVKAIVLTHYHLDHSGSANAIRSATGAKIYVHRDDAPILEGLVPPQLP
FT                   KEAPREAVEAYRWFKPVKPDVVLNDGDEVHGLRVIHVPGHTPGSIALYDGEHLFAGDNL
FT                   NFRDGRVQGPPPLFTADMQRARESVRRLLSLDFRVLLPGHGEPVVGDASARARQDLREL
FT                   L"
FT   gene            551607..552776
FT                   /locus_tag="ASAC_0555"
FT   CDS_pept        551607..552776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18962"
FT                   /db_xref="GOA:D9Q0X4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X4"
FT                   /protein_id="ADL18962.1"
FT                   /translation="MWYWLGVTYIAALSIVDFMMFNYIGFRTDVSDIDYGIIGAAWSAV
FT                   FIASSEFLGRLADRGDYRKLTAVSLVAIAVASLLFGLARGVELMAIAYMFHAVATAAAN
FT                   LGFSAGMFELSPDTEWEAKASGQRLGLFGIKGAGLLALSFVVPFIPLMGLAVGVGVASL
FT                   AVGLAFMLFLPSGWPPFERKLHGLMLRLEGFGLYATAVGSFAYGKYGLLYNISRSVERG
FT                   AGSSTGVAVSAMLTTFVGDYYLTALPLMLRYVNLGLRDYMVAFAAAGLSAAAALALVQG
FT                   TGSRSLAAAGIAIRGAWAIVAIRFIDSLAGIVAYIVVLVALFSVLDLSLYRIYIGITGG
FT                   YRVHGYMMLRELGSLVGSLAGGLALYLGPLAFMATPAVITAAAVAAALI"
FT   gene            552822..553502
FT                   /locus_tag="ASAC_0556"
FT   CDS_pept        552822..553502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0556"
FT                   /product="dolichol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18963"
FT                   /db_xref="GOA:D9Q0X5"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X5"
FT                   /protein_id="ADL18963.1"
FT                   /translation="MLSITLQLAITLALAAWVGAVVLYISKAVYRLSTSHGLGDRISRY
FT                   MARKTIHILGGGLVAALVPFVYTQPWMAFASAMALTGYIFYRRRKGLMAWFQEPDNAYE
FT                   AHFTIMWGLVILASWFFDPSMVIGAVSALFMSVGDGVTGVVRGLRRVRGKAWSGTIAMI
FT                   VVSSLIGGYFLGLEGVAAGVAASFVERINGVDDNITVPLVSFLLLLAMRYLLPAGLAHF
FT                   PPRL"
FT   gene            complement(553481..555160)
FT                   /locus_tag="ASAC_0557"
FT   CDS_pept        complement(553481..555160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0557"
FT                   /product="Sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18964"
FT                   /db_xref="GOA:D9Q0X6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X6"
FT                   /protein_id="ADL18964.1"
FT                   /translation="MEYKWTVLTNTTLGILMAMINSSVLIISLPAIFRGIQLNPLAPSS
FT                   FDYLLWLLMGYGVVSSSLVVSFGRLSDMYGRVKLYRLGFVIFTVGSVLLSITPGRGTVA
FT                   AAELVAFRMVQAVGAALLMANSAALITDAFPITERGRALGINQVAGMVGNLVGLILGGV
FT                   LATVNWRLVFIISVPFGVAGTVWSYLKLRELSRPRREEKVDVIGNLTFISGLVLLLAGI
FT                   TYALEPYHGEAMGWDSPRVIALMSAGAAVLAVFPLVEMRVQYPMFRLELFRSRQFSAGI
FT                   FAALLAGLALGGLMITLTIMLQGIWLPLHGYSYSSTPFWAGIYMMPMLFGFVALGPLSG
FT                   ALSDKYGARELATGGMLIAFAAMMAMMTLNYNFSYLPFALMIFAVGVGNGMFVAPNTAS
FT                   IMNAVPPEHRGVASGMRSVMTSMANTVSIALYFSLLLSAFEAKLPSAIYSSLVSAGFPQ
FT                   ALALEVSRMPPTAALFAAFLGYNPMQVVLQDLPQGVASSIEAGDPSGFKEVMSNTWFPH
FT                   VIAPPFMYALRFTLMISGVIVVVAAVASALRGRTAPQSLGGK"
FT   gene            555325..556068
FT                   /locus_tag="ASAC_0558"
FT   CDS_pept        555325..556068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0558"
FT                   /product="hypothetical protein"
FT                   /note="DUF72 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18965"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X7"
FT                   /protein_id="ADL18965.1"
FT                   /translation="MLLVGCCGWCLGRQRYYASFNVVELQDTFYEMPDEGRLRSLRGEA
FT                   PEGFRFTMKAWQAVTHPPGGPTWRRARHRVPEELADRYGNLRTTKENLEAWDVIARAAR
FT                   ALGASVVVVQTPPGFGASEDNVRQAAEFFRAVATRDFTIGWEPRGTWRSRPDLIAKVIG
FT                   DLDGVIHVVDPFRASPAVERPVVYFRLHGIGGGEVNYRYRYTDNDLEALCNKVRGLREA
FT                   REVYVMFNNVFMKDDASRFKSLCAV"
FT   gene            complement(556065..556643)
FT                   /locus_tag="ASAC_0559"
FT   CDS_pept        complement(556065..556643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0559"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18966"
FT                   /db_xref="GOA:D9Q0X8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X8"
FT                   /protein_id="ADL18966.1"
FT                   /translation="MLGKLRKFVNSVAPTTVGKALYKAGVTPDELTYTGLALSALAPLA
FT                   VYLGKLIMLPFLILLAGLMDVLDGAVARASGRTTAFGSYLDSVTDRVSDAFLFLAMALA
FT                   GVNQYITMIALAFSLMVSYARAKGELLNVRMEGIGLVERSERLIILFVMSLLLLLRQLL
FT                   VDNIIMAVVAVLAAATVIQRSVHVKRSIG"
FT   gene            complement(556650..557393)
FT                   /locus_tag="ASAC_0560"
FT   CDS_pept        complement(556650..557393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0560"
FT                   /product="Polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18967"
FT                   /db_xref="GOA:D9Q0X9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0X9"
FT                   /protein_id="ADL18967.1"
FT                   /translation="MALFLSSDVEQDAPPYMNTERGIVEGLPRLLELLDELKVRATFFV
FT                   VGRVAERHPRAVYNIIERGHELGSHGYAHVRLDRVPLREAEDDVRRSLRVLRDFSEVKS
FT                   FRAPNLKLPRQLLPVLREEGVSVDASLASYKPPFPRGLTVEGGVVRVPATVTSSVLRVP
FT                   WALQRPLLALMPRVTTLFVHPWEVSGVVHWRPDIWVGTGPRLLGLLRNAVSYMVRRGYR
FT                   PMTMSEAPSLLGNINFRALAQPGGR"
FT   gene            complement(557335..558630)
FT                   /locus_tag="ASAC_0561"
FT   CDS_pept        complement(557335..558630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0561"
FT                   /product="N-acetylglucosaminyl-phosphatidylinositol
FT                   biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18968"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y0"
FT                   /protein_id="ADL18968.1"
FT                   /translation="METLRIAMVSDWFPPRVGGVETSISELSKALGRLGHEVMVVTHEN
FT                   SSYRGPPGLVKGDGYLVYWIGTRLLAKDDVTYDPLVIAKASLFVKRNAVDVVHAHGVTS
FT                   VLGLMTSMIASGGTGVPSVLTNHSLLSGSLKGLGRLSLKYALKWPTLLVGVSRAAAEDV
FT                   SRISGRPADVIHNCIDVDSWREMATWSHLDGDPAIVITSRLSPRKNPLEIAKVASLVAR
FT                   KLPRARFYVVGDGMLMRDLVESLRGFGVEDRVKVLGLMPRERVAQLLSGADAFVLTSYR
FT                   ESFGIAVLEAMALGVPPLVYSSPGVLDLVEDGRSGIIADGPEAMADAIVRVASDEGLRR
FT                   DLARGAEDRARLFDCSIIARRYVEEYRRAEEVKCSDDRRFLAYRLYRALTGDPVKEGEW
FT                   CRGRKWEYHERSADGIVPVVRRGAGRPAVHEH"
FT   gene            complement(558618..559460)
FT                   /locus_tag="ASAC_0562"
FT   CDS_pept        complement(558618..559460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18969"
FT                   /db_xref="GOA:D9Q0Y1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y1"
FT                   /protein_id="ADL18969.1"
FT                   /translation="MLDLSLTALLSDLKEVGYAVLVGSLINVVLTLLWALRWRAGLKYL
FT                   GVRVSYLQSLGAIVASFPLGNLLPAGKAAQEAFRIAYLDVKEGKRTSVMAAAAVEWVAE
FT                   GLIISFLLLAVIIRHYALGAAALTLVAVAAGQPQGMTVKSAVRDLVKAFRLLSRDRRLM
FT                   ATYLAVSSAIIAIDVIKVWLVALMSGLYLALFDLILLYVILRVTSAAPTPAALGFLDLG
FT                   VIGALKFMGYPVGLAVLFLVSIRLVDTVMPSIAGIIVLVVTGSYRVLRQARGAGSWRR"
FT   gene            complement(559544..560305)
FT                   /locus_tag="ASAC_0563"
FT   CDS_pept        complement(559544..560305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0563"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18970"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y2"
FT                   /protein_id="ADL18970.1"
FT                   /translation="MVALEERYVVVTGGDRGIGRATVLRFARAGFNVVFTYRSRQDAAE
FT                   RTASDARAQGARSVLYYSVDVSSWESVSKFAQELSGRVPYVNVLVNNAGIIDYNDFEGL
FT                   TPERWKEVLDVDLTGPFLVTKALLDLLRRASWASVVNLASIAGQTGNVLASVAYCTAKG
FT                   GVIELTKRLAVELAKYGIRVNAVAPSFVETDMVADILNDPRRRREVEQMHPLGRIIKPE
FT                   EVAEVIYFLADPALSLNITGQVIGINGGRYT"
FT   gene            complement(560345..561166)
FT                   /locus_tag="ASAC_0564"
FT   CDS_pept        complement(560345..561166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0564"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18971"
FT                   /db_xref="GOA:D9Q0Y3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y3"
FT                   /protein_id="ADL18971.1"
FT                   /translation="MLQYILSVISGVVVGFSLGLIGGGGSILAVPLLLYFVGLSSIPNA
FT                   AHIALGTTDLAVGMNAYINSYMHLKKRNVSPKVGGIFAGVGVVGALLGTYLGHITPGGR
FT                   LLLYFAIAMIVLGVYIGFFRNAAKAGTHEEVSRVVEAYSRCPKLTAKVASLVAIFGFVV
FT                   GLISGYFGIGGGFLIVPALMFSSGLCITRAIGTSLLSVGTFGMAGGLEYAVYGDTLFII
FT                   SLLYVLGGVGGGFLGTSLAVKAPKKTLQRAYGIIIVLVGIYMIFKVLHLSL"
FT   gene            complement(561286..562437)
FT                   /locus_tag="ASAC_0565"
FT   CDS_pept        complement(561286..562437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0565"
FT                   /product="myo-Inositol-3-phosphate synthase"
FT                   /EC_number="5.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18972"
FT                   /db_xref="GOA:D9Q0Y4"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y4"
FT                   /protein_id="ADL18972.1"
FT                   /translation="MIRTVLIGAGSGASYFLAGLEKLKAREIQPVGIPLVNYMKAHRPE
FT                   DIDVVAVYDVDNSKVGRDMYSIASKLSPFSSVPRTLKDIVVSRGLHCGSLRGLDVDASG
FT                   LEDALGSPQQALEEFISELVKLKPDVIVNVITTEPMRFVESEGEFVKLASTCSAGATLA
FT                   YAYAASEYSLRTGNPVAFINLTPPAAANSPGVVSRFERAGALVLGDDAATGATPLTADL
FT                   LEHMAERGRRVLSVAQFNIGGNTDFLSLTEPERNHSKEVTKSSMVADILGYDAPHYIRP
FT                   TGYLEPLGDRKFVAMHIEYESFGGFRDEVIVNARINDKSNLAGLMASIVPVAKSLLERG
FT                   VHGSYATVNRFYMKMPGPRGTKNISKIVAYQDLLKELKKLDII"
FT   gene            complement(562500..562778)
FT                   /locus_tag="ASAC_0566"
FT   CDS_pept        complement(562500..562778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0566"
FT                   /product="Putative small nucleolar RNP protein Sm"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18973"
FT                   /db_xref="GOA:D9Q0Y5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y5"
FT                   /protein_id="ADL18973.1"
FT                   /translation="MAASQEKRVVNPLRYLRDAVDSQIYVKLKDGTEYVGQLLVTDSTM
FT                   NLVLDNSVEVKDGKQIVARLGKILIRGSMVQYVSFNPELAAPDVVSK"
FT   gene            562917..563759
FT                   /locus_tag="ASAC_0567"
FT   CDS_pept        562917..563759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0567"
FT                   /product="Fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18974"
FT                   /db_xref="GOA:D9Q0Y6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y6"
FT                   /protein_id="ADL18974.1"
FT                   /translation="MRLASVLVGGAPRLALVEGGQVYLALLNGSQVDPAEFFRDPVKLV
FT                   GKLERGEPVQGLDRPLEPPVPQPSKIIGIGKNYAAHAREMGSVERPVFFMKAPSALTGH
FT                   LHSIEVPEFIQKPDYEGEVVIVIGRAVKHAGRREAQEAILGYMAGNDVTARELQYDERL
FT                   PWCLSKSLDTFSPTGPYVKVLEDYSELQGSCVETYINGERVQHGCADEMTYDFADIVVE
FT                   LSKYMKLYPGDLIFTGTPPGVGHPRGRYLKDGDRVEIVVRGLDPLVNVVARPPGPRSS"
FT   gene            563823..564776
FT                   /locus_tag="ASAC_0568"
FT   CDS_pept        563823..564776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0568"
FT                   /product="Aldo-keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18975"
FT                   /db_xref="GOA:D9Q0Y7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y7"
FT                   /protein_id="ADL18975.1"
FT                   /translation="MEYTEFGSTKEKVPRIGLGAWQFSDAWGVTDYQKAKAAIAKALEL
FT                   GMNLIDTAMVYGNGMSEKFIGDAIRELGVPRSEVFIVTKIPGHFLSYDDVFRAVDGSLR
FT                   RLQTSFIDALEAHWPPAWHNIPTCEYARAFERLVEMGKVRYIGLSNYPVALIEEFRYCL
FT                   SRHDVEVLELRYNIVERQAEQQHIPYAEANSMTVLAWSPLAQAAILGKYTLEDVTKFND
FT                   VRRNNPLFRPENYSQILQLVEELKEVAKKYDKTLSQVALNFLLRASSAVLPIPGAKSPE
FT                   QVEENAGATGWALSYEDWRRLDEASKRLRISYVDIL"
FT   gene            564828..565952
FT                   /locus_tag="ASAC_0569"
FT   CDS_pept        564828..565952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0569"
FT                   /product="glycine cleavage system aminomethyltransferase T"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18976"
FT                   /db_xref="GOA:D9Q0Y8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y8"
FT                   /protein_id="ADL18976.1"
FT                   /translation="MSLALRTVQLSSLHEGLGASFGEFAGWSVPMVYTSTMEEHMAVRT
FT                   DVGIFDISHMGRLRLTGPDAAELLEIVFTKKVSATKEGFMSGPTLALTELARVIDDEMW
FT                   YRVSDNEWLAVPNAAVTERMKSHLQQAASSRGLKVSLEDLTSTYAMLAIQGPRSPEVME
FT                   RMGLKEAGSLKPLQFLLNVGLGDARAFLVSRSGWTGEDGFEVWAAPGDAERIYRKALEL
FT                   GAKPVGIAARDTLRIEMGFVLGGNEYGEDPLKFPCALSLRYGLGAIDWGKRGFIGEEAL
FT                   RACRREGLRWVRVGFEMKKSSARFIPRNGYKVMVDDVEVGWVTSGTFSPVLQRGVGQGY
FT                   LDVRYAVFGETVTIVDERGRSGEAKIVDFPLIRR"
FT   gene            565957..567450
FT                   /locus_tag="ASAC_0570"
FT   CDS_pept        565957..567450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0570"
FT                   /product="Predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18977"
FT                   /db_xref="GOA:D9Q0Y9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Y9"
FT                   /protein_id="ADL18977.1"
FT                   /translation="MRATAFYGRIYVSFRPPRAVDSLLAVNGRVVLEGDRGRVERACRE
FT                   LECEEVDIDRGVGLPGFIDAHMHLSGLAIQDSGVDLRGVDSLDELRRRVKEFLERHPNV
FT                   TAVLGRGWDESRLRERRPPTSADIDDVAGDRPVMLIRVCGHAAVLSSSAMRRVDLRGLE
FT                   DYIDIGPDGRPSGLVREGAVIRALRQLEPPPEEYMTYVAEEARRLALQGVTTVGFMNVP
FT                   LKLMAGLTSQPLPLRLRLYLDADSVGLLESLGVAGGFGNDLVRVMGLKAFADGSLGART
FT                   AYLSEPYSDDPGNRGRPLLGPEELRSLLARASRLRLQVAVHAIGDAALDVVLRGSEGLR
FT                   GWLRVEHASLVRDDQLPALSGLRVAVQPMFEVDDLPWIHKRLGQRVRWAYRFKSMISAG
FT                   AVVGLSTDAPVEPADPWTTLSAAVNGVEGVGERLSVAEALDAYTRGSAEVLMDRDVGSL
FT                   EVGKMADLIIASGDPLEVEPGELGKLRTLATYLGGSGVQ"
FT   gene            complement(567436..568683)
FT                   /locus_tag="ASAC_0571"
FT   CDS_pept        complement(567436..568683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0571"
FT                   /product="Imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18978"
FT                   /db_xref="GOA:D9Q0Z0"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z0"
FT                   /protein_id="ADL18978.1"
FT                   /translation="MAPLPEADLIIYNANVVLFEFRPVTRASQVKVLAGGEVAVKGNYI
FT                   AKVGQRGEVRGTYRAGLELNAGGRLLSPGLVDMHTHAVFAGSRDDELEAKLSGVSYSEI
FT                   LRRGGGIYRTVRATRSASDEELRDLLVKRLRLMLHLGTTTAEVKSGYSLDHEGELRLLR
FT                   VAREASSTAKVDVVPTLLAHVPPEEAREGRAREEYVKGFANDLVRRAAGLANFVDVFCD
FT                   EGAFTPDESRLILTSARAVGLGARAHADQLARIGCAEAVAQAGPASVDHLEVSDERSVK
FT                   AIAASRSTAGLLPASLMATMGSSRPPVPLLRAYGVPMALGSDLSANSVMPSMQTAIDLA
FT                   IYLYGLTQAEALAAATVNAALSLGLSDRGSVEAGKLADLVVWDLERVSELGYDWGRDRA
FT                   LVVIRRGSAVKDLLNP"
FT   gene            complement(568685..570097)
FT                   /locus_tag="ASAC_0572"
FT   CDS_pept        complement(568685..570097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0572"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18979"
FT                   /db_xref="GOA:D9Q0Z1"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z1"
FT                   /protein_id="ADL18979.1"
FT                   /translation="MKVCAGQRLTVEDICNVAVNSPVSMCQESLQLLSRSRKAYEAGAS
FT                   LGKVYGYSTGLGALASAEEGTWRGREAQVLREHDLGIGPEAPREVVRAAMLVRASQLAQ
FT                   GFAPVRPEVAQRLVDSLNYDIVPAVSLEGSVGASGDLAPLARISRCIYSGEGQATVRGR
FT                   RLSCGEALEAAGLKPLELGPGEALAIINSNAFSVAMASLGVCASLRLLGESLNVMSETL
FT                   EVTGCNPQHFSTAVANSKRLEGVKDVVASLKVDCQRSPRLQDPYCIRCVPQVYGSALEV
FT                   LRFAAKLLEAEAYSSSDNPFVYNDSVYHACNFHASAAGMASDMAKVALAHVGNMIERRT
FT                   AHLLSSATTGLPDFLAVKGTVVGAMIYQYTAASLAAKLRQLASPGSVHSIPTSGLQEDV
FT                   VSMAPNSSYELLRSTAVLARLIAVEDALASQASKVARGLPLDDPKDALERSLAKVVGEA
FT                   GLSGLSFIVNLA"
FT   gene            complement(570158..571132)
FT                   /locus_tag="ASAC_0573"
FT   CDS_pept        complement(570158..571132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0573"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18980"
FT                   /db_xref="GOA:D9Q0Z2"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z2"
FT                   /protein_id="ADL18980.1"
FT                   /translation="MKKWMLFDGTTLKRLLQLHYKVGESLSLVKRARFLKDPYDRRVGE
FT                   VEPLIPLAGVPWDWSTAGRPGARFAPSAIRTELYSLTPLSEDLGELRWGFDDMGDIDIV
FT                   GGDIIETGRRVVEASRHVMEVAMSRGVPAIFIGGDHSITNWTSRPFVEQGASLVVLDAH
FT                   YDIRKLTEGVTSGSWLRELVEATKVKALVVGVSEYVNPPYAPSRAKELGVDIISRVELL
FT                   KDFKSSLERLRSLVAGSKVYLSIDMDHLAQAFAPGVNSPTPLGMTPFESMSVIDTIASS
FT                   AKVVGIDVVEVVPGADVTGSTPRLAAALLLRAVQRSLVSMNMK"
FT   gene            571508..572839
FT                   /locus_tag="ASAC_0574"
FT   CDS_pept        571508..572839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0574"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18981"
FT                   /db_xref="GOA:D9Q0Z3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z3"
FT                   /protein_id="ADL18981.1"
FT                   /translation="MAANGPAATAALYFTTLAGLVGGSLPLVLLLAWLIYVGMTYIVYE
FT                   WSKNITSTYLWAVMQKKGFGSSYLSFVIGGWGYWYYYITGAAGFAILGIAAFISLIFPS
FT                   FYQTHPWIWIPIAIAVAAEVWAVVYTGAKVSTTYNLIAGLIEVAFLLLTGLILVLMFIH
FT                   KNTFLPFTPIPLGKDWPIILTTMIFAITTFGGMNQAVPLGEEAIDPKRTVPKALAWLAF
FT                   LIGVPIIFNAYAQEIVYGVDNMFKYSQLPDPGIIIYGSVLGSIAAIIFAVLVIYAFDAS
FT                   AVGFLNSAVRAGYGIARDGILFPSWFTKPNKFKVPGKNVTASAIIVTGTAIASGLVWGP
FT                   VMGSVFLLTSNGYFNFINHLLASIGLVNFKRKRGERVGAGLIAVVIALVLALGAAIVLS
FT                   AMAPPPLDYAGLTSLVWFIIGNIVYLVEKRRKPDNMKKFGEFTL"
FT   gene            573104..574960
FT                   /locus_tag="ASAC_0575"
FT   CDS_pept        573104..574960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0575"
FT                   /product="Urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18982"
FT                   /db_xref="GOA:D9Q0Z4"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z4"
FT                   /protein_id="ADL18982.1"
FT                   /translation="MSVPSKYKGQPIEELISEGYYDPETRTVHAITGPELHVRSRDWQV
FT                   EGILRMLFHVLDPMVAKDPKNLIVYGGTGKAARSWDDFEAIVNTLLTMDSDDTMVIQSG
FT                   QPVAVFKTDLRAPRVVMSNAMLVPKWADWSYFWELEKRGLISFHQMTAGCWAYIGTQGV
FT                   LQGTYETVGAAAERAYGSLEGRLYVSAGLGNMGGAQPLAAKMLGGVALIADVDKRMIDR
FT                   MIQTGYLDTWTDDIDKAIDMALEAKRSRTPTSIGVLANAVDLLERLVKENVVPDVLSDQ
FT                   TPAHDPLSYVPEGMSVEEAARLRSQDPERYIQLAKQTMKRHVQLMLELQARGAVTFEYG
FT                   NNLRKQAYDAGLTEAFKIPGQMEFMRPLFEEGRGPFRWTSLMGDPNDIYKLDDVLLQLF
FT                   GRNQRLARWITAAHKYVKFQGLPARVVYLGYGERALFGKVVSQMVRRGELSGPIWFGRD
FT                   HLDAGSVASPYRETEGMLDGSDAIGDWPILNYALNTAVGATWTCFHHGGGTGIGYAIHA
FT                   GFGMVVDGTELAEQKAIRVFTVDPGMGVVRHAHAGYPRSLAVAREKGVRIPIMKMLEEK
FT                   SRRVIEEAKKEGRISDYTYQRVKKDLEEYESKKGNYSPPFNT"
FT   gene            575194..578649
FT                   /locus_tag="ASAC_0576"
FT   CDS_pept        575194..578649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0576"
FT                   /product="predicted exporter of RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18983"
FT                   /db_xref="GOA:D9Q0Z5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z5"
FT                   /protein_id="ADL18983.1"
FT                   /translation="MYSRRTAYVIVVVAIALAVIFYPFMTRINSVVSTNESSMLPQGVE
FT                   SIKVMNIISREGNLSEQGNYIYVVTGVPVNLTTFYRLNGTLTQGTSWVSVARGVYIKLN
FT                   NVSQRLLNVSLSTAEGLVRLWEAVNNLSLRLERLNSTLVGLTYMLRNADYAYAQYYSLG
FT                   RNLSLAYSQAVPEVVALGNETEGLSGAYVSTLFNTIRAEYVLSNMTDAYSTGNLTQGDV
FT                   ELVVSECPPIGGAQSPSPQLVEALFHYVLSTGGPSRFSLASAENFTYTVLYGELNASGE
FT                   QRALPLLQAYGLAFRNASAAYSSYIESLMNNLTQDNQYRLYYALSSIGSASGREAFLAV
FT                   VSSIPAPGQTKELLTTLAEEYAASGFNESDVTLIVRNVTYSLLSSRLPSDVAMDMASYV
FT                   ANGSFSREAAAELAAKTLAARLPVNLSGYAPLVLSYVPEELLEYDPNATCALCSNMTLA
FT                   EASASAIAERGLNVTPSLSMALLRGESAYSLSLDLVNRSLTSPTARLLLAELASAGPIE
FT                   DYQSLLSRMPSLLNSSLARLGVPSNLTPVLSSEAAVVLEDPSLYGRAVTNVTEYAFNRT
FT                   FANLLGDLRGLLVQRNLDGFLVMYSVNMSYDEALSVRGQLVSELRSAGYGNASVMLTGT
FT                   QAINHDLSSSSFRSISRGDMISALLVLVILAIVLESLVAVLVPFIGIGVGLVVALGVGY
FT                   LLASHNVITLNSISRTIMYEAGLGLGVDYSSLISRRFREELGKGLSPAEAAWSAARRSW
FT                   RAVVTGALTASIGFGAMTIASNFPFLRSLGEAAPISILITMAVSLTVVPAVLAIVGGSR
FT                   IVWWPSRVKASAARASPGRSPRARYIAFVVVIALILIPAGFIYATFRGSYDFTLMMPQG
FT                   AQSVQALHYITDNYAAGIMYPVYVVAANYSTLQAINSSISRLSCVQSTQLYNYSEPVLS
FT                   VTLSVYPLGREAIACAQSIRQLAKQVSPSAMVGGEAAINLDLQNIVYHDFYHLVYPIAI
FT                   VLMFIVLLAFFGSVPMALTALASVVIAAVFGSSLAIEAYRLSGVNLPWYLPIVVFTAIL
FT                   GVGMDYNSFIINRVREEAGSHDVRTAVEIAVRSTSVLVVGLSTIMAGAFAGLLAFSAPG
FT                   FRGMGVALMAGVLSAGLLAALLFTPAVLYMLGERALWPSRRAGR"
FT   gene            578733..578897
FT                   /locus_tag="ASAC_0577"
FT   CDS_pept        578733..578897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18984"
FT                   /db_xref="GOA:D9Q0Z6"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z6"
FT                   /protein_id="ADL18984.1"
FT                   /translation="MVVDPVCGMEVDESTPYKTMYKGKVYYFCSEGCLKAFRRDPEKYL
FT                   REGPKGMPG"
FT   gene            578894..581170
FT                   /locus_tag="ASAC_0578"
FT   CDS_pept        578894..581170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0578"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18985"
FT                   /db_xref="GOA:D9Q0Z7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z7"
FT                   /protein_id="ADL18985.1"
FT                   /translation="MSENERRPLRIGKEEQLRVVGMHCATCSTTVAKALRGVKGVEEAE
FT                   VNLASGTAKVVVSGARLRDLVEAVRRAGYDVVTERLRLRISMNPEDSRRVTELLEGLDG
FT                   VVKASVNPGTGEAVIEVNPYSTSAEAIVEALRGHGFRAQVISKAAPASAGELRGYLRAL
FT                   AVAWSFGLLTLYLQYTSRPLLAMVASAPVVFYAGLRYHLGAYRAFRNRTTNMDTLVSTA
FT                   TLVAWLYSAYSLAVHGPVFFDAASLLISFLLIGKTIEAYIKERLSGEVVRLLPSRARVI
FT                   RDGSEVEVSADEVKVGDLLVVRSGESIAADGVVDEGKGEVDESIVTGEPMPVTKSKGDP
FT                   VVGGSRLVSGFLKVYVTRSGERTYMAQLMTAVRDAEAARLRAQDLVDRVAAVFTPTIIA
FT                   IAVVTFLAWHFALGFPTPKAVLFAVAVLASACPCALGLATPMAVLVSVHRLAKRGVIVK
FT                   DGEALERVKDVDVFVFDKTGTLTEGRPRVKDYVELQPGVMELAASLESLSSHPVAKAIV
FT                   DRFGARLRGSVKDFNEFPGDGVAGTVGDRQVIVGRPEFVAQNCEGQAKGDVAVCVDGRV
FT                   AGWLSLEDPVRPEALELVAKLKSMGRRVIIATGDSGPSAEAVAAALGVEVRKGLSPDDK
FT                   AELVRSLRQEGHRVAFVGDGVNDAVAEKEADVGIALAGGTDIAKYAGDVVVMNLKGIEL
FT                   LLRESRIATRKVKENLAWAFGYNSVLVPVAAGLLYPAVYLSPQYAALAMSMSSVIVSLW
FT                   STVPL"
FT   gene            581224..582402
FT                   /locus_tag="ASAC_0579"
FT   CDS_pept        581224..582402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0579"
FT                   /product="Putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18986"
FT                   /db_xref="GOA:D9Q0Z8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z8"
FT                   /protein_id="ADL18986.1"
FT                   /translation="MYEAEFPSLRSRHYLDWAAVGVPPLRAIGAIRSLLDVYESSPEEA
FT                   SSMGSQAELKAAARGQLAPLVGCSPDNLVFTGTSTTSAVQEAVDSIPMSKGDNVVIFDM
FT                   DFPLVHAEAYRLRLRGVEVRVVRNRDGDYDVDQLYEVVDRRTRAVIVSSVMWVNGLRVD
FT                   VEEVAKVAHEAEAYLVVDAIQQAGAIRPRGLERADFVAFGTQKWLLAPFGLGGMCVSRR
FT                   SVEELQPARPGYSNAPVQDWDAYWLDPNKAPFYVEPYRRDSALKFEYGGSLSSLSLRGA
FT                   EAAASLINEVGIDNVEAQVMRLRKALLEELEDLRADLLTMPEQSKASGIVLFRVGDSVR
FT                   EDYELARRLRARGIAVSARGAAGLWGIRVSVHFPNKEDDITALSEAIRELRG"
FT   gene            complement(582392..583825)
FT                   /locus_tag="ASAC_0580"
FT   CDS_pept        complement(582392..583825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18987"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q0Z9"
FT                   /protein_id="ADL18987.1"
FT                   /translation="MKVALALGLVALVALALGAPLLLQVRVGEAQGAGQGQAQALLNLT
FT                   QRAITVGKSLGINVTQAEELYSRALSYYNNGNYTGAQDLCLEALKYIASEAKGVRPTYM
FT                   PPAYGIEAQLLAIERFVNGSPAINSTDRSYVISRVDEALKDISSGNVSGAAEILADLKG
FT                   YLANLSVRVSMYAKHAMIGRLVRELHKARGELEANWSYMQEANVSPAQVADEVVKELEE
FT                   ELNSSAANATPAQLVGLARAVEEIESRAPMAEPFPNATGRVMLYGAQVKALVGINRSLS
FT                   RVESLMAYLTGSEANLSEEALNLTFKAINATLTALHYYAAGEDNLSLEYINQSITFANE
FT                   SAGIAENLTSSGHGMAAAVGRGIYRADELIIGLDEKLYAYVESQNIVGKVYEFRGELLF
FT                   AVNQTTYVAVLRIVNGTQETHHVIFALVVIGEGAHVNANLTQLPLRVDVVGQVAGAVHY
FT                   LYVVKAFNVTELAPEAVSP"
FT   gene            complement(583963..584409)
FT                   /locus_tag="ASAC_0581"
FT   CDS_pept        complement(583963..584409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0581"
FT                   /product="Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18988"
FT                   /db_xref="GOA:D9Q100"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q100"
FT                   /protein_id="ADL18988.1"
FT                   /translation="MSYMVQVGDQVPDLELETTAGKVKLSDFRGKKLVLYFFPKAFTMG
FT                   CTRELKRFTELYDQFKALGAEVIGVSVDSVDTLKRFAEKYGAKFPLASDKAKEVSKTFG
FT                   VLKLMTASRVTFVIGPDGVVRQVISNLKRAEEHADRALEAVKSI"
FT   gene            584535..585689
FT                   /locus_tag="ASAC_0582"
FT   CDS_pept        584535..585689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0582"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18989"
FT                   /db_xref="GOA:D9Q101"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q101"
FT                   /protein_id="ADL18989.1"
FT                   /translation="MSSSESVELLRSSVREFAEKVIKPVARDIDRDNTVPPEVIKQVAD
FT                   MGYFALRVPQEYGGPGLSTLESVVVVEELAKASGAVAIMATVSGTMVAYPLVHYASDEI
FT                   KRRYLEKLARGSIGAFALSEPCCGTDAAAITTRAEKDGDEYVINGRKTWITNSPYADFF
FT                   LVAARTGTPEQRHRGVSLFVVDKGSCVEVSKLDMMGYRGSGTSEVLFKDCRVPEANMVG
FT                   QLNGGFKIVMDTLNEGRVVTAATALGLAEAAFEDSLAYAKQRESMGVPIAEHQMVQYML
FT                   AEMKVRVEAIKQLIYEAARRVDAGDPEYPMWSSMAKLAAAEWGVDVARMAVQVEGGFGY
FT                   SKESLVERIYRDVKMVEIGDGTNEAQRLVIARSLLGRIRPVRQG"
FT   gene            complement(585691..586656)
FT                   /locus_tag="ASAC_0583"
FT   CDS_pept        complement(585691..586656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18990"
FT                   /db_xref="GOA:D9Q102"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q102"
FT                   /protein_id="ADL18990.1"
FT                   /translation="MNITPRKLQKLGASSLVVTLPHTWIEAHGLKAGDVVYIVDEGDRL
FT                   KIVPASTGSDRNAYEFEAYKLVMPQLVSWALTCLYVNNVNEATIDLRGMGPEAMQVLKE
FT                   ASMRLLGLELLEVERDRAVMKIVLDDSKADPKHAIKGLGSAVSNIAELLRQVAEGGQVT
FT                   EDQFSIATNELTKYQHLIMRYVVGSMNSGSVEGNLQGTIVGTALLGVVGNTLLDAAKMA
FT                   SRLEVRSRVVSQLASQVRDLAPLVSAMVAQPSVKRLHEVAFNVVATISSIESYIKSSQS
FT                   AAEAAIIAKVDDAIKTMAIVFMTILCGAVMGEEYLKPSTQ"
FT   gene            complement(586797..587504)
FT                   /locus_tag="ASAC_0584"
FT   CDS_pept        complement(586797..587504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0584"
FT                   /product="Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18991"
FT                   /db_xref="GOA:D9Q103"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q103"
FT                   /protein_id="ADL18991.1"
FT                   /translation="MSASEVISQERMPLIGEKFPEVEVATTHGRLKLPDYFTSKGKWFV
FT                   LFSHPADFTPVCTTEFYSFSLYYPEFEKLNTGLIGLSVDGNPSHISWVQWIERNLKIKV
FT                   PFPIIADPLGLVARRLGMFHAQSATNTVRAVFFVDSKATIRAIIYYPLELGRNVKEILR
FT                   VVKTLQLIDKTGAVAPANWPNNEIIKDNLLNPTPASVEEASLRLTQFKGYDWWFTFREA
FT                   PREDVEEAKKYAP"
FT   gene            587671..588690
FT                   /locus_tag="ASAC_0585"
FT   CDS_pept        587671..588690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18992"
FT                   /db_xref="GOA:D9Q104"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q104"
FT                   /protein_id="ADL18992.1"
FT                   /translation="MLLGDATKGLMTGRLTRGCELCYAGLKAVIFITGVCDENCFYCPV
FT                   DRDRFGRRVMYVNDERAYDINDIIREVERQGATGASITGGDPLADLPLTLSLIRALKAT
FT                   FGPEFHIHLYTPGRHSTPEALLALWRAGLDEIRFHPVSKNYMKGIEYAVRLTGMRVGAE
FT                   MPIAPGLEGWVKEVIKFVDSVGGHFVNLDEMEFAEPNREPLRLRGLRPDDSREAAVKGS
FT                   LRAAMEVLSWAESNVRVPVHFCPVSFKDLVQVRNRYRRTASRDLRWYEVPLDDGTVARG
FT                   EIVGEDGDVIGYFRPGEQVSLPKGAVARVVVTYPTQARSPVLCEAESEDPAEAFRECS"
FT   gene            588765..589481
FT                   /locus_tag="ASAC_0586"
FT   CDS_pept        588765..589481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0586"
FT                   /product="hypothetical protein"
FT                   /note="DUF364 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18993"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q105"
FT                   /protein_id="ADL18993.1"
FT                   /translation="MNVVKALVEESLPRARGRAIRRVAVGRYAYVELDDGRAGLAYVDW
FT                   DWVKPNRDPWSPPRSAEEAVGLALSYDPVMAAVGVATINALVNTGGQPVDPLDLVKVSP
FT                   GSKVAIVGYIRPYVRRLSGTAKVYVFELSPSEEDFVLPWYAEEEMLPQMDLVIATGVTV
FT                   VNKTINRIAELSRGSQLIVVGPTTPMLPEAFEGLRGALGGSTVVDREQAYSMITMGYGA
FT                   GALLHSKVLRKATVQL"
FT   gene            589549..589821
FT                   /locus_tag="ASAC_0587"
FT   CDS_pept        589549..589821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18994"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q106"
FT                   /protein_id="ADL18994.1"
FT                   /translation="MRLPLVNLKEVAGPGPYRARLEVTLWPGLVEEVSVPRLSRQPDRA
FT                   YCSRIEGLEARSYVVTLCSSGEPFASVYLCPPWIRSASGTTRQTP"
FT   gene            complement(589784..590341)
FT                   /locus_tag="ASAC_0588"
FT   CDS_pept        complement(589784..590341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0588"
FT                   /product="Nucleoside-triphosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18995"
FT                   /db_xref="GOA:D9Q107"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q107"
FT                   /protein_id="ADL18995.1"
FT                   /translation="MRRLYMVTHNDRKFLEASLILKPYGIELQQIKAEKLEVQDEDVVR
FT                   IAEVAARHAYEQFRVPLIVDDSGLYIDALNGFPGPYSSFFLEKVGLGGVLKLLSGVTNR
FT                   RACFRTGLAYADEGGVRTFAGEVCGSIAESPRGSGGFGYDPLFVPEGHSRTFAEMGVEE
FT                   KDSMSHRGRALRAFAEWYLKRS"
FT   gene            complement(590338..591018)
FT                   /locus_tag="ASAC_0589"
FT   CDS_pept        complement(590338..591018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0589"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18996"
FT                   /db_xref="GOA:D9Q108"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q108"
FT                   /protein_id="ADL18996.1"
FT                   /translation="MIESWASSLTLLKRGAESEVRLGDFMGMKAIYKLRVSKPYMDPAL
FT                   DSRLRAQRTLKEAKVLSVALARGVRVPRLYAVFPSLGLIVMEYVRGPTLKELVGSPGWE
FT                   SLAEDAGLQLGLLHSAGIVHGDSTTSNMVVSDGGVTLIDFGLADFSSELEDRAVDVHLL
FT                   REAVTSTHPSAAGRFMEAFMRGYSRALGEGAAEEVSRRAREVEMRGRYVASRRSVWAEE
FT                   GGEG"
FT   gene            complement(591015..592070)
FT                   /locus_tag="ASAC_0590"
FT   CDS_pept        complement(591015..592070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0590"
FT                   /product="Putative O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18997"
FT                   /db_xref="GOA:D9Q109"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q109"
FT                   /protein_id="ADL18997.1"
FT                   /translation="MATAATRSSSSNSEVIVLGIESTAHTFGVGASRWTSAGPELLKDA
FT                   RRNYVPKQGGILPREVAQFFSQVAAEVVEEALSVNSLTPRDLDAIAVALGPGMGPQLRV
FT                   GATVARAMAAALKVPLVPVNHAVAHLEVARYTTGLRDPVILYVSGGNTAVTTFVEGRYR
FT                   VFGETLDMALGNLLDTFAREVKLGPPYVVNGNHVVDACAEGGEFIGWFPYVVKGQDVSY
FT                   SGLLTAALRALRRGAKLKDVCYTLREVAFSAAVEVTERCLAHTGKRDVVLTGGVAANRV
FT                   LNSKLDSMARLHGGTYRGVPAYYSGDNGAMISLAGLLAHLSGVHVEPERAFINQRWRLD
FT                   EVEVPWYGKLL"
FT   gene            complement(592030..592212)
FT                   /locus_tag="ASAC_0591"
FT   CDS_pept        complement(592030..592212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0591"
FT                   /product="30S ribosomal protein S27ae"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18998"
FT                   /db_xref="GOA:D9Q110"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q110"
FT                   /protein_id="ADL18998.1"
FT                   /translation="MAKQVKAYVHLLYEVDYNNMTIKAKNRKCPKCGNFMAHHLKPVER
FT                   WHCGYCGYTEFVVQQ"
FT   gene            complement(592212..592595)
FT                   /locus_tag="ASAC_0592"
FT   CDS_pept        complement(592212..592595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0592"
FT                   /product="30S ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADL18999"
FT                   /db_xref="GOA:D9Q111"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q111"
FT                   /protein_id="ADL18999.1"
FT                   /translation="MTGLSEVPGMPEAKRVDLGDGSWLEVLSERRNDLLKRTEVEALAH
FT                   HELKSTPARSAIREAVAKAYNKDAEAVYVKTIKTSYGVGISKVHIHVYDSHDDAVKVEP
FT                   QYVLARHGEAEKKQAKTKAGGGK"
FT   gene            592839..592958
FT                   /locus_tag="ASAC_0593"
FT   CDS_pept        592839..592958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19000"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q112"
FT                   /protein_id="ADL19000.1"
FT                   /translation="MAKMLGRSKLWGEGRAAASVLAGRALGITIIKKVVAERA"
FT   gene            592961..594553
FT                   /locus_tag="ASAC_0594"
FT   CDS_pept        592961..594553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19001"
FT                   /db_xref="GOA:D9Q113"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q113"
FT                   /protein_id="ADL19001.1"
FT                   /translation="MHIDESQYKVQDLVDRKRTSSYYTTYDGISVIRSFLKEVPSREGA
FT                   VLMDPFMGSGVLLSSVDDLVKPSRVIGIEINKEPCELGRKMLSSIYDSVEVICGDAFKV
FT                   AWKYKADIIVSNPPFVRWHLISNRDELLNSVISHGYGSFVSRRDPGLHILSIFLMDYIL
FT                   KEGGHALLVLPASTFYTRQGDGVKKLLKYRYDVIAMAENLKSPSFSSGSGFKELIVFLR
FT                   KRKLFEFNAVQTAIYQYDGNLKESRRVNLSKMPKLLDRNWLSLFDYDNAEAVAEMIEKA
FT                   LDMGLLRYLRKGEIIRGVEMYGPDFFFIPNRAWSIVGEDESSVLISNREQTLRLPKRYL
FT                   VKCLRKPEYYNDSIVVHDPRFYAIAINDDPEGDVAKYVEWGERQNIPALKFGSKWYQHV
FT                   WRQLQTKKPYGHVFIHDKLDPTRHVILANYSEKPLCASKNFYIIRENNPLIAAWLNSSI
FT                   MQYILQTFSKRISDNWTRLLEDDYLEIPVPSKVKDVDLSSVQNAEKAIEEYLDIRSINA
FT                   TIIKDPPNSIHEL"
FT   gene            complement(594805..594880)
FT                   /locus_tag="ASAC_R0022"
FT   tRNA            complement(594805..594880)
FT                   /locus_tag="ASAC_R0022"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGA"
FT   gene            595025..595429
FT                   /locus_tag="ASAC_0595"
FT   CDS_pept        595025..595429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19002"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q114"
FT                   /protein_id="ADL19002.1"
FT                   /translation="MAKQVQCNSIGVSVKFGNVTCYDDGSIVVEGPAVLWVSKALMGVD
FT                   GRSRKVGAVQRAIMDAISRGLHTREEIAASVGISIGSLGYSLTSLVRKGLVMLVKATSG
FT                   GPCRSYYFLPGQDIQAYLTANRLVPCRKSS"
FT   gene            595489..596469
FT                   /locus_tag="ASAC_0596"
FT   CDS_pept        595489..596469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0596"
FT                   /product="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19003"
FT                   /db_xref="GOA:D9Q115"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q115"
FT                   /protein_id="ADL19003.1"
FT                   /translation="MRADVPVECVVDAHVHMPLLRERGEVNSYIRGLVESGVGGAVLLG
FT                   IPPFKEILASIPLEEVKSEHERVRGLIEKLAGDIMDQLEPESLYLSAVKLSESFCSFAR
FT                   HSELAGVVNFPVMYPANLSLGPDELARQLEEAVSLGFRGFKVISTLFLKYLSSEQVEAV
FT                   IEVAERKGVPVVVHGGCDPGIWELPRYCKYGDPSKLEPLLSRHRDATVIVAHAGGYSAI
FT                   APGVFFEEALSLARRFESVYVDTSALPPQLVPVVLRDFPAGRVLYGSDYPAVANSSLRE
FT                   YMEEVFMTLLASGWRGKELEGYAHGVAEEVFRASCVTPLYDGVGL"
FT   gene            596589..598568
FT                   /locus_tag="ASAC_0597"
FT   CDS_pept        596589..598568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0597"
FT                   /product="Acyl-CoA ligase (acyl-CoA synthetase)"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19004"
FT                   /db_xref="GOA:D9Q116"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q116"
FT                   /protein_id="ADL19004.1"
FT                   /translation="MESLSESPSKQEIELLPYGEKYHPYHNKYVDFWRQSLADPMRFWD
FT                   ERARELVWYRTWDRVLDDSNPPFYRWFVGGETNVNLNALDRWMNTHVANKVAYYWEGED
FT                   GTTRVLSYRDLFREVNKFARALQDLGVKPNDTVTIYLPMIPELPISMLAVTRIGGIHSV
FT                   VFSGFSPSALADRIVDAKSRVLITADGYWRKGKVVELKKNADEGVRLAEERGAKVDKVI
FT                   VVRRLGNQVAWNEGRDVWYHELVSKYPENTYVKPVPRKADDVLFILYTSGTTGKPKGIM
FT                   HSVGGYMVYVYNVFKWNWDIRPEDVHWTMADVGWITGHTYIVYGPLLNGATEVMYEGAI
FT                   DYPQPDRPWQIVERYGVTIFYTSPTALRMLRQYGDEWVKKHDLSTLRILGTVGEPINPD
FT                   VWKWYFEVVGRGKCPIVDTWWMTETGAAMIAPAPGISLVQLKPGSATFPMPGIEADVLD
FT                   ESGKPTPPGVKGYLVIKRPWPGMLLGVWGDPERYVKTYWSRFPGYFYPGDYAVKDEEGY
FT                   FWLLGRADEVLKVAGHRIGTAELEDTLIKHPAVAEAAVIGVPDPIKGEVPVAAVVLKAG
FT                   YRPSEDLKKELIDMIRTNIGPIATPQAILFVSKLPKTRSGKIMRRLLKDIMEGRPLGDT
FT                   TTLEDPTAVDELKRAWDEFKSQMR"
FT   gene            598573..599136
FT                   /locus_tag="ASAC_0598"
FT   CDS_pept        598573..599136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0598"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19005"
FT                   /db_xref="GOA:D9Q117"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q117"
FT                   /protein_id="ADL19005.1"
FT                   /translation="MSQDQPFADPSSLGLWGFALTTIVLSLHNAGLISTAGLTLAYAFF
FT                   WGGAAQVFAGWMDFKRGNMLGGTAFSTYGLFWIGLAMAFVLSSWDPSVFSMSGAELGAW
FT                   FVLWGVLTLIYAVGAYMAKARVLTSVLALLTLTFWVLGAAFFSGSAAITRAGGWIGVIT
FT                   GLDALYLGAALLINWVARGQALPT"
FT   gene            599305..599874
FT                   /locus_tag="ASAC_0599"
FT   CDS_pept        599305..599874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0599"
FT                   /product="N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19006"
FT                   /db_xref="GOA:D9Q118"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q118"
FT                   /protein_id="ADL19006.1"
FT                   /translation="MSSCRRERLAALGSYSIELLCPEDAKYVVEFYSSLDAFSLYYRFL
FT                   GIFKDFEGHARRLFSGQCNYAIGAFLGNDIVALGEGFSDCRSAELAFAVKEEHRRRGLA
FT                   TVIAALLILEAYRRGIKTMEAYMHGDNYAAIRIGEKVGLNLECEGDVYHGKAEVAKVRD
FT                   RCLNAIREKGGSLEPWYLEAIASVKP"
FT   gene            599914..600597
FT                   /locus_tag="ASAC_0600"
FT   CDS_pept        599914..600597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0600"
FT                   /product="N-type ATP pyrophosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19007"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q119"
FT                   /protein_id="ADL19007.1"
FT                   /translation="MGSRVAMFSGGKDGLRAASLAWPVDILLFLVYDFPEPSPHIENVG
FT                   ATIAEASLIGKPIVVARLDRGKEFEETADLLRKLNADKLIAGDVFVEDHLKYMESLASE
FT                   AGASLLEPLWGQDTLEILMKDLEEGYSMKVLGARTRALRRAVGEVVDRHNSEWFLSLAK
FT                   SDGADPLGENGEYHTVVVNSPLHRAPLRTFNVRRISMECCDIELVAAPFNQAALGSYIR
FT                   AFGTP"
FT   gene            600712..602232
FT                   /locus_tag="ASAC_0601"
FT   CDS_pept        600712..602232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0601"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19008"
FT                   /db_xref="GOA:D9Q120"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q120"
FT                   /protein_id="ADL19008.1"
FT                   /translation="MGNSRGSISTAALAAIVVVIIIVAVAGLAIYYTHRPSKVTTSTKP
FT                   TPTTTSTTTTSTSASSQQVTLTIATYTGAPQQFLSMAAQLFEQEHPGVVIKVDAYPFTE
FT                   YITNELTVLKAGESSYDIVTFTPTSARLLAPYLVPLNSSVINTSDILWPAESFGGVIYN
FT                   ATTNTSEMVGVAPWVSNVLIIYNTKYFDNATLQQEFYNEYHMQLNPWTWHNWTVVVDVS
FT                   QFFVSHNITKYGVLIMDDTAGGDLDSSFESIYGWFYIHNQSLNCGTIHGIPGFGIEFYG
FT                   CYPKGWTYPFPPPAINTSAGVQALEILRELVSYEPSPTVFQVSFDNTPELFAEGYGPAA
FT                   VNYASRLAAILAQNVSPSEIGLAPLPGNYSMAGGTYFGISRYSQNKQLALEFLQFVESP
FT                   QVQEEMFLKLGLFPISKQAYSVLLSNSSVPAYEKNWLLANEISAEYGNAWEPLVPVTLQ
FT                   LGNALGNALLNYLENPTSQSPQQVLNSVAAQYISILKSYYASTTTSSS"
FT   gene            complement(602288..603724)
FT                   /locus_tag="ASAC_0602"
FT   CDS_pept        complement(602288..603724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0602"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19009"
FT                   /db_xref="GOA:D9Q121"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q121"
FT                   /protein_id="ADL19009.1"
FT                   /translation="MSRPWRYPREYLRLVSIVTSFAAILTPLDSTIVSVSLPAIARGSH
FT                   ANYLETIWVPVGYLASLSAFLLLFGRLGDVRGRKRVFTVGFLIFTVGTIMCALSVNGLE
FT                   LDAWRAVQGLGAAMILSNSGAIITEAYPPWERGKAFGYWTLAVYTGTTVGPVVGGAITS
FT                   FRYIAGVPSWRWVFLVTVPLAALGYALSQAYLKESERVDEPVDVLGGLLAAAGIWLTLM
FT                   GLTAGAFEGWSPEYLSLLAAGLALISAFAVRESRLGPRALLDLRLFRSVPFSAGNLAAL
FT                   LNYAGYFFVPFFLSYYMIEVLGIGPIYVSLALLSLSLAMVVLSPISGRLSDRVGARPLA
FT                   TAGMAIIAVGLALLMQLGLRASLQDITWRAVLLGIGMGLFSSPNTASVMGAAPRDRLSV
FT                   ASGTLNLMRFAGQSLSLALASALAASYIPRGVLVTIFTGLPAAQAASAVSFVRGLRAIY
FT                   MVMIWLVVAGAVASAIRGRS"
FT   gene            complement(603730..603915)
FT                   /locus_tag="ASAC_0603"
FT   CDS_pept        complement(603730..603915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19010"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q122"
FT                   /protein_id="ADL19010.1"
FT                   /translation="MVALSSIDDVLRRKEDESLRKLKEGYEQYLKSIRDMKEQALREAS
FT                   RRLDEAAKEFVRSLTG"
FT   gene            604181..605419
FT                   /locus_tag="ASAC_0604"
FT   CDS_pept        604181..605419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0604"
FT                   /product="predicted transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19011"
FT                   /db_xref="GOA:D9Q123"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q123"
FT                   /protein_id="ADL19011.1"
FT                   /translation="MITYTAPMWVGLIIGFIIGAAAEAWGIANPETLIRLAKWEDRLFL
FT                   DCIALGFAIGTPVLFGLYALGVGFHWGPKPLYVIGVGLGGVLFGSGLALSGYFPGSIWM
FT                   ALGEGRRDAVYALFGAILGAATWTAMYQDPAIRKALVGTLNFGSQIIGATHPSGAEYLV
FT                   PWPGLNRYSLFGIALVYGIIMFLIAYYVPRYRGGSRSCLRANIEKRVTPVEMKMHEDTA
FT                   RYLTDGALPYKKGSLAQKLNEYYAVESNVTRWFMVSVAGIVALTVVAEMFLHQIFGEST
FT                   TDSWIAGHLFMPNFAYSKIVFKGIGWEPYSDIGTLMGSFFAAIFLTRRFTAFRNIIPPS
FT                   WAERFGTNSAVRFLGSFGGAYLMLLGARMADGCASGHILSGGLEMALSGLEFAGFVFLS
FT                   MVLVGRVYYQRRR"
FT   gene            605419..605694
FT                   /locus_tag="ASAC_0605"
FT   CDS_pept        605419..605694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19012"
FT                   /db_xref="GOA:D9Q124"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q124"
FT                   /protein_id="ADL19012.1"
FT                   /translation="MEMAKVSEETLDKMDRTFKAIFIIAFIMQLVIAAIVTHDATTTPL
FT                   TGWQVASVGIITVILLVIAAVIYSQYPYSVLGQPVEQQGGQQAEKK"
FT   gene            complement(605818..607548)
FT                   /locus_tag="ASAC_0606"
FT   CDS_pept        complement(605818..607548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19013"
FT                   /db_xref="GOA:D9Q125"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q125"
FT                   /protein_id="ADL19013.1"
FT                   /translation="MSLLLHPRGRASLTARAAAVLIIIVTAASALLTGIYVLPGALVRG
FT                   RLIIRAFYLRDGSPVQIENASFSVWAWAPTQKGTELMPIFNGTGGEINIDMSKLLAWVE
FT                   DWLRYYGPGAMTSFMPSIIVWVMYPIDLPNGSVELAIEPQLEPLNLSVPLSGSGAVLEV
FT                   QVSHPFKAIVGPGQLRPRAASVGAVMSAQTTTTTTTVLITNTTSALGGQLGRCWHSYYY
FT                   EAAPHVLSWYPNSSGVAPISLAVAVLQPSPDATSNNLQVMLLGPTVQYVGFNAVMIASG
FT                   AIGAAAQHFNSAGLEALSEATKALSPLAVNPSLSFEYVSVSSWEDGNVFTGGPDVAQLY
FT                   VVGQIAFINWTVVKYSAACDRVVDYIHAWYLGPLVTAVNVYRSGTGVAPIVHLWYSYVN
FT                   PVNLSAWAEESALAYEASQGNEGAAEILGSLEVAYPPPPTPAPIFWGSYDVNLTPLKVV
FT                   PTFGSLSISYTSLEVDGPESTYAVGLDVGSIAVSALGDLACDGAPCGPLLAGALEPITF
FT                   GTHTFAVDSDIISVQDGLKSPPVYVYFSNLTPVYYNYCSGINFTMPHNIIYVTFNGSAG
FT                   "
FT   gene            607720..609522
FT                   /locus_tag="ASAC_0607"
FT   CDS_pept        607720..609522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0607"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19014"
FT                   /db_xref="GOA:D9Q126"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q126"
FT                   /protein_id="ADL19014.1"
FT                   /translation="MLPLHVKNSVWGTSRKIAALSSGPAAGLGSPLGHATLKISLSPSS
FT                   LGSCLRLTAPYVAYITAFGVVPFFATFALVGLDFRSALVALRLVPVGQVFLNTFILAVA
FT                   TSVLGTLIGLVAAVAVDMLDVKYQRPLSLLTVLPHTVPFVSAALIWSISLYGGGWGWFT
FT                   YLLHISFDPLYLANTALYGVILVSVWGAIAFPFIIIYATLRSIPPEIRENAMIDNIGLS
FT                   RYYGEVAIPLASKAILIAFIIELAFSFGAFDAPYVLTGGGPGYATTTLGILTYEAVYNL
FT                   NSYSAGALIAAAIAALATVPAIALFRVLRSRRALLPAVSVRLPDPVFKGIMLAVLSVIL
FT                   FFNVMPIYWMFLVAFRPNTLDFRSPPIMIPVKFTSAFFVQALRGSVPYMVSSVVVSVAV
FT                   GVIAVLLASGASYEIARGRAWGWLLPLSIYLYVLPPMAFVIPLYIAFAKAHLLNTWWAL
FT                   ITAMPLGYVTYALWIMNGFFVDLPKAYDEVADLFNIKGKFRRLILPLSRPVLLSTFLLA
FT                   AVGAWHALFYPLIFSATPYNFGFPPQGAQTVTIYALTAIQESTIDWGLLASMALVAALP
FT                   PMVLDIVFLSLIARGSRASGLKFL"
FT   gene            complement(609509..610216)
FT                   /locus_tag="ASAC_0608"
FT   CDS_pept        complement(609509..610216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0608"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19015"
FT                   /db_xref="GOA:D9Q127"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q127"
FT                   /protein_id="ADL19015.1"
FT                   /translation="MNRLRLVAWSLSALYPPFLFLSVLDVPRPLSLVAAVVSTPIFFVT
FT                   FYLLASYSELGGRRTLYFLAASAAISYAFEFLGVHYGLPFGKYYYTKGLGLKVLGVPVY
FT                   IPLLWASLGFYSLAATGSYLAASLAMVAMDLAFDPFLTIEGHLWVWQTRGPYYGVPITN
FT                   FIGWFVVSMAFYYAYDALGKAKPRPRLVSRAFYLEYVAAWSAMDFVSGLWLAGAAGLLA
FT                   ASLALALGALTGT"
FT   gene            complement(610258..613044)
FT                   /locus_tag="ASAC_0609"
FT   CDS_pept        complement(610258..613044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0609"
FT                   /product="Putative trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19016"
FT                   /db_xref="GOA:D9Q128"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q128"
FT                   /protein_id="ADL19016.1"
FT                   /translation="MVLHLRISYYDTSLAGVPMGGLGTGSFEIGPDGRFREWLIFNNRP
FT                   WAGYGQPQWFMTPDDLVFFLRIEPEGQEPILRGLFTGLWYGSAEDYTYRGCGPWVVAEP
FT                   YHLPWAKGVEGVEMDVRYPRVTLSYRDSLLDELGVEVSLDAYSPLLPGDLKASSTPAVI
FT                   LRFRVTNRGTSRVKVSLMAVARNLARSAGGRPSSEVREGPDWTAMIMSACCVDERHPMA
FT                   RGALAVASLGQQSSGAVGSVDSSNRPQLVNLLRRLLVDFRGDGTLTGPSSMTSDLDVFS
FT                   AVATRPIELTPGSSEELYWAIAWHFPNHIDASGQRVGHYYENFFGNVEQVISYIFENKH
FT                   ELTARLEAFSSAMYDASYDDWVIDLVTAQLTSIPKLSWLTRDGHFGLWEGGPGCCGLNT
FT                   VDVVLWAFAGVINMYPELVKVAVKDVVRHILRPDKHYYYELFALGFHENMSLYREMLRK
FT                   DPSIQNDPAKFSEAIAEVVRRTGKDPTGRVPHSFRASFNLIDSYDRNDLMPEFLLIALL
FT                   PYYATGDREYLRSLWNDVLTVIDGTRRQHDSRGTGLIEHYMPSDYEGLSRVAQDAAEKG
FT                   LVPGFYGGNVVKLLFSGPEFVMNSVNTFDTFSLLGVASFTGDLWAASLRAAAEAASREG
FT                   LARAEELRQLSLRAYESMVKLLWNGSYFDDWYDPESGLRDRAILSAQLTGEWYLQVLGL
FT                   GDGVDSEKVRSALREVYRANFRRWEGLLNGTYPGTPRPSMVGDVEEPNGTKILNRVSSQ
FT                   ADTPWTGVEFGVASQMLYEGMVEEAMEVLRSIHDRYRSWGLYFNHLECDGHYSRPLAAL
FT                   AIPNSIAGATYDGVRGELAVAPRLGGPSFRGPVMVAGNLLSVSYRREGCSGSITLKAVE
FT                   GPGLRLSSLRLDFKGCRASVKYNGSEVPLSYVKDGELGLSRELMLRPGDLLEVSLGQ"
FT   gene            complement(613084..613689)
FT                   /locus_tag="ASAC_0610"
FT   CDS_pept        complement(613084..613689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0610"
FT                   /product="indolepyruvate:ferredoxin oxidoreductase (IOR),
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19017"
FT                   /db_xref="GOA:D9Q129"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q129"
FT                   /protein_id="ADL19017.1"
FT                   /translation="MDVSRRRINIVMTGVGGQGLITAARILGEAAVEGGCKALVAETHG
FT                   LSQRGGAVEVHVRLGDVYSSLVPRGEADVVLSFEMIEAVRGVPYLRQGGVLLTADTLMM
FT                   PPTPGLRPLKRQQIEAALKGAGVRYVVIPAREAAEKVGSYLAENMVMLGALVGTGALDG
FT                   FVEPERIRAKVQELPMADKNLAAFEEGIRLGSQARLRP"
FT   gene            complement(613680..615581)
FT                   /locus_tag="ASAC_0611"
FT   CDS_pept        complement(613680..615581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0611"
FT                   /product="Indolepyruvate:ferredoxin oxidoreductase (IOR),
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19018"
FT                   /db_xref="GOA:D9Q130"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q130"
FT                   /protein_id="ADL19018.1"
FT                   /translation="MYRILGRAGSTALLMGNEAVARGFLEAGGGFAAGYPGTPSTEVIE
FT                   SLAEVAKEAGIYVEWSSNEKVAVEAAYGASLAGVRSIATMKHVGLNVAADALMSIAYTG
FT                   VRGGMLVFVAGDPSMWSSQNEQDDRYYGLISYVPVLTPSDPQEAKDLTVLGLDLSEKFS
FT                   HPFMMVSTTRVSHTRGPVVLGPLRPPRTAGKFERARGLTLVPAVAREQREKLISKWEDI
FT                   RKTFAGLGQFNRVEGDGDVAIVTDGVAYGFVKESLSELGPEADKVKVVKIATPLPFPRS
FT                   FVIDAISNVKRVLVVEELEPVVEGQLKQALEEERLTPEVHGKDLVGLAGELTLDRVRRA
FT                   VRSFLGLPVEEPRLYKVDLQIPPRPPAFCPGCPHRATFYALRRAVNRLRLKAIYSGDIG
FT                   CYSLGLYEPFREQDIIIEMGGSVGAANGLAHAAQDQVPIAIIGDSTFFHAGIPGLINAM
FT                   YNRAPMLLLVLDNRTTAMTGEQPDPGSGVTAMGDEAPVISIEGIARGIGIEKVVTFDPF
FT                   DINGATNAMAEALEYVVKERRPAVAVARRACALDALRRARKAKVQVPLYQVEDDKCTAC
FT                   GICYNAFSCPAIFVKDDRKAWIDPSLCTGCGVCAEICPYKAIVKVVQEGKGWEEAWM"
FT   gene            complement(615799..616815)
FT                   /locus_tag="ASAC_0612"
FT   CDS_pept        complement(615799..616815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0612"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19019"
FT                   /db_xref="GOA:D9Q131"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q131"
FT                   /protein_id="ADL19019.1"
FT                   /translation="MPGLCLYGTVLNSVNTVEASIRSVYRPDAEIVVVDGGSRDGTYER
FT                   LLELSKDYNVKVYRLPGSTRGRGRDYALRMCPEGSYAAYFDLDDEYNAYFHRAIEWGMA
FT                   TESQRPLYYLVKRDYAIARGGWRDLNYAEDIEFFTRVGFDYYLPLITSRPVVRHWSSGR
FT                   AEAQRYGRGSISRALRLIRMTIDDIRGGAYSFTEFASTIRRAHYRLASPLVYAAAAAMG
FT                   IYRNAEGVSNKVAYFRAVLERLVNPVEAIGADPADVIVIVEYLPALRLGLGWAAGRIAA
FT                   AGLSPLVCKMDTRDALVGVGSEEAVRRWPRAPLHSCKTIAVTSPAPTLSSRSFHDHS"
FT   gene            complement(616985..617404)
FT                   /locus_tag="ASAC_0613"
FT   CDS_pept        complement(616985..617404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19020"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q132"
FT                   /protein_id="ADL19020.1"
FT                   /translation="MGSWEEDECYEFRRELDELFERVYKDVKAGRYDFLRNAIDIDVVK
FT                   SIYVDRPHEIIVIPDMGKLNRRAEVLIYVDPMSLAVTGTKGECKYNRVADHNRVSFYNS
FT                   LLEYLDYLSQRPELQVKGVGQRTRSVMSIALDRVN"
FT   gene            complement(617454..619610)
FT                   /locus_tag="ASAC_0614"
FT   CDS_pept        complement(617454..619610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0614"
FT                   /product="NAD(P)+-dependent formate dehydrogenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19021"
FT                   /db_xref="GOA:D9Q133"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q133"
FT                   /protein_id="ADL19021.1"
FT                   /translation="MPVKVIIDGREVVLEKPTTILNAARRAGIDIPSLCYDERLSPYGS
FT                   CRLCLVEVKGRGLVTACTTYVQDGMEVSTETPEVVEHRKVILGMLAERHPRDARGRLAE
FT                   LFKRYGVEPGGEERPELVDDSHPLLRFDFSRCVLCYSCVRVCDEYIGRLIWRAMYRGQQ
FT                   TVVIPETGKFGTSSCISCRACVDVCPSGAIVDKVMSSSVPDRWGETACSMCSLSCPVRV
FT                   GLSGSRPVYVDGDRGQLPFSAECLKGKYHWEDLVYVPERPEGPRVRSNGLWSKAGWDDA
FT                   LKAVAQGLREAVRDGGPSSVGVIVSSRLTAEAYYLSQLLARAGLGTNNVDTASTLLPST
FT                   GELTPIGGPLPTVPFTAVQDADVIVTIGQVEEYHPALASAIRRQSLQGYSRLVVISTKD
FT                   DKLSRFADVFVESGQEHMQAAVRAVEASLAEGGRVDVAGASKYLPGAASLALSLRSLGG
FT                   SRASRQAGVDEGAVRAAAETIASAGRLVIVSELDGTPGVASESLSLAALSGALSREGSG
FT                   LLPLLSYFDNYEAVAFGVSPSRLPGGLRLDEARGLEGAWKVSVPGEPGMSSAEMIEAAR
FT                   DGRLRALVIIGYDLASPSPMRESILEAMSRVPLVVSISPAAGVGVSYASKFHLPLASHV
FT                   EEEGVYVSADGRLTLARGNVVINNAMRGWEVASRLLEALGYQRRYSSSRDAWDELRSLV
FT                   KAPLPDYDSMARGPAKVDLRRMAA"
FT   gene            complement(619616..621061)
FT                   /locus_tag="ASAC_0615"
FT   CDS_pept        complement(619616..621061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0615"
FT                   /product="NAD(P)+-dependent formate dehydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19022"
FT                   /db_xref="GOA:D9Q134"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q134"
FT                   /protein_id="ADL19022.1"
FT                   /translation="MPLTIRINLPKQEVNTFYSFPDFAPPEEHCRGLACYAARSLDPEA
FT                   WKKAVAQQPPTYCLGKCYAGPSSTLTGGAPHVEVRSRKAIVLRHIVDGPVKSLRDYLAR
FT                   GGMRGLERALSMPQAEVIDEVKRSQLRGRGGAYFPTGLKWESAMRQAAPAKYVIVNGDE
FT                   GDAGAYVDRFLMEWDPYLVIEGALIAAYAIGAGRVYFYIRREYPGAVAAVRRAVEEVRE
FT                   AGYLSPPLPSELEVHVGRGSYVVGEETAMINAIMGRRPEPTPRPPYPTERGLFGMPTVV
FT                   NNVETLSSVPWIVENGGDAYAELGFSRSRGTKVLSLSSTFSRPGLYEVEFGVSLREVVY
FT                   DMGGGVRFGKLKGVMIGGPLASLIPSEELDVKLGVEELRAIGASLGHGNVIAFSDDTSV
FT                   ADMLHEVLLFASFESCGKCFPCRLGTAKLERMFSKGYLTEEEAREAMSIANTMAVASLC
FT                   GHGQAAGQAVAVTLKKFWKEIVR"
FT   gene            complement(621097..622299)
FT                   /locus_tag="ASAC_0616"
FT   CDS_pept        complement(621097..622299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0616"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19023"
FT                   /db_xref="GOA:D9Q135"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q135"
FT                   /protein_id="ADL19023.1"
FT                   /translation="MGDTGASETGMPRRLSSRLSSLAASPMKIIDSLLGPAGADVIRLH
FT                   AGEPSLPPPLELVDSLVDDLRRPESYAYAPTRGLPELREAVAEELKRDGTSVSFDEVAI
FT                   TPSGTSAIFSAMSVLLDPGDEVILVDPTFMIYRPVIEYLGGRVRWVRASPERGFQPDPD
FT                   AVAAAINDRTKAIVLVDPDNPTGRLLDPDIGRAIAELAQDRGVYLMVDEAYRRIVYEGS
FT                   YRSVQPYAPDSVIGLGTFSKDPGVPGLRLGYIYGPKDFIDAYASFNGHAFFGASNMSQL
FT                   YVLRYLRWEGREKFIESVVAEYRRRRDAAVKAMRRYVPSARFTEPRASMYLYADLSPLV
FT                   NDAESFASRLASKYRVTVMPGTAFGPANRTFIRVTFVSQPPERLEEGIRRIGEALGEAG
FT                   Q"
FT   gene            622379..624103
FT                   /locus_tag="ASAC_0617"
FT   CDS_pept        622379..624103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0617"
FT                   /product="Voltage-gated chloride channel"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19024"
FT                   /db_xref="GOA:D9Q136"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q136"
FT                   /protein_id="ADL19024.1"
FT                   /translation="MRLSELPYYERWFIAGIVIGISVGLMALALYYLEVYALGRLVLLD
FT                   VLHVNERGMTLHQYYASLPWLLLMPLVLVAAFPLSLFVALAMRTPEVGSDPAVKAYHRN
FT                   ARMRLEEAPAAIISSAITIGLGGSAGREGPASHAGAVISQWLSRIMNMSAEDRRRAVAI
FT                   GLGAGIGTVFKSPFAGAILSAELLYRRDMEPEVIYPSLIASSIAYVIYGSVTGFSPILG
FT                   LCSCPFNPLYLPLFAVLGLITGSMAMLYVRSLNYFSRLFRSLANPFVRAALGGALVGLL
FT                   VILFPEDMGEGLSWVRSLMGGGQVVTLLPLVLALLLLPLSKVLATSLTLGSGAKGGVFA
FT                   PGLDIGAFTGLAFGEALHFASPSLFREVGPFVVVGMLSTFGAASSAPVSSMLMTVEMSG
FT                   SLALLPGEMIALAVAMIVFRGPTLLREQVESRARSPVHAGEYAIPVLRKVRVAEVPPRQ
FT                   LYVRQDARVSEALQVIASAGLLSLPVVDPLGRVLGIVNSVDLRQGRPEEPAMKYMRPEP
FT                   GHVRPDSSLEEAINMMSRTNSRYAIVEDNGKFMGIVTLDDVVRAYEREASRYSGPQG"
FT   gene            complement(624078..625205)
FT                   /locus_tag="ASAC_0618"
FT   CDS_pept        complement(624078..625205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0618"
FT                   /product="Probable thiamine biosynthesis protein thiI"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19025"
FT                   /db_xref="GOA:D9Q137"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q137"
FT                   /protein_id="ADL19025.1"
FT                   /translation="MVATLAGELGIKGRPTRAHMVNELIRNVSATVRLRSWRAYGGTLV
FT                   LEVDGDLPALSRVFGIAHYSAATPVKYEDLQDLTRKASALVVEDVRGRRFAVRARRAGG
FT                   EDRFTSMDVNRELGAALLQASAGVDLESPEVTVYVDIVERGLAYVHTGLAEGARGLPVG
FT                   VAGRTVALVSGGIDSPVATWMIMKRGVVPLVLNLSIGGEEHRRAVLEEVRALRAWSGRH
FT                   DIKVFFVDGIPVMKGLAEVRRELRVVTLKRVLYRLAEALAIREGAHSITTGESLSQVSS
FT                   QTMWNLEAEEHGIELPVLRPLIAMDKDEIAEVARRIGTYSVSAKVPEYCAIAQASTTRA
FT                   RVEDVIKAEQAMNLDYRELVKSAEVVKVSPEGQST"
FT   gene            complement(625260..626366)
FT                   /locus_tag="ASAC_0619"
FT   CDS_pept        complement(625260..626366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19026"
FT                   /db_xref="GOA:D9Q138"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q138"
FT                   /protein_id="ADL19026.1"
FT                   /translation="MELPRRSSNLGVRWKYAVVAGLIVAALVLALRLAPATARRQSMIT
FT                   VTTGQQLASALNTSRPVLLIFGATDCVYCHVLDPYAEQYAQAHPGVEVVNVELNLLYSN
FT                   DPGLVERLVSYYDIQGTPTELVIYHGMVYGYHVGIWPPPTADQLPYIEQFVNSSLSGRP
FT                   IAPALSVGPAPAAAGSPTSDLKYVSPAAALGVGALAAVSPCSIPMLALYSASSRRRALS
FT                   RMALELALMTLGVAAFGALLAKVYSLSPLIESSLEGFAAGFSAFLGYELLRGRVVMLGG
FT                   PAAAFAPLAGLECSLPFFVAAISAVAAAGLTTAIMSSIAFGAGYSAVYVGLSGAVGRAM
FT                   SLSRRYGTVAGLTLVLIGVLLFVYVVVV"
FT   gene            626468..626917
FT                   /locus_tag="ASAC_0620"
FT   CDS_pept        626468..626917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19027"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q139"
FT                   /protein_id="ADL19027.1"
FT                   /translation="MGEEGNKYDARKDPKVIKIMTQLMAQGGVMLEQTCPICGLPLFRL
FT                   KSGDVVCPLHGKVYIVSSDEEAREVEIDETIKRLEYFASLKLRELMDKGDIGEAGDLLG
FT                   IMEQAERVLRLRLERLSSTSRQAQPQPPQPPRQRGKEEEEEEEEA"
FT   gene            complement(626914..627540)
FT                   /locus_tag="ASAC_0621"
FT   CDS_pept        complement(626914..627540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19028"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q140"
FT                   /protein_id="ADL19028.1"
FT                   /translation="MGVVRKASLGFMVEAARALIAGCRERGLRCRDPPLATSRLLSRIG
FT                   LNQYQARAFWSDAREASGREYVIYRYRGASFSLGLSVVESELLHIDGWLPADYFDCRLM
FT                   GDACSRSPRGKALYAYVSGFIAGGRLRVNSVNLLRILDMTVPGLVDELLDGVSDVIWGR
FT                   GHERLVNAVLKATGLDSIRIVLPATPEDVEDLLSLSPLLARLLKG"
FT   gene            627603..628421
FT                   /locus_tag="ASAC_0622"
FT   CDS_pept        627603..628421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0622"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19029"
FT                   /db_xref="GOA:D9Q141"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q141"
FT                   /protein_id="ADL19029.1"
FT                   /translation="MDRASAGWLGLYVVGSALLYFFVKAGLAYAQPLEYTVLRFVLSAA
FT                   VLLALTRSLTLNRYVALLAAASSVVWAWGLMLVLPATSASLSYFMPFVAIIMGFLALGE
FT                   RLDKWGAAGTAIGAVGVSLYAVESIRGRNTALGVGLTLFNTVLWAGYTVLYRKIAKMGK
FT                   SVDMSSVNLSMFLLGTVMMLPFVALDPSPVRFNLTLIASLAWASTMGGALQFLSWSRLL
FT                   ERMSVSRVTLLSYLVPAAAAGIQAVMGEPPDPLQALGLGIMVLGAYVALR"
FT   gene            628501..629850
FT                   /locus_tag="ASAC_0623"
FT   CDS_pept        628501..629850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0623"
FT                   /product="DNA helicase TIP49"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19030"
FT                   /db_xref="GOA:D9Q142"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q142"
FT                   /protein_id="ADL19030.1"
FT                   /translation="MSEIQITPVRQPKWSSVHSHIRGLGLDKNGKALRVADGMIGQTEA
FT                   REAAGLVVEMVKQGRLGGKGVLIVGPSGTGKTAIAVAMARELGEDTPFVAINGSEVLAA
FT                   ENKTEFLMQAMRRAVGVRMRDEREVVTGVVTDLKYLKRTSPFYPYPVLGGAKVTLETRD
FT                   DSGTFTVGPEVAQQFQELGIRKGDVIMIDVNTGEVRRLGRVKEKAAVSYDIDVTENVEI
FT                   PSGRVRSRREIVRTLTLHDIDASIAAQRAAFTIFGFLREESAISDEVRSRTDELVKKLR
FT                   DEGKAELVPGIMFIDDAHMLDIEAFSFLTKAMEGEFAPIIVLATNRGMTTVRGTDEVSP
FT                   HGMPRDLLDRLLIITTKPYSEDEIREIIRVRAEEEEVELSDDALSALTKIGAERSLRYA
FT                   VQLLQPAKLAAERRGSSRVEASDVEQVSKLFADLKTSIEYVEKYKDLLLH"
FT   gene            complement(629847..630764)
FT                   /locus_tag="ASAC_0624"
FT   CDS_pept        complement(629847..630764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19031"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q143"
FT                   /protein_id="ADL19031.1"
FT                   /translation="MKASPEDCAEELEGIYLTSRVYRASVELREAPSPEVTGGEVSLLV
FT                   KSVHEPSIDEVPLLNALLDSFDFAEIYEYERVAEVPEGDRTEHMVKFILDALSRNRGLI
FT                   IVAPDLMSVSLAGRLPDEVAEELDSAGVADVSVTAENTLYLPLPDAVEDSPVEIVAKAN
FT                   SRSSYERVSWLMEEARRRGLNVRGPTFMPDNRSVMEYVTSTGSRGYAYRVPVTKLAAML
FT                   VAFDRCSEQGLVEEVRRAETSTHTVYALRVPEEYSRRLLGALSELQRRYSGAPLLRPSP
FT                   KLQPLLERGLRESMAELMRRLGAF"
FT   gene            complement(630859..631512)
FT                   /locus_tag="ASAC_0625"
FT   CDS_pept        complement(630859..631512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19032"
FT                   /db_xref="GOA:D9Q144"
FT                   /db_xref="InterPro:IPR031594"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q144"
FT                   /protein_id="ADL19032.1"
FT                   /translation="MIDPGVALAALGITLLELSEAAAVGVAVYAELRSALASFGAMVAG
FT                   EALVLVPTFVAGKVIEEVPVTYVRLFSATLLLYFGLRLARSTRRTVLRSRKGAAASVAS
FT                   ELSEGRGLAATAFSVGATEALEAAIVILALLPESYASAALGFAVGAALVAVLAYFLKQN
FT                   ILRIRVALLKNFVSAMLLTFSAFWYTEAFYSPSDLLLIPIFAVAFLAVYAYANS"
FT   gene            complement(631547..632026)
FT                   /locus_tag="ASAC_0626"
FT   CDS_pept        complement(631547..632026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19033"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q145"
FT                   /protein_id="ADL19033.1"
FT                   /translation="MTGTLRQPPRIKVLEAAGAIADGRVQLLNTVSPDVLEAVVTSSEG
FT                   DRRYHVKVVKEGDHFRAYSDDNGTKLRGYVGYPIISVLMLAGVIKRDPEVEQALKGIDW
FT                   RRLNETYKKYAVVEDLVLKQAEARVPRERIEAYRDSVMRALRGLRIEFDGRLANA"
FT   gene            632069..632863
FT                   /locus_tag="ASAC_0627"
FT   CDS_pept        632069..632863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0627"
FT                   /product="Creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19034"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q146"
FT                   /protein_id="ADL19034.1"
FT                   /translation="MTEVWELPGSRFDSSPRSIAVIPIGSVERHGDHLPLGTDAIEAAW
FT                   VAQRVADALGADLFPTIWYGVSPALARFPGTINVETDAFIAYVRSVLKEIARNGYRLIV
FT                   IINGHGGNTTAIRVAMKDAAYSTGATFVMFDWWRDAGREALRQLFTSPGHAGEDETSAM
FT                   LYIDGAHVDMSAARAYPSGWSPSSEGEARDLKSMRNSMIYVQGVAVESQAVDQALYPYA
FT                   VLGDPTKASADRGAKWLEAVVSEIVDRVRGLAGTLGVLPPRP"
FT   gene            complement(632817..633311)
FT                   /locus_tag="ASAC_0628"
FT   CDS_pept        complement(632817..633311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19035"
FT                   /db_xref="GOA:D9Q147"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q147"
FT                   /protein_id="ADL19035.1"
FT                   /translation="MQAAQDPQGNLLSASLGRTSRLLLLAVELLIALAIIVVMVLSLWN
FT                   LLVEVEAASAQLSSGDAAAAHVTILSMVDLVIIMLLAADLMRTIVISVREGYISIRSIV
FT                   EVAMIVIVREMVASSITQQQINPVTIMELALAFLAVAAAYVITGVFRGGEEAHQGCPQA
FT                   P"
FT   gene            complement(633323..633649)
FT                   /locus_tag="ASAC_0629"
FT   CDS_pept        complement(633323..633649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19036"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q148"
FT                   /protein_id="ADL19036.1"
FT                   /translation="MGKVVKLVLDTEDFHPLHKNWMNLAQQLAKELNVELEVKKEDYVY
FT                   AISYGDKDDLGMAWLPQLFAQLENGEVKLVMSQYPFDPKTTKPSDPMALEEARKKLQEI
FT                   MKDP"
FT   gene            633777..634808
FT                   /locus_tag="ASAC_0630"
FT   CDS_pept        633777..634808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0630"
FT                   /product="Glucose dehydrogenase (GDH)"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19037"
FT                   /db_xref="GOA:D9Q149"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q149"
FT                   /protein_id="ADL19037.1"
FT                   /translation="MKAVVFNSHGGPEVLHEAEVPDPRPGPGEVVVRVRYTSLNRIDSL
FT                   VRRGYPGIKVKLPHILGSDVSGTVEEVGEGVDFLREGQQVIAAPVHGCGHCEYCLTGRE
FT                   NMCRLWSMLGFQEDGSYAELVKVPARAVIPAEGDPEELGALPLSLLVAYRSLVSVANVS
FT                   RGQYVLIWGATGGIGTLAIQVAKAFGARVIATTRSEEKAKVLREAGADLIVNTSEEDAV
FT                   SRVMEFTDGHGADVVIDYVVGTTLDKSLEALAIGGTIVVFGYLGGPVKEINWNRFYLKH
FT                   ARVVGTHTGSPWEMAKAYQLYAQGLVRPIITRRLGLSQAAEAHRVMEEGSLAGKLTMKV
FT                   DLG"
FT   gene            complement(634800..635297)
FT                   /locus_tag="ASAC_0631"
FT   CDS_pept        complement(634800..635297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0631"
FT                   /product="N-terminal acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19038"
FT                   /db_xref="GOA:D9Q150"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q150"
FT                   /protein_id="ADL19038.1"
FT                   /translation="MCQASRPLTPPNRAAWGSLVRLRPYRPEDIEAILRVEEESFPPRQ
FT                   RYTPETFDYLLSLRGSFMIVAEEDGEVAGYALGYVEGRGVGHLASLAVRPAFRRRGIAS
FT                   ALLAEAERVLKGEGAVAVKLEVRETNYPAINLYLKFGYRPARRLPRYYGDEDGILMVKV
FT                   LA"
FT   gene            complement(635325..636245)
FT                   /locus_tag="ASAC_0632"
FT   CDS_pept        complement(635325..636245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0632"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19039"
FT                   /db_xref="GOA:D9Q151"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q151"
FT                   /protein_id="ADL19039.1"
FT                   /translation="MGVGLKGGLREGLRRYFLATRPCALLSSISLALTGGVIAMRLYTG
FT                   FTIAGAAVTLVAAVGLSLFLAAENVFDDYLDTLRGVDMPGAPRITYNPHGFYSLGMSVG
FT                   QLRNYSLALFGAGSAIVALATFLPNRPLLPLFLALGSPLLFLYPAPRGFKYGGVGEIDV
FT                   LLMGILMVVGTAYAVSGALSLREVALSLPPSIITTSVLLADNMRDYKWDKAHGVRTLPV
FT                   RVGMRATSALYAALVFTSLLLPAFMVWPWGLLSLAVAPMAIYSTLIVVGVVRVQLSTAV
FT                   KFRFYTVLALTVTYLVALSLPRALP"
FT   gene            636350..638332
FT                   /locus_tag="ASAC_0633"
FT   CDS_pept        636350..638332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0633"
FT                   /product="Acetone carboxylase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19040"
FT                   /db_xref="GOA:D9Q152"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q152"
FT                   /protein_id="ADL19040.1"
FT                   /translation="MGGALDVVAVDVGGTFTDVIYVDSSGSVRLSKVPTTPRRPEDGVV
FT                   SGVRSVSPSGAFEVLHATTIATNALLGQVGLELPRTALLTTRGFRDVIEIGRQARPRLY
FT                   DLLFAKPRPLVPRELRFEVDERTLSDGTVVKEVSEPELDEVASRMESMGVEAVAISFIN
FT                   SYANPSNEARARDLLSRRFAYVTASHEVAMEPREYERTSTAVINAALRPIVSRYLSSLR
FT                   SSLGSMGASSLSVMSSAGGLVDVEEAALRPVQLIESGPAAGAIAASWLARELEVGSAIG
FT                   FDMGGTTAKASSIVGGEVQVTTEYEVGGEAHHGRVVKGSGYPVRFPFVDLAEVSAGGGT
FT                   IIWRDEAGALRVGPLSAGADPGPASYGRGGSQPTITDANLVLGRLGTSLAGGAVELRPE
FT                   LAAQALSRLGDPEGVAQEALELAIVEMARAVRLVTVERGLDPSGMTLIAFGGAGPQVAA
FT                   ELADEMGVGRVLVPPDPGLFSALGLLVADSKYEARLPFPRDLEAAFEGLEASLARRLGR
FT                   VDHFIRLLDVRYSGQGWELTIRAPADLSPASVREEFDRAHEAAYGFTLDRPIEVVAARV
FT                   FAVISRPKPRLRGPPREGEPRPVAQRRAWIGGSWDEVPIYRRESLPQGFRLRGPAVVEE
FT                   YSSTTAVPRGWTLEVGPMGVLELRR"
FT   gene            638336..639901
FT                   /locus_tag="ASAC_0634"
FT   CDS_pept        638336..639901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0634"
FT                   /product="Acetone carboxylase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19041"
FT                   /db_xref="GOA:D9Q153"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q153"
FT                   /protein_id="ADL19041.1"
FT                   /translation="MVSWEVVHRATVFIAEEMGVALRRSALSPNIRERADHSCAVVDSD
FT                   GNIVAQAEHIPVHLGSLRVGVRNLLRAMESEGVELGEGDVVVSNDPYITGTHLNDVTVI
FT                   SPVYVDGRLEGYVVNKAHHVDVGGPAFGSINPDARTIYEEGLVVPPVKIVEGGRLRDDI
FT                   LRLYLANVKYPEASEGDLRAQLAALRVGASRVRELIDRYGRGAVREGWARSIEYARELA
FT                   SSEISSWPEGTYRASDVLEVGPGEGDMVNISAEVSVSRGRARVSLNAPGQLQRPVNAVL
FT                   GVTYAASSFAIRSLMRADVPVNEGLYSTIEVEAPEGSMLNARPPAPVAAGNLEVSQRVV
FT                   DVILLAMSAALPDRVPAASSGTMMNVMLGGVDPRTGRTWAYYETIGGGSGARPNGDGVS
FT                   AVHNNMTNTMNTPIEVAEASYPVVFTAYRVREGSGGAGKYRGGDGIVRSFKVTAPARLS
FT                   IIASRFRSRPWGLRGGLPGAPARVTIVRASGRAEEVAPFSTVDLGPGDEVIIETPGGGG
FT                   YGSP"
FT   gene            complement(639898..643791)
FT                   /locus_tag="ASAC_0635"
FT   CDS_pept        complement(639898..643791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0635"
FT                   /product="Subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19042"
FT                   /db_xref="GOA:D9Q154"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q154"
FT                   /protein_id="ADL19042.1"
FT                   /translation="MQPMNLAKGLVLALVALMVISAIPSLPVASSQGPETVAVLYVPLR
FT                   DLGLVFLYAEASSTPGNPLYGHLMNSTMLSLVLPPPSQVSGNASLLQGMGFRVLGVLEG
FT                   SMILFGARLGQLEEDFGGQARYFSYMGREYFVYASYVPGMGYVYASNFTLQPLGLTSGL
FT                   QGVGPGELREAYGVGNMTGSGVPVGIVTYYGDPLLEDELRAFDAAYGLPGASMSYVPVG
FT                   PYDPNLGLYSGWAEEAEALAEAVHSMAPGSPIVIYAAWQGLPFSAIAAEVDQLNATPVV
FT                   LIPFGAPEGLVNYLGYGFYLFNFYLADAYFALGAAEGITFVAPTGNNGSLYPYGPLGSL
FT                   YYPASSPWVLSVGGSTSFVSGNLTAQSSWSAEGDLGSQAGVSGVEPMPWWQGLLRQAPP
FT                   QGFPHGRSSPDVVADASPATGLSVVTASGQGSAWGNGLAAAVVAGELADVEGYVGHRLG
FT                   LIAPTLYLMYRGTPCNASTRSAFEQAYPGYSFPWLAGRGYSVLDGLGAVNAGQLARWLA
FT                   NGSLLRAINCTVPRLLVSASLSPQGPELLPGQRLSVVASVTYYNETVSSGFVNLYIETA
FT                   QQGVVEVVPMSYSAGLWRASVTVPANASGPAMIAVEARYNGTWGIYEYEAFIGYFVEDL
FT                   NLSPGPHLGPLSMSYEVVELNGTPVNVPPLFDVLYYCYNNNTYALEGTALGGSIEVKLP
FT                   GYYVVEARPPAFASLPLVSGPLVAVGYSPEAAGGYAPSPGGCLYFTVSLKAPAEAGPEA
FT                   SAMIERGSNVTVYLASNSSGLVSTFYQAYVYYNSTLGEYWGCVRLPSYVGQGYYAVIVE
FT                   TNYSSAELGAVEGVTYGYVYVSPPLRATLKAPAYSMMGQPIRVYANVTYLNGTPARLGY
FT                   FTLSVRPVSGGPSASLPMEFNSTLGLWEATVTLPWSNGSLEGISAGQPQAWDLEVYGQG
FT                   VYSQLAPVETQVIEVPVYYYFNRTLGAGQFYPVDSYFDDVNMTFSGALYNDVFAGTDYI
FT                   VDSNVTILYSSSYGVLVIVDSNVTLAYSRLGRVVLVNSSLTMLWSNVSGLAVGPGSRVS
FT                   VVVPAYVREAVGYLQSLVADYFSQAMGNVSLVREELLGDLGRLSDELSGVRFNVSLLQG
FT                   QLYQTMENLTAAWQRLEGLRANVTALGYAINASLAYAKAMLQEANSAVSQAGYVVGEFR
FT                   SLASQLRSNVTAEAELVSALESNVSSLGRALSMAEANITGLRQNVTQLMSYQEAEASRL
FT                   SSWIGGNYTALRSQLLQLSSSVSAQGSRLSSQASSLARATAVAVAGLALAIAALALALL
FT                   HVMPRRPRRAPQA"
FT   gene            644248..644765
FT                   /pseudo
FT                   /locus_tag="ASAC_0636"
FT   gene            644804..645973
FT                   /locus_tag="ASAC_0637"
FT   CDS_pept        644804..645973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0637"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19043"
FT                   /db_xref="GOA:D9Q155"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q155"
FT                   /protein_id="ADL19043.1"
FT                   /translation="MSSAGPISVIVTAYNRRQYLPYALRSLEAQTLPRDRFEVIVVKNF
FT                   EDKESDEIIRRNGWKEVYSDEQWQGRFLLAGLEEAKGDIITFLEDDDMYREVRLEKVYR
FT                   GLGSHAMFYNLQQPIDANGREIGVRLRPREPPRELEVSDAREVVLYNLDFNASSMAVQR
FT                   RVAERARLDLVRKSVDTALAAAALEAGSIRVVPERLTLYRVHSENTSATRGLTAEALAR
FT                   KYMEYYRDYMALREATTSKVSRELLDFRATYFGSILCLGRGIEGVEVKVRPLKAVWLRL
FT                   RGWPVNRGAVLGSILCLVPADLVRALRLRRFLLPAGEEPGGSAVKAAKVLFVAPSPRRR
FT                   VHQRRWAALNASVPGPSLGQPIKDRGGLQGRPWVPGPLCRQRGLPGAQR"
FT   gene            645989..646120
FT                   /locus_tag="ASAC_0638"
FT   CDS_pept        645989..646120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q156"
FT                   /protein_id="ADL19044.1"
FT                   /translation="MDNAQDAPADDNMAVVGELAGPEEELIASLLPEFSRVKLEPVT"
FT   gene            complement(646123..648102)
FT                   /locus_tag="ASAC_0639"
FT   CDS_pept        complement(646123..648102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0639"
FT                   /product="Alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19045"
FT                   /db_xref="GOA:D9Q157"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q157"
FT                   /protein_id="ADL19045.1"
FT                   /translation="MTLELRGLAVRGPSGEEACEGAGNRFRCPSAEVEVTDDGGSLFVS
FT                   FTSLGQVDRSWPLSLSLSLRVSGGLALTNDPAPDSAYAVGFRYYNLLGTGATPSVERPP
FT                   DDVEYPPREFRGGRPTSWLYPIWLRDEGSIPPLTAGLIAFTGDEWLAAVAISSGRLTGY
FT                   LGPGPRLSVYLGSPAASASGHVLAYALSGDPYDAIAQAWARASGRAKVRLRSQKPRPSF
FT                   SRRLGWCSWNAFLGNVTEADVKATVSSLIARGVRLGWALVDDGWESLEGKSLREFSADG
FT                   SKFPGGLRGLSEELRSMGLRMGLWTTINGYWGSLSEGLAGRYPKAKVRDGHFVRPDSAD
FT                   RFYEDYLGWMASQGVSFVKVDNQVWLHDGYVDVPSAEAAGGVEEALQSVASRKGLELLM
FT                   CMALVPEAYSNFSAAATARASVDYIPFWRAGAKLHIMFSAYAGTFLSPILYPDYDMFMS
FT                   YDQGALAYAVAAAVSGGPVYITDRFPDRTNVDLLRRLTLPDGTLAVADEPGLVTRDVLL
FT                   RDPYNEDVLLKVASAASGVPVVGAINVTRRGSRVREALRPSYLPRPPTAERLAYYKSVS
FT                   GEAGVIGGSGSVNLELGELEAELLTLSPAVDGVAVIGIAELLVPPAGVTVEGNRVRARA
FT                   PGTLVYYDGALREVKVSEGDVVEV"
FT   gene            648319..648444
FT                   /locus_tag="ASAC_0640"
FT   CDS_pept        648319..648444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19046"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q158"
FT                   /protein_id="ADL19046.1"
FT                   /translation="MAIISGYMGGRGGSLWRLTLSTLCPRYTIMLRTIVLVYKGF"
FT   gene            648501..650927
FT                   /locus_tag="ASAC_0641"
FT   CDS_pept        648501..650927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0641"
FT                   /product="Peptidase A5, thermopsin"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19047"
FT                   /db_xref="GOA:D9Q159"
FT                   /db_xref="InterPro:IPR007981"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q159"
FT                   /protein_id="ADL19047.1"
FT                   /translation="MSRAHLIIVLLALILLAPQQHAAGLHVSRPSVPRLPVMPFPEAAT
FT                   ENAVGINDNGTALVNGSQVNYYYTTRSLLGVFNFYGGSFYSGPPVNANWSSVQLNANLN
FT                   VTPDVVLWAQDVIHIYAAGNGTYYVEIEDNLWNATNNLWNATNNLWNATNNLWNATNNL
FT                   WNATNNLWNATNPAVLSASGNGNISSYHGEQYYAYTYPVQFESSEPFHVYVMMNVSVNA
FT                   AMEPVIYMYFRFVNSTYDSGWVLYDTITANETAFNDNPTFLAGSVPGVASNGYPYVIQF
FT                   VTAGCGEGSTLYAYSWDASMMLYYRYDGRFYAVPGAFSLEPYNFSGGVTAENVSAVQGI
FT                   AEYYYDGLVYQLSGSSYQEALWQASASSYSPAPNEVSVNLTPAGALWVVSVMGVNVSFS
FT                   STVAVTSPQALIQVPSGEYIVTATLYAGSSPVYSFSSEVAVAGMQQVIALNVSSQTPFI
FT                   YNGQMFMAGNYTFYSQQPFVANLTFVAYMPSAGIRVLPSEVLVNGTPAHVTSLLLAVNG
FT                   NTTVVEGAVLQYYVNLSQPVPANVNGINATLTSGWYNASTRIIIYRYFYIGEAERLYVS
FT                   PEMIVINLSSPLTLPLRPVLQYYVHISLPNGTISGWYANGTVIRPPEVIYVNGSARYVL
FT                   QVGGPLVVDSPVNETPAYQLQVLVSYALPNGTAFVGWLPLGYTLRFPTTINVSSGVSYE
FT                   LVSPEEVAVTSPGAIVVEYSPRFLVTVTYANGTTRSFWAPQGYTVKLEAPAPPLHAVRW
FT                   VGTLDLPNGASVSVGEPMAEREAVTINAAEVGGLGAAAVAVAVVAVALLLLRRRP"
FT   gene            651099..652055
FT                   /locus_tag="ASAC_0642"
FT   CDS_pept        651099..652055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0642"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19048"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q160"
FT                   /protein_id="ADL19048.1"
FT                   /translation="MISGIRRIGKTSVLNVALSEVNAVTLIIDCRTLRPNYSRAELYSL
FT                   FSEALSSRLDRVVDLLRGLRGASIMGSGVELRWRGRDSVSLADLLDRLNSRRAVIALDE
FT                   AQRLRRPLSTEARDAIAHAYDYDRNVSLVLTGSEAGLLYDFIGLKDESSPLYGRYFREV
FT                   RLERFSRGQSVEFLRRGFDELGVEVSDDVIEGIAEYFDGIPGWLTFAGLRVAEGRGLED
FT                   VREEAVKVAEGELLDLLRSRAFTPEVTYRRYRALLSCIARGSDSWGKVMSCLGQELGST
FT                   LSSSVLDNMLRTLERLSIVKDYRFLDNVYREAALRLR"
FT   gene            652248..653804
FT                   /locus_tag="ASAC_0643"
FT   CDS_pept        652248..653804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0643"
FT                   /product="Sugar-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19049"
FT                   /db_xref="GOA:D9Q161"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q161"
FT                   /protein_id="ADL19049.1"
FT                   /translation="MRSSLSTAAIAAIVIVIVVVAAVGGYLAYVSTRHHVTTTTPTTTT
FT                   TSVTTPITTTTTTTVTTITFYTWWATTGRVALDHLIPAFEAAYPQYTVQKEIIPGAGGT
FT                   NARYAIMGMIIAGRPPDLFQSLLGANMLSYAEAAPQGVKAFLNLTPALKSMGFLNPSVV
FT                   SLPIIEAAAYNGTTLNAPVSVHSGFVLYINMKVLRQYNLPLPTNMSTLIYDTVQLAEHG
FT                   VTPWMVPGADGGYDQEQLWFAIFLSLGGPRLLDEVLYGTVNFSSPTFWSVFNETNRLFL
FT                   NFTSYNYPAWRSMTWSQGIADVALGKAVFEVDVDSATNYLYDFDNITVYPATEPYISWP
FT                   NVTVVAEPFPGTQDYFVVVSDAVAIPVSPYQEAALTFMKYWLSYSGQQAWTRWKAVTYY
FT                   LNGTDWYNTPQQWWMYQHLVNLSRTAPQNFVIDPLSLFADTDETIYSGLLALQSTGPSY
FT                   LQGWTSMFENAMHEECEEWLTGAKMGLGYLGLPGEPFGGYVPPWVNPSTFTFTSNYTCL
FT                   S"
FT   gene            653801..653950
FT                   /locus_tag="ASAC_0644"
FT   CDS_pept        653801..653950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19050"
FT                   /db_xref="GOA:D9Q162"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q162"
FT                   /protein_id="ADL19050.1"
FT                   /translation="MTVGLKPLYLVFNFLVSPSISSFFFLFFVPSGSRCQPLAAPAALR
FT                   HLKL"
FT   gene            653989..654675
FT                   /locus_tag="ASAC_0645"
FT   CDS_pept        653989..654675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19051"
FT                   /db_xref="GOA:D9Q163"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q163"
FT                   /protein_id="ADL19051.1"
FT                   /translation="MKALRVAHGLMSLGLLTVALSALTLDLSPALLTAVALGLATVFAA
FT                   NFALWRPRSPASVALAAALAAAYALAGPRVLAASVPAGVAMLSSWALELARRRDASTVL
FT                   GSLGVSLLILPLASLGRGVPAGIAIAWASSALAVSLAALGVVKEANRARATALSAVTAA
FT                   AGAALDLALGCHACALALAPPAALTAALSRTSLRDLGPRPLRRLGVISAAASAASFAVL
FT                   AAVELL"
FT   gene            complement(654903..655340)
FT                   /locus_tag="ASAC_0646"
FT   CDS_pept        complement(654903..655340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19052"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q164"
FT                   /protein_id="ADL19052.1"
FT                   /translation="MVSALRVRVRLTRHDCEVAKALGGRGGFSIVRMSASRGLSTHLVE
FT                   VEDEEELRGLRRVKIGRSLYLVTTSSCSACRALSELGVIVLGGRSEGGDAVVYDIIVHR
FT                   NRLGSVLEALEQRGLSPRVLSREPYREPALSQAQLAALLTA"
FT   gene            655410..657632
FT                   /locus_tag="ASAC_0647"
FT   CDS_pept        655410..657632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0647"
FT                   /product="Nitric oxide reductase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19053"
FT                   /db_xref="GOA:D9Q165"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q165"
FT                   /protein_id="ADL19053.1"
FT                   /translation="MSLRRDALPVLLAIIVVFAFSGALFAYTFSRLPPVPPAVVTQNGT
FT                   VLFTRQQVIMGKYYLQKYGLMDYGSIEGMGAYFGVDFTSYTLELYELYLAQRLNLTVSY
FT                   KGGVPVLPPSEAAEVKRLILDPGGTMSWGRNYTVSDYMLGAFNYAVDLYSQYLGQNSSE
FT                   LRLRPDFITNRTVVRDLVAYFTWSALISLNNYTQGFPYMPGLTSPSTNAWAATMIMIAA
FT                   ILAVGFPVGAFIVRDLVSHWNDPLLKVDLPSPGPAQRAVIPFMVLLMVAAGVQGLLGTY
FT                   LMHLYATQSLYGLDLIGLLPFNVARALHIWLAIYWIALTWVAFSLFVLPYFGVELSRRK
FT                   VIAIMGFLSAVAVASLAGVWLDYLGYVPFSSGPVEPWFMFGAEGRDVIEVGSLWLLLTA
FT                   VGVFYLSYLFHRASRLAAEPLRPFASVLSYVLAGFGVGVVVGALPVVRPWPYFTEDEFF
FT                   RWIFIHAAVEGFWPSIVITVLAVLLVVRGLIPAGLARSVVMIDAVTEVITGMIGAAHHY
FT                   YWTGFPAVWMYVGAALSILEAIPLGFAMAYVVLVARRAGTLGTLTSFDRTLLTLVLVAG
FT                   IGGSMGVVFLGAGLINAPIVNYYVHDLQYTMAHAHAAFPLAYGLPSITMWFVALYLAGH
FT                   VRESHLKYIRLGAIGYGVGFYLQALLSLVPLGVLQTVYELRYGFWYAKTVIVPSVGLDP
FT                   APGFWETRLAQLFIWLRMPGDLTAAASFAIIVVPMALDWVLSRRST"
FT   gene            657695..658048
FT                   /locus_tag="ASAC_0648"
FT   CDS_pept        657695..658048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0648"
FT                   /product="hypothetical protein"
FT                   /note="DUF488 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19054"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q166"
FT                   /protein_id="ADL19054.1"
FT                   /translation="MVARVYESREAGGCLAVLAERLWPRGVSREELKVDVWPKELTPSD
FT                   ELRRWFSHDPAKWEEFKSRYFRELDSRREAVKELCSRIRERGCAVLLYSARDREHNSAV
FT                   ALAEYLQRACQEA"
FT   gene            658338..661424
FT                   /locus_tag="ASAC_0649"
FT   CDS_pept        658338..661424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19055"
FT                   /db_xref="GOA:D9Q167"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q167"
FT                   /protein_id="ADL19055.1"
FT                   /translation="MTAAYFRELRGPAAAPIAIAFFFFLLLFLLVPLALPGPPSRAQGG
FT                   GGVTIITGPTNITRPGYYELAGDVSCAQPSGIAIGVLADNVVLNGSWHQLRGCGDGTGI
FT                   YIRGDNVTVVDLTVLNYTYGVRAFGDYITFDYLVVNSNFSVEAAGSHITLNNTWDNYIF
FT                   AGPWFAGGYGINVSGSYIVMRNVSSTSRLRGYGIVVSGDHVSLTGSKDIVDNNTLYFEG
FT                   DYINISDVSVVAVGNGTGVRVRGSHVMLSDVNVTGSTHSYYYAPTVGINVTGTDIALEG
FT                   STLLDNNIALYVDGSNVSLVDVGMYDNLWQNGTGLVALGDNISARNLTGVWEADDVIFS
FT                   GQGLTINGSLLKFFKDGVVAHGNNVVVARASMTYGTNGTVIVGDGPLLYGDSVSVSTDA
FT                   INVTGNDAEILYDNTSGGAGIIVKGDSPELVGDVIYGPGRWGLNVTGSHPVIRDTKALF
FT                   ALTVNVTGNDAYLAGDNFTYPMVFISGSSPTIVNTTLLSSLGLFISGDHVNMTGVSISV
FT                   TPLNNGTGLSIDGNDLHLEGVLLYGSTANISGYNVTVVDSNFTFGQSAVNRVPPFTLLR
FT                   YYGGNLTIVNTTLYNPFGACLEADASDVTVVGSRLLYGWWDIYMVGDNLSVSGTELLGA
FT                   KYGIYVVGSHVTLNDDNISEDGYGGVNMTGDYLVVENSTFFFDWGGIPPSGYGVYLNGS
FT                   HATIAGSNFTDDVNDVVIVGDDVTLANSTLANTVFSLAGQPDSFIARYGVGLVLVNSTG
FT                   DLVYNNVFNNSRNVVMVNSEAAFYVSPRPGTNIVGGLVIAGNAWLSPFGGGFSQVTPPL
FT                   PFDPYLCDAPYVNGSVVDLYPLRYPAAAPARLYRVTFTESGLPPGTAWSVDVNGTTVSS
FT                   NSTSITLLMAAGEYYYSVGAVQGYEPSPPSGVVGVAGPAAVTISFTASTTTTTTTTNTT
FT                   TAPPPTTTTTSSTSTTTTSSAATATASATTTTSTSSTTTTSSAAATATTATSTTSTSVS
FT                   SATSTAPPRRPALTGLYVGVAVVVIIIVVVAAVLLLRRR"
FT   gene            661549..661704
FT                   /locus_tag="ASAC_0650"
FT   CDS_pept        661549..661704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19056"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q168"
FT                   /protein_id="ADL19056.1"
FT                   /translation="MITAINVPKRHPAASRAPETTGEARGRAIVGRPATSAAAAASTTA
FT                   GAPRAR"
FT   gene            complement(661812..663137)
FT                   /locus_tag="ASAC_0651"
FT   CDS_pept        complement(661812..663137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0651"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19057"
FT                   /db_xref="GOA:D9Q169"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q169"
FT                   /protein_id="ADL19057.1"
FT                   /translation="MAGAPTNVAIVLCDTLRRDVLDVYGGTVSTRPLLEALGNRAIVYT
FT                   GYSNSFWTVPSHFSLFTGLQVDRHGVHEGPNRNTLMSVSGLGRSFSGHTLASELKRRGF
FT                   YTIGFSANSLVSYISGLNKGFECLAVNDSWLIYGPLFTPIIALNNLKIIEELGAKHRGR
FT                   LKYLSAFLDILKNKGVSGAASITALYFKVRLLRALSDYVADKGYTDAISTVLWDVKGEP
FT                   FLLFVNIMEAHEPYYYNDPYFINNAKWDYKIISCARCVRREFKGYLKGASTCVRAAAEI
FT                   ANVLRSKGLLGRTLFIFTSDHGQEFAEHGAIGHNSGHLYEENIGIPIIVKPPEGMKLSR
FT                   SDCYVGLHELYGLAMAAASGDREWAPSCGPGLAESYEAVAPDPNAGRGIRRVAVFLGRH
FT                   KAVFRLNDDKVEEVAEAGRPLDLGSDKAKGVIDELRGHLPSS"
FT   gene            663485..664315
FT                   /locus_tag="ASAC_0652"
FT   CDS_pept        663485..664315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0652"
FT                   /product="Peptidase_A4 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19058"
FT                   /db_xref="GOA:D9Q170"
FT                   /db_xref="InterPro:IPR000250"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR038656"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q170"
FT                   /protein_id="ADL19058.1"
FT                   /translation="MNPRYLALAALVILLAAAAPHGGGAARAQAKLYPRLPLRGSTSES
FT                   LNWAGYADVLAPHSFISVNASWYVPDVQCSPRSSDVAVWVGIDGFNDSTVEQTGILVQC
FT                   QGGRAYYSAWYEFYPASPVYAPSSYVVRPGDKVVGWVIYNTSTGEYRTVLVDVTQGWNF
FT                   TSPWTAVSGAEDSSAEWVVERPAVGGSLTTLADFGTAYFNVKYTGVLPPGGVYVRLANG
FT                   SAGNISSFNYYEMIMVNDQGKVLAQPSGLYAYGSSFYVCYGPCGSSGSGGHHGK"
FT   gene            664634..664768
FT                   /locus_tag="ASAC_0653"
FT   CDS_pept        664634..664768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19059"
FT                   /db_xref="GOA:D9Q171"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q171"
FT                   /protein_id="ADL19059.1"
FT                   /translation="MGPGRIRALREFIKYIKSFDDVWMARRDEIAEFWVKNFGKQVPG"
FT   gene            665034..665297
FT                   /locus_tag="ASAC_0654"
FT   CDS_pept        665034..665297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19060"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q172"
FT                   /protein_id="ADL19060.1"
FT                   /translation="MQALSYVTRSREVLRLYRGAYSNWPLVLLNLVLRGRAKARTRLGV
FT                   ELSGDAALLGLVARLMAVENIATEVKRRLIEMASQNGARQKG"
FT   gene            665396..666025
FT                   /locus_tag="ASAC_0655"
FT   CDS_pept        665396..666025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0655"
FT                   /product="predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19061"
FT                   /db_xref="GOA:D9Q173"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q173"
FT                   /protein_id="ADL19061.1"
FT                   /translation="MLYFWHNIQFLADLNDYVMLNVEGRSVLDVGAFVGDSAIYFALRG
FT                   ARRVVAVEPSPWAFQAAKKNVEVNGLSDRVTLLNCAVGRDEGKALRLAESETNTVFSAE
FT                   RADGSGSYEVPTCTIDSLIEKYGPFEVLKVDCEGCEYGSIPYSKRLGELREVLIEYHDG
FT                   YEPLAKKLGEEGFEVMYSGHYSGGRLAHKPFDPKLGYIYAVKKRQG"
FT   gene            666518..666850
FT                   /locus_tag="ASAC_0656"
FT   CDS_pept        666518..666850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19062"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q174"
FT                   /protein_id="ADL19062.1"
FT                   /translation="MRDSGGFSTVSSTSPGNEGCWVPAVSLESLLSEVRSPYLLKVDCE
FT                   GCEADLVSREPHAVEAFKYIILKSHPHVTGIPHERLISSIEGLGFTCRRLGVTVSDATT
FT                   FYCTKR"
FT   gene            667131..668666
FT                   /locus_tag="ASAC_0657"
FT   CDS_pept        667131..668666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0657"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19063"
FT                   /db_xref="GOA:D9Q175"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q175"
FT                   /protein_id="ADL19063.1"
FT                   /translation="MSLRARVFRGAAKLLSASTFVTLLQFAFYITIVRVLGLQGLGAYF
FT                   DTTILWTLTGFALTWPAQGFNRFVTGEYQAGRVERARHLYRLGVMIGLLGGLSAATAFI
FT                   VLAPQAAALMFRSAHYAGLVRVLAVDMVLSSYNSYAGIGLGATMRFGKISLVQVLWALA
FT                   RYLTGIALLIAGYGPLGLIAGWVAGDLVNAVFNTYWSRDLLLGPTSAHPLRPVIKFAAP
FT                   LALSGAVVSVLQSFDRIFVLAKLGLAELGSYSTIMLASGVPQMLPGAIAGALGPAMIGL
FT                   EERGELRPEAVEKAVRYITTLSIPPLLLIAAVGRPLVLLFLGPSFVHDWEAFTILTVGH
FT                   SLMTYDIPISMVLAAKRDSKALAMQSVVTAATIALLAPPLIDLWFAAGAAIAYVVARLV
FT                   GFLAVAMPRVKRYGLLRVDLGDYARLALASIIVFAGTLSLGLATGLRLVLLPAYIAFGL
FT                   ALTWASVRALHVLDADDYGALMEALPAELHGVMSRLWRGLGLPLPNGYLDDAR"
FT   gene            668789..669346
FT                   /locus_tag="ASAC_0658"
FT   CDS_pept        668789..669346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0658"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19064"
FT                   /db_xref="GOA:D9Q176"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q176"
FT                   /protein_id="ADL19064.1"
FT                   /translation="MPFEFERLDIPDVVLVKPKVFRDQRGYFMETFVAKAFEQAGVKFN
FT                   VVQENQSYSRRGVIRGLHYQRGQWAQAKIVRAVKGEIYDVAVDIRPWSPTFGKHVAVRL
FT                   SEDNGYALYIPRGFAHGFQVLSEYAIVVYLVDNDYAPQAEGGIRWDDSDIAISWPISGP
FT                   VLSEKDARWPTLREALQGGFIP"
FT   gene            669356..670207
FT                   /locus_tag="ASAC_0659"
FT   CDS_pept        669356..670207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0659"
FT                   /product="DTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19065"
FT                   /db_xref="GOA:D9Q177"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q177"
FT                   /protein_id="ADL19065.1"
FT                   /translation="MGERYLVLGTGQLGSELVGLLRGEREKGKDVAYTYHGSDPFGFGQ
FT                   QLDVTNFELLEDLIIKVSPDVIINAVAMTNVDACESDRARALKVNAEAVKHVARAVRVV
FT                   GSYMIHVSTDYVFDGTKGLYREDEEPNPINYYGLTKLLGEAYALSYDDSLVVRTSGVFR
FT                   DKGFPSFVVRQLRQGRAVKAYAGFYSPISARKLAEAILALAELRKTGIINVAGERVSRY
FT                   QLAVEVAKAFGLDPSPVTEVKEVEGWVAKRPYDSSLDISRARALLNFDFYSLRENLRHA
FT                   VV"
FT   gene            670209..671252
FT                   /locus_tag="ASAC_0660"
FT   CDS_pept        670209..671252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0660"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19066"
FT                   /db_xref="GOA:D9Q178"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q178"
FT                   /protein_id="ADL19066.1"
FT                   /translation="MEAVVLHGGQGTRLRPLTHTGPKQLIKVAGKPVSQWVLEQVRDAG
FT                   IKDVIVVLGDNNPQRVVEYYGDGSWLGLRIRYLYQGRARGLADAVYRVKNLVGDRFIVY
FT                   LGDNVVPYDLKRLLSFRGSASILLARVPNPQRFGVAVLKDNRVVRVVEKPREPISDLAL
FT                   VGVYGFTREVFDVIEGLKPSWRGELEITDAIQGLIDRGREVTYDVVDGWWKDTGTPEDI
FT                   LEANMVLLDRHATRSIRGLVSNSRIDGRVIVEDGAQVVNSRVVGPAFIGKGSVVRDSYL
FT                   GPYTMVGDGCTVEDSEVENSVILDGATVAGISLRDSIIGQGSRVARGNGKPKATRLIVG
FT                   ESSVLEV"
FT   gene            671256..672233
FT                   /locus_tag="ASAC_0661"
FT   CDS_pept        671256..672233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0661"
FT                   /product="DTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19067"
FT                   /db_xref="GOA:D9Q179"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q179"
FT                   /protein_id="ADL19067.1"
FT                   /translation="MTETVRVAVLGGAGFIGSAVVRELNRRGMRPLVFDLLTYAGRPEN
FT                   LQGTDHEFVRGDIRGPELHEALSRFRPEVIINLAAETHVDRSIYSPQDFVTTNVIGAVN
FT                   VLEAARRLGVRLLHVSTDEVFGDASVYGCADESSPLRPSSPYSASKASAEHFVLAYVRT
FT                   YGLEALVARPSNNYGPRQHPEKLIPKAIIRTLLGLEVPVYGSGLQRRDWMYVEDTARLL
FT                   VDLALKGEAGRGYNLPGGHVATNLEILGLIGRALGREVKIKHVEDRPGHDVEYCMRPSF
FT                   SYWTTPLEDGIGRTVRWYIENQEWWRPLLGNKFFVNEVPWRSVG"
FT   gene            672215..673459
FT                   /locus_tag="ASAC_0662"
FT   CDS_pept        672215..673459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0662"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19068"
FT                   /db_xref="GOA:D9Q180"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q180"
FT                   /protein_id="ADL19068.1"
FT                   /translation="MEICWLRLFSLSALSSLLPVVYILAVVATQRGPVVSSKSLVSVIV
FT                   TAYNRKQYLPHALRSLEMQTLPRDRFEVIVVKNFEDKESDEIIRRNGWKEVYSDEEWQG
FT                   PFVLAGLEEAKGDIITFLDDDDMYREDRLSYIYRAFASSRDVVYFHNEQVIINEEGKVI
FT                   SDKSPLPAVKAQRDFVLSSSLLSKVEDRLGICYYQLLPLLREFGPYFDFNSSSIAVRRE
FT                   VIDKEKLKPLEVGIDNMLFALALRLGDERSLLYLTGVPLTYYRVHGNSFSAKAYGKIKA
FT                   SHFKDLRLVEKVMSLLKSNRAASRVAGELPEGCKCNNYELFAAYLRLEALYLPTRLARE
FT                   LSQSLVLRPSEILRFLRCDLVNSALSQERSATSLVMHEAWSLMYMTLSYVLAFIDRVAP
FT                   RSSEVPLRLRGRLRR"
FT   gene            673629..673772
FT                   /locus_tag="ASAC_0663"
FT   CDS_pept        673629..673772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19069"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q181"
FT                   /protein_id="ADL19069.1"
FT                   /translation="MQTLPRDRFEVIVVKNFEDKESDEIIRRNGWKNSFSEEGSYGKLI
FT                   LW"
FT   gene            673837..674688
FT                   /locus_tag="ASAC_0664"
FT   CDS_pept        673837..674688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19070"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q182"
FT                   /protein_id="ADL19070.1"
FT                   /translation="MYEPQKLSEVYKVFEERADITYFHDTRKYMILNKLIFDGINKQAA
FT                   YEDTWLEGAIGYLESITPTDQDVLVDPKDSGAAGYLLKYHGMVATVSLMAVRRSCLDRW
FT                   VHILKDIEISAERAIPAIAAECGKLYHMSRRLTVYRFHINNSSIGLDAPGRLRALRNLS
FT                   RAVEDHERLLGTISPRNPMRTVIANDMLSAKLTLFLADKELRKELNVRSGPREKLDVLR
FT                   SWCNLNNMPLKDCMIFATSLILPDGLRRALGRLLTYYIERKGAATLQASRAMGIGLRGP
FT                   ST"
FT   gene            674706..675620
FT                   /locus_tag="ASAC_0665"
FT   CDS_pept        674706..675620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0665"
FT                   /product="methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19071"
FT                   /db_xref="GOA:D9Q183"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q183"
FT                   /protein_id="ADL19071.1"
FT                   /translation="MVPCDGQKLNLRPSELVALGDLVRRGLVEFSGCEVIFNVNGAKVH
FT                   VPISEVMASNGGLAAIRKAILHGWLFRDDRWSKDGVSFVHMHEEILGTFDDEEYSFLEV
FT                   NNRPVIDVGAYIGDTALYFVKKGASKVIAVEPSPGAFKELTDDIIKINGAQAKVVAVNA
FT                   AIAEAGPVPISKDAADVKGARVRWVGRSKVERKDDTLTSVKAMGLYEVVKLYGVDNAAL
FT                   KADCEGCEYHIAMREPEALSGFEEIGLEYHAFNSGIPVSELIRALSNAGFVCERANDWV
FT                   YLKNAGSSWNSEMIGMLHCVRRR"
FT   gene            complement(675617..676771)
FT                   /locus_tag="ASAC_0666"
FT   CDS_pept        complement(675617..676771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0666"
FT                   /product="Predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19072"
FT                   /db_xref="GOA:D9Q184"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q184"
FT                   /protein_id="ADL19072.1"
FT                   /translation="MEQRRKIAFIVPGLFIAGGIRVALALANALGEHFDSKVVSPEPGN
FT                   PWPQYKVPIVSPKMPPILGSLLNFGKRVSGRKGKAGLPTLDFVIQRLTGFRLDEQRALL
FT                   GLLKDFDVAIATWFPTAFIALQSDAKPMILLQDFPELVAETMGNVGLRLFKAVLRAPLG
FT                   FLSISSYITEIIKSENPSAKIYYIGNGVDLDTFYPRKVTRGDEPLVSVILRRPRFKGSD
FT                   IAVESLNLAAMRTTFKAIVISEFPEDEFRLKFRPRFPYVFYQSGVSDEELARIYSSSDV
FT                   FLFTSRAEGFGLPPLEAMACGTAVVSTNAKGNMDYMVNGYNALVAKTFDPGEIADLLVQ
FT                   ALDNRELRQSLAQGGLETARRWDFRLVVDRTRRAIEEELQRQGD"
FT   gene            676996..678171
FT                   /locus_tag="ASAC_0667"
FT   CDS_pept        676996..678171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0667"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19073"
FT                   /db_xref="GOA:D9Q185"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q185"
FT                   /protein_id="ADL19073.1"
FT                   /translation="MNSTDNLQVSVIVTAHDRRRYLPHALRSLEMQTLPRDRFEVIVVK
FT                   NFEDKESDEIIRRNGWKNVVTDVVPLGGKIAIGLEEAKGDIITFLEDDDMYREVRLEKV
FT                   YKVFTLHRDVIYFHNEQVLIDERGDVISDESLFPAVRDRGDYVIRSSLLSKVERKMGVC
FT                   YYQLLPLLKAFGPGLGLNNSSIAVRRGVVSADKLKDIEITVDIELFASALKYKGEASTL
FT                   YFTGKPLTYFRVHEDNASSIAFNTAFGKAALLNQLNNEAYLVNRVKWLLKLARWHGFVS
FT                   KELPQECVCNAYGFSSTIARLEAIYLPMPLARTLSQSLTPPASELIKIAKCAVTNFALS
FT                   SSKESVKILGTLRFLAFLLMPYVLVLVDRAFPHNSGVPLYVRRALSFLRSR"
FT   gene            678269..678430
FT                   /locus_tag="ASAC_0668"
FT   CDS_pept        678269..678430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19074"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q186"
FT                   /protein_id="ADL19074.1"
FT                   /translation="MHKRRRQYLPQALASVLAQEAGDFKLETVVMADYEDNTSGLATGV
FT                   RWVSVDNE"
FT   gene            678423..678623
FT                   /locus_tag="ASAC_0669"
FT   CDS_pept        678423..678623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19075"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q187"
FT                   /protein_id="ADL19075.1"
FT                   /translation="MNESLGAKIAEGIEESKSEVIALLEDDDVWLPGKLRFVASRFKEV
FT                   KGLAFLHYLHLTTLGVIYRSP"
FT   gene            complement(679295..680503)
FT                   /locus_tag="ASAC_0670"
FT   CDS_pept        complement(679295..680503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0670"
FT                   /product="putative glycosyltransferase (group 1)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19076"
FT                   /db_xref="GOA:D9Q188"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q188"
FT                   /protein_id="ADL19076.1"
FT                   /translation="MESLNINLVIETNQRGTYATTKVVFQKLRERGHEVRLWTTFPSEF
FT                   NVLPRPPSFKPFGYDVAVNLPTYARKVLKVINPPKDSIVHSMNAMHELAYLAHGQGVKS
FT                   AIAVHYAWPICYFNAYSYNACDCTSSVLEAAKCIYSRRRGPRKAFALGEALYWKLKRSW
FT                   IRRNLMGSSAILAISKFTKELLVKAGYEEAKIRVVYISALMPYNIEYSPYEPSDAFTFA
FT                   YLSYPDEGKGIFQLIKAFALAIKANPKLRLKIYGGLTNPDVVRLVGELGIRDKVELTGW
FT                   APFENFVSSLEDLLRDVDVVVVPSMVFETWARVVTEAMLSGRPVIVTKGNGGLVEQVED
FT                   KVTGFHVNVYKVEEFARSLIEISSISREELRNMGLRARETALAKWNQERIVDSLEHFYK
FT                   ELL"
FT   gene            681148..681372
FT                   /locus_tag="ASAC_0671"
FT   CDS_pept        681148..681372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19077"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q189"
FT                   /protein_id="ADL19077.1"
FT                   /translation="MVMTKNLGSLSYARHGYNSLIVEERSPETVASAVSQLLDNPALAD
FT                   ELPLNARRTAANFRFEDFMKRFKACVGLP"
FT   gene            complement(681398..682381)
FT                   /locus_tag="ASAC_0672"
FT   CDS_pept        complement(681398..682381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0672"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19078"
FT                   /db_xref="GOA:D9Q190"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR038013"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q190"
FT                   /protein_id="ADL19078.1"
FT                   /translation="MALDTVESLFKGGFRVTLVTRRVGSWFLRRLLSMGSVQVALRRPL
FT                   PTSTANIILDAVQSFPSDCGLRFNFHGDVQPVDADIIYFHQFNVDYGFRSSARVRLKLL
FT                   PQWEIRRRFLERVKENNRLVLVNSTFTMAEARHFWGLTNVEVLHPPVHVERYSDWPDGP
FT                   RPRRVATVHRLDDYMLKVIKEVASSLDYEFVVMGSVKNVSSLKELSRLPRNVKVIPNAD
FT                   EPTKKAYLQASRAYFNANMFVEGFGIAVVEGMAAGALPVVRNVGGHLDYAPEDYMFNGI
FT                   DDAIDKVEKAVESWDYEKASLMRSIAQRFSLGAYTDRLINIITKFL"
FT   gene            682521..683513
FT                   /locus_tag="ASAC_0673"
FT   CDS_pept        682521..683513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0673"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19079"
FT                   /db_xref="GOA:D9Q191"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q191"
FT                   /protein_id="ADL19079.1"
FT                   /translation="MVAVASQGLCLYGTVLNSVDTVERSIRSVYRPDAEIVVVDGGSRD
FT                   STYERLLEIAKDYNVKVYRLPGSSRGRGRDYALRMCPEGSYAAYFDLDDEYNAYFHRAI
FT                   EWGMATGSQRPLYYLVKRDYAVARGGWRDLNVAEDVEFFARVGLDFHVPVLFRRPLSGP
FT                   RRGSLMGDARRYVRGTLGAVSRSVRNVVDLIRGNGFKYGELASLPYIRRRPYLLVAPVP
FT                   LIYTMALVKGIYRYDPLLNNHDLMFKYMVSGLVDPIKEVGADDDHAVFSVPLSTASRLG
FT                   FNWVVAKVRSANLKPYTCSQGGSKVLIGVTSSGALASVGFRDCDEVDSP"
FT   gene            683510..684322
FT                   /locus_tag="ASAC_0674"
FT   CDS_pept        683510..684322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0674"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19080"
FT                   /db_xref="GOA:D9Q192"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q192"
FT                   /protein_id="ADL19080.1"
FT                   /translation="MTRVSVVIPTLCRPELRDLLSSLGLQRRRPDDVIIIYACETARLR
FT                   PLIEDEPLPIQAYPQRGVGVTGAVNQGLESAEGEIIVIIDDDAVAPSPLLLKYEELLGR
FT                   LPRAFAGACSRDILYERDRGPVKGPDDSALVKLYRRLYVANLVRPYPGLEAFARGVFVD
FT                   RGLRVRHGPCIPNGDCISLPFRAVNMALRKEAVDGLRLPEDRDLGAARGFEQLLGVMLA
FT                   AKGYLYAYTSGNPVYHLHHASISRSHRSEAEERAMRRYMAEALSRLNG"
FT   gene            complement(684311..684451)
FT                   /locus_tag="ASAC_0675"
FT   CDS_pept        complement(684311..684451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19081"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q193"
FT                   /protein_id="ADL19081.1"
FT                   /translation="MFSISQDLGSIVTNLAGRARGPFSGRAKLPTWDEQASRLLDFLSS
FT                   V"
FT   gene            complement(684512..684766)
FT                   /locus_tag="ASAC_0676"
FT   CDS_pept        complement(684512..684766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19082"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q194"
FT                   /protein_id="ADL19082.1"
FT                   /translation="MIITLVDDTDLSVPGKGQQVRTYELYSRVARKAEVRLVTQGASHP
FT                   ERLAWASELRVVRPLPGRAAAWVGGISSLARNNGGYQRL"
FT   gene            685078..686814
FT                   /locus_tag="ASAC_0677"
FT   CDS_pept        685078..686814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19083"
FT                   /db_xref="GOA:D9Q195"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q195"
FT                   /protein_id="ADL19083.1"
FT                   /translation="MTRQGRTSLITLAIAVLLALIIYYVVIFEEVGNEVFGVSDVYGPL
FT                   SHATALGVIGTLITLLSLMMAFYAALSESFSSRWTALIIVMSALTVVSVRFLVPDLADR
FT                   YYITDFEDSFNHMFRAMYIAEYGHLTPWPDFMWLNRSLWFTLAEAILVLWGHPTWFKDP
FT                   PFYFVIKWVPELMSLLMAPATYLLARSLGLSRRAAAVAIPLSIVLWSDIPESVSDHYGT
FT                   VTFTIAAATFVLALRERDRRSLAMLLVATLAAVYTHELIAALAGVAFFGGGLLYLMFPG
FT                   KSNSRTFTAKALLTVTAAYLIMGVYDSYGFVQQGIHYYWSLTISTLRRLTSRAPQLIYQ
FT                   ATVRAMPSYHVAVEVKAAAYIAELLIPFAIAVALSLRRPEHRALMGALGLSGLVGAALT
FT                   LGLGAVGWADRVPLMFIGVLAVILASLVEVKSHRRAAVAVALAPVIVLTPLCLYASFAG
FT                   YPAVAFPEVGWDLGIWWIVTSNGEPALTSNFTVAVPGELAPNTIIAYWLPPIPAEEWCN
FT                   ETLSESWFTPGYMGFYYQPYSVYSAYSSCSDYLKLYSNVLLAEYNNSIVIDAPVGFLAL
FT                   MR"
FT   gene            686864..687937
FT                   /locus_tag="ASAC_0678"
FT   CDS_pept        686864..687937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0678"
FT                   /product="Glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19084"
FT                   /db_xref="GOA:D9Q196"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q196"
FT                   /protein_id="ADL19084.1"
FT                   /translation="MRIVVARRDSLTHMDGVTRFTATLAKGLALLGHRVALMSWGLLDA
FT                   PNGYSDFNDYLKGVYGIESIDVLTIRGHVSSHPEPRVSIDWLLRGSRVLREWDADAIII
FT                   SGVAPLTFRPRVAVLHNVTRLRSRVARWLYRRLYKSYDVVVCVSKKSSSEALSAGVRCG
FT                   RVIYNPVDLKPFRPRGDREPLVVHIGTRGEKNVDISIHAVKMMRDRGYNLRLAVIGPGA
FT                   SNSVKNFLGEVPEWVLPLDNASEEVKADMLSRSKALLLPSSYETFSYVAVEAMASGTPP
FT                   IVSEAVPEEVVMDGVNGLRVPELRPEAFAEALARLINDEDLWWRLSEAGVNWAKRYDYM
FT                   TVAKEYESLLHEIINKG"
FT   gene            complement(687962..688099)
FT                   /locus_tag="ASAC_0679"
FT   CDS_pept        complement(687962..688099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19085"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q197"
FT                   /protein_id="ADL19085.1"
FT                   /translation="MAAAIITIYNDSGLAYKLGLKGRDGVYTWNQVTDKLLSLYAAGKA
FT                   "
FT   gene            688297..689433
FT                   /locus_tag="ASAC_0680"
FT   CDS_pept        688297..689433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0680"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19086"
FT                   /db_xref="GOA:D9Q198"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q198"
FT                   /protein_id="ADL19086.1"
FT                   /translation="MSSKGLISVIVTAYNRKQYLPHALRSLEAQTLPRDRFEVIVVKNF
FT                   EDPVSDSIIRRNGWKEVYSDEQYQGRFLLAGLEEAKGDIITFLDDDDMYREDRLEKVYT
FT                   TFKSVTDVVYFYNSQKPIDEQGNILYTQLKSSATERLYLVKSRALLKVNQRLGLCLFEE
FT                   PSLIRVIGLHDFNSSSMAIGKAVLEDYKENLRSLKLALDFFIGSVARNSEGLLAIYMGQ
FT                   LTYYRLHQKNTSSFSNAWKERSKRLEALYREALYQIFYINGNQLIGNLYPKSCRCNRYR
FT                   LFAVGSKLHLYAIPLKELRYVYNEFPTSLKELYGYLRCAIKLKQLHDENKARAAMSSII
FT                   LTFGSLLLWIGGYMPITPLRRSLYDLAGGVTRKIYYAI"
FT   gene            complement(689519..690640)
FT                   /locus_tag="ASAC_0681"
FT   CDS_pept        complement(689519..690640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0681"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19087"
FT                   /db_xref="GOA:D9Q199"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q199"
FT                   /protein_id="ADL19087.1"
FT                   /translation="MRIVHVVHSYWPAAGGIENVVRALAEGMASRGHEVHVVTAAYGGR
FT                   PREEVVNGVHVHRAKSIRLGFPDLTYPLYVPRELLRSADIVHGHSQNSLFTVKILEEAK
FT                   GLGAKTALHFMAVDSLGDHPNPLVRLIGPLYGRRNVRVALKASDLRLVKSHRDAELLRA
FT                   RYGVETVYVPDGVDERLLTMPNMAEKFRERFGVHDPFVVYVGRLHRLKGVDVLIRAMTV
FT                   VKRESPELKAVVVGPGDQGPYLALAERLGVRDRVLFTGYVDEEAKVGAIDASLALALPS
FT                   VSDYAEAFSLAITEAWARGKPVIASAVGEVPYRVKNMVNGLLVPPRDPRALAEAILLLA
FT                   RDPSLGGKLGAEGSKSVLSWSEVIDHLLRIYQA"
FT   gene            690727..690852
FT                   /locus_tag="ASAC_0682"
FT   CDS_pept        690727..690852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19088"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A0"
FT                   /protein_id="ADL19088.1"
FT                   /translation="MAMMSQPKDLMNSTPCFGRYSAREFTTVTKPLRSSQGPSIP"
FT   gene            complement(691010..692131)
FT                   /locus_tag="ASAC_0683"
FT   CDS_pept        complement(691010..692131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0683"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19089"
FT                   /db_xref="GOA:D9Q1A1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A1"
FT                   /protein_id="ADL19089.1"
FT                   /translation="MRIVQVSPFYSPVVGGVEEVVRRIAEYMASRGHEVHVVTYNRLRS
FT                   DGLGSLPREEVINGVHVIRLRPRFTWSHGSYSPELPDVIRSLRPDVVHVHVWRHPHVFQ
FT                   VARLKGELGFTAVLHGHSPFHTLSQLGLVTWLYHRLADAFGRGALAAYDAYIALTSYES
FT                   RVVQGLGLDEGKIHVIPNGIDEDRCSADLDSRSGSAVLYLGRVSKSKNLGLLAKSMEYV
FT                   RGKAKEVKLVIAGPDEGLVNEVISYVRSHGVKAEYLGAVSEGEKHRLYSASDVYAFPST
FT                   FEPFGITLLEAEAHGTPPVITGQGGQVEVAPPGVVGLWARPKPRDFGEAIAELLTNESL
FT                   RRKLAYQARQWSQRFTWGRLLPKYEELYGKLTA"
FT   gene            692285..693313
FT                   /locus_tag="ASAC_0684"
FT   CDS_pept        692285..693313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0684"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19090"
FT                   /db_xref="GOA:D9Q1A2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A2"
FT                   /protein_id="ADL19090.1"
FT                   /translation="MSSGELISVIVTAHNRKQYLPYALRSLEAQTLPRDRFEVIVVKNF
FT                   DDKESDEIILRNGWKNIITDVVPLGGKIAIGLEEARGDVVTFLEDDDMYFPERLSVVYK
FT                   AFADLPGLIYLHNGQEVIDEGGSSLGPLQGLSHDVVIPLPPTEVACYAALVNPGGFHNN
FT                   SSIAARRHVLEGGPLRYVRSSPDLAALASALRRGRGLLLLMGRPLTYWRVHTGATTSHS
FT                   YSSRSGDMASSLRALARSYYAWALDAHLVKSYLAGTPCERYVEHLEAFRAVEIASMPSW
FT                   AAGQRLTVTLYRRLRQAQALRRLGSVSARNYLVMVADSLMSKAPDRLRELYWKARWLAG
FT                   GQ"
FT   gene            complement(693431..693925)
FT                   /locus_tag="ASAC_0685"
FT   CDS_pept        complement(693431..693925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0685"
FT                   /product="ABC transporter, binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19091"
FT                   /db_xref="GOA:D9Q1A3"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A3"
FT                   /protein_id="ADL19091.1"
FT                   /translation="MGMLWVETLPSISLLYPYSPYEYINETITGFPSQGHDYWASYWLI
FT                   GWPAALLCLHLVNQSVPEPWWYYYSAYSMSQVPEQWVTSNDPYVTTVTTTTPVTTTSTT
FT                   TTTTTAVTSVTTSTVTVTSTSTSTFTTTVYRYVTSAGDIAAAVVVTAVVVALAVWAVRR
FT                   K"
FT   gene            complement(693965..694300)
FT                   /locus_tag="ASAC_0686"
FT   CDS_pept        complement(693965..694300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19092"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A4"
FT                   /protein_id="ADL19092.1"
FT                   /translation="MSDIQMTIIEPSGEADYDESAVLIADELKAIGLNVVPETLPFSTW
FT                   FSDLLSGDYWMARFWGMGAVPVAAQQFLARLSPKTTNESAMGFGGFMWINLSQYPFMEY
FT                   INEAMQY"
FT   gene            694512..695144
FT                   /locus_tag="ASAC_0687"
FT   CDS_pept        694512..695144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0687"
FT                   /product="SAM-dependent methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19093"
FT                   /db_xref="GOA:D9Q1A5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A5"
FT                   /protein_id="ADL19093.1"
FT                   /translation="MGWEPFERLHSRYDSWFSRNAVTAENEVKALMKAVEGAGRPCVEV
FT                   GSGTGFFASRLGCLGVEPSVNMARLALRRGVQSVQGRAEALPLRDSSVSAVIFVVTLCF
FT                   LSDPAAAMAEASRALVRGGVLVSCIVARSSPWGQHYIGLGRAGHPFYSIAKFYDVDEVE
FT                   SMAVSAGLRPEGHFATLTYGPLDEPREEEPREYSGAEGFVCSRFRKA"
FT   gene            695120..695335
FT                   /locus_tag="ASAC_0688"
FT   CDS_pept        695120..695335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19094"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A6"
FT                   /protein_id="ADL19094.1"
FT                   /translation="MLKVQEGLRRQPLGELAMCDLGSLRDILKVAGRPQSWSPSERAAD
FT                   IKGVTDRDGPVRKKSQGETLPSGLQA"
FT   gene            complement(695373..696764)
FT                   /locus_tag="ASAC_0689"
FT   CDS_pept        complement(695373..696764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0689"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19095"
FT                   /db_xref="GOA:D9Q1A7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A7"
FT                   /protein_id="ADL19095.1"
FT                   /translation="MGPVRWTVAAAIIIVVAVAASLAAYLYRPARQVTITVVTYNDVAP
FT                   VVEMAAEEFEAQHPGVKVRVVSYPWDTYVEQEITVLKAGSLEYDVVTFTPTSSQLIAPY
FT                   LVPLNTSYFNWSDIIADQEDFGGLYYNASSGRAEVIGIAFQTWVELLAYNATLFNNATL
FT                   QHEFQEEYGFSLNPWTWGNWSQVVDADKFFVSHNITKYGFLVEDEPKHELIDTFPAIFE
FT                   WYYMHNQSLNCGNPAGLPGYGTMFMGCVPSWWGHGFPPPAFNSTAGVEALETLRELVSY
FT                   EPPPSQLAIGYSALVSILSQGSSAGAIAWANDIMGMNSSVASQLLMAPLPGGYGEPGST
FT                   FLGISRYSQHKQLALEFLQFIVSPQFQVRAFYAQGSLPISREAYLQVMNNASLPAYERE
FT                   WLRAILVANENATATPPTLPQTYPVLIPSFNGPVFEWLSSPTSSPMQVLQQAARAWVEA
FT                   LGGGG"
FT   gene            696845..698062
FT                   /locus_tag="ASAC_0690"
FT   CDS_pept        696845..698062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0690"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19096"
FT                   /db_xref="GOA:D9Q1A8"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A8"
FT                   /protein_id="ADL19096.1"
FT                   /translation="MAVGGPFMASRLTGWASAARPLLAGEVPSYWGGTLLFDPRPKEDP
FT                   RDLFDREEELKALRSGINYPVTLLLGLRRSGKSSIVKVLMRQEDALWVYLDMRKFEGRA
FT                   YITYRDLVQELEGAINSWPERLRQAFRGLRGVRLAGVEVRLSWGPGDRAEISDVLERLS
FT                   EVAEEEGRRPVVVFDESQELRRLKGYDLLYPIAYAYDNLRVRFIFTGSEVGMVYRFLRL
FT                   NDPGSPLYGRAVTEINVGPFSRGLSLEFLRRGFEEVGMKVPEAEVEEAYDSLGGIPGWL
FT                   TYYGFYYMQLRDHREALNKTISTGVELVRQEFRGFLVGREAARERYYTIMEACREGCTW
FT                   SDVKRALEAREGARVDDKQVTLLIRNLVDASFLTREGDLYRPADVLIRRAFQRQGGSET
FT                   THSLRI"
FT   gene            complement(698152..698322)
FT                   /locus_tag="ASAC_0691"
FT   CDS_pept        complement(698152..698322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19097"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1A9"
FT                   /protein_id="ADL19097.1"
FT                   /translation="MGSGTAAYITGTLSGVSSAWAVNGGNALSSGVIYEFQLHMLNGDV
FT                   MSSVSNAAFIS"
FT   gene            complement(698662..698952)
FT                   /locus_tag="ASAC_0692"
FT   CDS_pept        complement(698662..698952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19098"
FT                   /db_xref="GOA:D9Q1B0"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B0"
FT                   /protein_id="ADL19098.1"
FT                   /translation="MLHDKQFWEGLVVHAVSTLFEEFITMSATSALAHEGVTNKNVTFI
FT                   VKEATRLVSAWMFYVLFNYLKKPAWAAMTAGTIIAISIYDLLNYFLEKDVS"
FT   gene            complement(699346..699849)
FT                   /locus_tag="ASAC_0693"
FT   CDS_pept        complement(699346..699849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0693"
FT                   /product="Fe-S cluster-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B1"
FT                   /protein_id="ADL19099.1"
FT                   /translation="MKQLIAIPERCTGCGRCELACSFEHFKVFDPELSAIHVLRLEREP
FT                   LDAPLFCIQCGLCAVDGVCPHNAIYRDPNTFSVAIDRARCDGCERCVEVCPYGVITIDH
FT                   LEKKAVKCDLCGGDPQCVKACPENALAYVDVNEAAYYKRYFFAKLQEKFMVPIVPYPAR
FT                   GSTS"
FT   gene            complement(699917..701338)
FT                   /locus_tag="ASAC_0694"
FT   CDS_pept        complement(699917..701338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19100"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B2"
FT                   /protein_id="ADL19100.1"
FT                   /translation="MRRAAPLLLAFAVLAALAVAEADLIIVYRAAVSLEPVASPVVYKA
FT                   SAPACGFAPNLSVLYYGAVQGSSGYAFTLLVPAQRGYEYKLQWPISVFTAAENGTATIS
FT                   LGGGSTTISVRRGDTYLLYLLSGAPLSSVSLSGSLAFSPSSALGLSFVYGLRTAVHQPP
FT                   QGAALSFVDGQSLQTTMYYQGDYDGTPSGGWPYDLGPSAAEAYYWDLWYAGSAAQPVMD
FT                   MTGYLQEYYGNLQYAPSAGAVLWSYSYAGGHNLTIAAVVTYSSPSLALGHGVYFYLFLA
FT                   PQGKAANQSIPYVSSESLSQPPSPVMGDVMYPASNGSYLVVQFDPAWYYNLSLATGPGI
FT                   GGSSGPWNAWVVSVTVAGKGKKAGLTANFEPSPSPNLGPPWSGWDGVGSWSPTPWVPGP
FT                   GDYVLVCVTYDPSNGYIYGRAVDLNYPFYNSTFSEYVGSYFSPPAAGAYYVGVGSGTGY
FT                   LYAADWGLVWAWAGP"
FT   gene            complement(701335..702072)
FT                   /locus_tag="ASAC_0695"
FT   CDS_pept        complement(701335..702072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19101"
FT                   /db_xref="GOA:D9Q1B3"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B3"
FT                   /protein_id="ADL19101.1"
FT                   /translation="MAAAAASLIIASLGALAALPAVVADARYYYIGVGLVSRVVTPTYS
FT                   KVTVYPPMAVPEVLLGASAVYIAFNRRARAAYLALAALSYYFTAALEVAEGLRGLGGLT
FT                   INYGPSSALVVPGASVSLNYASVALLTASAGAALAASAWGEVRKIVEAAEALARRRFGV
FT                   GLEELRRRSPGLARAVELYSRYSPGYGEARSHIYDEGEPVREVADREARRIFGVGIDEL
FT                   ERTKPWAAREIMRRARYIRRRRA"
FT   gene            complement(702077..702817)
FT                   /locus_tag="ASAC_0696"
FT   CDS_pept        complement(702077..702817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19102"
FT                   /db_xref="GOA:D9Q1B4"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B4"
FT                   /protein_id="ADL19102.1"
FT                   /translation="MGNDEVNYAYAAVVIVVSVLGALVVLRYLGPLGRPLPEPPFNVSL
FT                   VNVSGVGDRLYVNITISDCRVRPLGGSVEVYLGDRVVGYSTFNATCGINTVSLPLQPQL
FT                   VGSEARFAVNVSLGDRGYVISYFERLVTAVMSLRPVNVTFEDGEPLLFLSYVSPFPVMI
FT                   SAGQVTYINYNLSALALSGCVTPRALAPAGQGTVKLQLLNCSYEDLSALRPGDVYQIRA
FT                   LANVTYISPYGNVTQEVGLLGYQG"
FT   gene            complement(702893..703477)
FT                   /locus_tag="ASAC_0697"
FT   CDS_pept        complement(702893..703477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19103"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B5"
FT                   /protein_id="ADL19103.1"
FT                   /translation="MKGYLKVAMLASLLAVALAAPMAAAHIIFVYKEQVNFNAVTPVLF
FT                   KPGPEAAAVQLSLYNVTGKTGQSGAFIQLTIPVTNATYEYVYQALELYVNNAFGQGTPE
FT                   LSVASCSYTGSATLTSVTLVVYPTTDSSPGQGQNITITPSTSACTASGTATLTQGTTYY
FT                   VDFKVLPTIPVPYGSSGTLTLYLEVENVTSS"
FT   gene            complement(703605..705398)
FT                   /locus_tag="ASAC_0698"
FT   CDS_pept        complement(703605..705398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0698"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19104"
FT                   /db_xref="GOA:D9Q1B6"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B6"
FT                   /protein_id="ADL19104.1"
FT                   /translation="MGSFSRLIRVDLGSGEVKYDELRDEDVRAYLGGRGIGLLLALKGG
FT                   YGRPQDPLSPELPLIIASGPLSGAGIPLSSRATAVFFSPLSRRWSYSTVGGSLAVIMRY
FT                   AGADVLMVTGRAQRPSYIVVEGGRAEVRDASGLWGMGTFDAERALKEVHGQEAAVAVIG
FT                   PAGENLVPFASINHETWRQFGRSGGGAVMGSKNLKAVVFVPSGRSIEVADPERTWSMIS
FT                   YMTQRLATAAKSYRDNGTLGTIDAANGTGFFPSLYWTGVSAPGWRRISWYEVLSKNYYV
FT                   GKRATCLHCPVACHKVVTSRRYGGYYELEYETTMALAGLTGVVDPDELIQLASLVDDVG
FT                   LDTISTGNVLGLLAYLTEKGYVDPSEGVRFGDAQRFRELITAIAKREGIGKVLSMGTRE
FT                   AARALGHPEVAIEVKGLEPAGYDPRTLKGMILTYAVAERGADHLWSSGYAIDIPGLAGG
FT                   RQATGEEKVRAVMDLEERNAIYDSAVLCKFGRNAYGWSELVQVLNAVTGFSYDQASLRE
FT                   TAERIIVIHRYMNGTTVEDDKLPPRWLNEPVEFDGKRYVVAEEEWRRMVMTYYKLRGYD
FT                   EEGRPTRETLERLGILKAAGG"
FT   gene            complement(705454..706263)
FT                   /locus_tag="ASAC_0699"
FT   CDS_pept        complement(705454..706263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0699"
FT                   /product="Zn-dependent hydrolase (AttM-related)"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19105"
FT                   /db_xref="GOA:D9Q1B7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B7"
FT                   /protein_id="ADL19105.1"
FT                   /translation="MAETGVKHAYLFDYGLMQAEWGWFLPDPATNGQRDKPRRWVEFPM
FT                   AGALIEHEDGWIMIDSGPSPDAARVWPKESFEAFPVVRFTQDNVSVNQLKQLNLKPEDI
FT                   RAIIFTHLHLDHAGQAYMYRDSAYLIAHRLELQHALTQIWEGKYGAYVPSDFEPLKGAR
FT                   WVLVDEERLEILPGIEVIHTGGHTPGHMVVKVEAPNGDTWYFMGDFFHMPEEFETESKG
FT                   WLLYNGDQFESFTRKMKFWTSSKRVHMFMTHDPTNWQKYPRIPRPLF"
FT   gene            706399..707682
FT                   /locus_tag="ASAC_0700"
FT   CDS_pept        706399..707682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0700"
FT                   /product="Iron-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19106"
FT                   /db_xref="GOA:D9Q1B8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B8"
FT                   /protein_id="ADL19106.1"
FT                   /translation="MAYLAYSELTDSVFVINLPYIKFGLGASKDVGYEARRLGMTSVLL
FT                   VVGRRLAETKLAEQVRGSLESQGIKVEVFTDVHVEPDDEAIVQGFSKVRDLRLDGFVAL
FT                   GGGSTIDTAKLLNLLYSYPADLMDYVNRPVGKGMSPPGPLKPMIAIPTTAGTGAENTNV
FT                   AVLDIKRLHVKTGVSNQYLRPSVAIVDPLTTVSMPPMVTASTGLDVLNHAIESITAHPY
FT                   TARPAVSPAERPVYAGSTPIGDLFLPVITWAAKYIRRAYADPYDIEARYYMQLGANLAG
FT                   LGFGHAGVHVPHAMAYPIAGMVRDWHPPDYDFGYPIVPHGISTAIPAAYAFRFLAPYNE
FT                   DKFRAVARALGLDDSGTPREVGERIFDFYLKLLEDLHVPTNLKEIGFSRSDLDGLVEGA
FT                   WAQQRLLVLSPKAISKDDLRRLYSEMLE"
FT   gene            707715..708086
FT                   /locus_tag="ASAC_0701"
FT   CDS_pept        707715..708086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0701"
FT                   /product="hypothetical protein"
FT                   /note="DUF74 domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19107"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1B9"
FT                   /protein_id="ADL19107.1"
FT                   /translation="MPSLLPGETLSFTSTDIIITTSNDVPGHRVVKVLGVALGITVRSR
FT                   GLGGNLLASLRSLVGGEIKEYTEMSEQARIQAIQRMVEHAKSMGANAVIAFRLDSNEIG
FT                   ETMDEIIAYGTAVVVEPTA"
FT   gene            708171..708638
FT                   /locus_tag="ASAC_0702"
FT   CDS_pept        708171..708638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19108"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1C0"
FT                   /protein_id="ADL19108.1"
FT                   /translation="MSSADLRARLEGWAKTEVAHANRLSETARRARSPLVRAVLTAIAV
FT                   DSEKHYQLLMIAEELLTKSELSVDEFEGTLNDIREHIATEEDAIKFFESQLRDPAVASN
FT                   LQLTFVLKLLLRDEKFHHIVLHDLYQALVRGRIIGQGEEWEELYRELDRYL"
FT   gene            708682..709812
FT                   /locus_tag="ASAC_0703"
FT   CDS_pept        708682..709812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19109"
FT                   /db_xref="GOA:D9Q1C1"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1C1"
FT                   /protein_id="ADL19109.1"
FT                   /translation="MDRGSRLLWASWTFSVANGLSSPVLGLYLFTGGSMEVSVEFYIVG
FT                   AAFILATYIAVGMSSGRLRSTASLYRPGLALLAAFYFTLLALGPRAHSCVPPLAALYGV
FT                   ASGLYWSGWDIVYYEFISDRLTFFNRLSYLGFASSLALPAIYGGVLAALRSSGYYVLFA
FT                   SSAVGLAVASALMPSLRPSLGSFSVLHMASLPARDRRYGGLVTALSMLFGYGYSTSYVN
FT                   PILTYVYFGDSYSRFAEFNYALNVLGVAVVRARRWMASRLGAGNLVLYSSAALMASAAA
FT                   TAVTWRAAPAYLVASSFMGQMVTFVDVETWNSMRHDRFAEYMTNRHLMLNTGRVTASLL
FT                   VLAVVNFLGPFTSPLVPGAFALAGGSYFKVIRRDKP"
FT   gene            709855..711117
FT                   /locus_tag="ASAC_0704"
FT   CDS_pept        709855..711117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ASAC_0704"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ASAC_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADL19110"
FT                   /db_xref="GOA:D9Q1C2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9Q1C2"
FT                   /protein_id="ADL19110.1"
FT                   /translation="MGTLVIEDALIFDSSGRQPFRGTVVVKDNVIEDVGTRGEVSPPEG
FT                   ARVVEARGMFLMPGLIDAHLHLTGSRSGRIEEDLVTPIGVFFARAVRDLEALADAGFTT
FT                   VVDAGSIVGLHLRDAVAEGTVRGPRVVAAGPVLSQTFGHADVHYLPVEWVDYRTTRKLT
FT                   PFASLICDGEAECRKAARHAMREGADFIKVMASGGVLSQRDRPEYRQFTLEELKAIVDE
FT                   ARAANRWVHAHAEGKAGIVNAARAGVKIVAHCDMMDEEAAEEVLKAGATCVPTFAIDYR
FT                   LLEEGQKLGVPEWGMRKIAELADIHLENIRRAYRMGVRLATGTDFSGGVGRHGENAEEV
FT                   AIFVEKVGMTPQEALIAATRNAAYAAGLEGRAGIIAKGALADLILVDGNPLDNVRALTD
FT                   RSRVKLVVRGGEVIKDLTTRA"
FT   gene            711192..713753
FT                   /locus_tag="ASAC_0705"
FT   CDS_pept        711192..713753
FT                   /codon_start=1
FT                   /transl_table