(data stored in ACNUC7421 zone)

EMBL: CP001743

ID   CP001743; SV 1; circular; genomic DNA; STD; PRO; 3097457 BP.
XX
AC   CP001743; ABUF01000000-ABUF01000006;
XX
PR   Project:PRJNA28827;
XX
DT   05-MAR-2010 (Rel. 104, Created)
DT   16-DEC-2013 (Rel. 119, Last updated, Version 5)
XX
DE   Meiothermus ruber DSM 1279, complete genome.
XX
KW   .
XX
OS   Meiothermus ruber DSM 1279
OC   Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae;
OC   Meiothermus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3097457
RX   DOI; 10.4056/sigs.1032748.
RX   PUBMED; 21304689.
RA   Tindall B.J., Sikorski J., Lucas S., Goltsman E., Copeland A.,
RA   Glavina Del Rio T., Nolan M., Tice H., Cheng J.F., Han C., Pitluck S.,
RA   Liolios K., Ivanova N., Mavromatis K., Ovchinnikova G., Pati A.,
RA   Fahnrich R., Goodwin L., Chen A., Palaniappan K., Land M., Hauser L.,
RA   Chang Y.J., Jeffries C.D., Rohde M., Goker M., Woyke T., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.,
RA   Lapidus A.;
RT   "Complete genome sequence of Meiothermus ruber type strain (21)";
RL   Stand Genomic Sci 3(1):26-36(2010).
XX
RN   [2]
RP   1-3097457
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Ovchinnikova G., Goltsman E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F.,
RA   Hugenholtz P., Woyke T., Wu D., Tindal B., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1436c7dd32e1bc48e56f692dbc83490d.
DR   BioSample; SAMN00002601.
DR   EnsemblGenomes-Gn; EBG00001015477.
DR   EnsemblGenomes-Gn; EBG00001015478.
DR   EnsemblGenomes-Gn; EBG00001015479.
DR   EnsemblGenomes-Gn; EBG00001015480.
DR   EnsemblGenomes-Gn; EBG00001015481.
DR   EnsemblGenomes-Gn; EBG00001015482.
DR   EnsemblGenomes-Gn; EBG00001015483.
DR   EnsemblGenomes-Gn; EBG00001015484.
DR   EnsemblGenomes-Gn; EBG00001015485.
DR   EnsemblGenomes-Gn; EBG00001015486.
DR   EnsemblGenomes-Gn; EBG00001015487.
DR   EnsemblGenomes-Gn; EBG00001015488.
DR   EnsemblGenomes-Gn; EBG00001015489.
DR   EnsemblGenomes-Gn; EBG00001015490.
DR   EnsemblGenomes-Gn; EBG00001015492.
DR   EnsemblGenomes-Gn; EBG00001015494.
DR   EnsemblGenomes-Gn; EBG00001015495.
DR   EnsemblGenomes-Gn; EBG00001015496.
DR   EnsemblGenomes-Gn; EBG00001015497.
DR   EnsemblGenomes-Gn; EBG00001015498.
DR   EnsemblGenomes-Gn; EBG00001015499.
DR   EnsemblGenomes-Gn; EBG00001015500.
DR   EnsemblGenomes-Gn; EBG00001015501.
DR   EnsemblGenomes-Gn; EBG00001015502.
DR   EnsemblGenomes-Gn; EBG00001015503.
DR   EnsemblGenomes-Gn; EBG00001015504.
DR   EnsemblGenomes-Gn; EBG00001015506.
DR   EnsemblGenomes-Gn; EBG00001015508.
DR   EnsemblGenomes-Gn; EBG00001015510.
DR   EnsemblGenomes-Gn; EBG00001015512.
DR   EnsemblGenomes-Gn; EBG00001015514.
DR   EnsemblGenomes-Gn; EBG00001015515.
DR   EnsemblGenomes-Gn; EBG00001015517.
DR   EnsemblGenomes-Gn; EBG00001015519.
DR   EnsemblGenomes-Gn; EBG00001015521.
DR   EnsemblGenomes-Gn; EBG00001015523.
DR   EnsemblGenomes-Gn; EBG00001015526.
DR   EnsemblGenomes-Gn; EBG00001015528.
DR   EnsemblGenomes-Gn; EBG00001015530.
DR   EnsemblGenomes-Gn; EBG00001015532.
DR   EnsemblGenomes-Gn; EBG00001015534.
DR   EnsemblGenomes-Gn; EBG00001015536.
DR   EnsemblGenomes-Gn; EBG00001015538.
DR   EnsemblGenomes-Gn; EBG00001015540.
DR   EnsemblGenomes-Gn; EBG00001015542.
DR   EnsemblGenomes-Gn; EBG00001015544.
DR   EnsemblGenomes-Gn; EBG00001015546.
DR   EnsemblGenomes-Gn; EBG00001015548.
DR   EnsemblGenomes-Gn; EBG00001015550.
DR   EnsemblGenomes-Gn; EBG00001015552.
DR   EnsemblGenomes-Gn; EBG00001015554.
DR   EnsemblGenomes-Gn; EBG00001015556.
DR   EnsemblGenomes-Gn; EBG00001015558.
DR   EnsemblGenomes-Gn; EBG00001015560.
DR   EnsemblGenomes-Gn; EBG00001015562.
DR   EnsemblGenomes-Gn; EBG00001015565.
DR   EnsemblGenomes-Gn; EBG00001015567.
DR   EnsemblGenomes-Gn; EBG00001015568.
DR   EnsemblGenomes-Gn; EBG00001015570.
DR   EnsemblGenomes-Gn; EBG00001015571.
DR   EnsemblGenomes-Gn; EBG00001015573.
DR   EnsemblGenomes-Gn; EBG00001015575.
DR   EnsemblGenomes-Gn; EBG00001015577.
DR   EnsemblGenomes-Gn; EBG00001015579.
DR   EnsemblGenomes-Gn; EBG00001015581.
DR   EnsemblGenomes-Gn; Mrub_R0001.
DR   EnsemblGenomes-Gn; Mrub_R0002.
DR   EnsemblGenomes-Gn; Mrub_R0003.
DR   EnsemblGenomes-Gn; Mrub_R0004.
DR   EnsemblGenomes-Gn; Mrub_R0005.
DR   EnsemblGenomes-Gn; Mrub_R0006.
DR   EnsemblGenomes-Gn; Mrub_R0007.
DR   EnsemblGenomes-Gn; Mrub_R0008.
DR   EnsemblGenomes-Gn; Mrub_R0009.
DR   EnsemblGenomes-Gn; Mrub_R0010.
DR   EnsemblGenomes-Gn; Mrub_R0011.
DR   EnsemblGenomes-Gn; Mrub_R0012.
DR   EnsemblGenomes-Gn; Mrub_R0013.
DR   EnsemblGenomes-Gn; Mrub_R0014.
DR   EnsemblGenomes-Gn; Mrub_R0015.
DR   EnsemblGenomes-Gn; Mrub_R0016.
DR   EnsemblGenomes-Gn; Mrub_R0017.
DR   EnsemblGenomes-Gn; Mrub_R0018.
DR   EnsemblGenomes-Gn; Mrub_R0019.
DR   EnsemblGenomes-Gn; Mrub_R0020.
DR   EnsemblGenomes-Gn; Mrub_R0021.
DR   EnsemblGenomes-Gn; Mrub_R0022.
DR   EnsemblGenomes-Gn; Mrub_R0023.
DR   EnsemblGenomes-Gn; Mrub_R0024.
DR   EnsemblGenomes-Gn; Mrub_R0025.
DR   EnsemblGenomes-Gn; Mrub_R0026.
DR   EnsemblGenomes-Gn; Mrub_R0027.
DR   EnsemblGenomes-Gn; Mrub_R0028.
DR   EnsemblGenomes-Gn; Mrub_R0029.
DR   EnsemblGenomes-Gn; Mrub_R0030.
DR   EnsemblGenomes-Gn; Mrub_R0031.
DR   EnsemblGenomes-Gn; Mrub_R0032.
DR   EnsemblGenomes-Gn; Mrub_R0033.
DR   EnsemblGenomes-Gn; Mrub_R0034.
DR   EnsemblGenomes-Gn; Mrub_R0035.
DR   EnsemblGenomes-Gn; Mrub_R0036.
DR   EnsemblGenomes-Gn; Mrub_R0037.
DR   EnsemblGenomes-Gn; Mrub_R0038.
DR   EnsemblGenomes-Gn; Mrub_R0039.
DR   EnsemblGenomes-Gn; Mrub_R0040.
DR   EnsemblGenomes-Gn; Mrub_R0041.
DR   EnsemblGenomes-Gn; Mrub_R0042.
DR   EnsemblGenomes-Gn; Mrub_R0043.
DR   EnsemblGenomes-Gn; Mrub_R0047.
DR   EnsemblGenomes-Gn; Mrub_R0048.
DR   EnsemblGenomes-Gn; Mrub_R0049.
DR   EnsemblGenomes-Gn; Mrub_R0050.
DR   EnsemblGenomes-Gn; Mrub_R0051.
DR   EnsemblGenomes-Gn; Mrub_R0052.
DR   EnsemblGenomes-Gn; Mrub_R0053.
DR   EnsemblGenomes-Gn; Mrub_R0054.
DR   EnsemblGenomes-Gn; Mrub_R0055.
DR   EnsemblGenomes-Gn; Mrub_R0056.
DR   EnsemblGenomes-Tr; EBT00001538680.
DR   EnsemblGenomes-Tr; EBT00001538681.
DR   EnsemblGenomes-Tr; EBT00001538682.
DR   EnsemblGenomes-Tr; EBT00001538683.
DR   EnsemblGenomes-Tr; EBT00001538684.
DR   EnsemblGenomes-Tr; EBT00001538685.
DR   EnsemblGenomes-Tr; EBT00001538686.
DR   EnsemblGenomes-Tr; EBT00001538687.
DR   EnsemblGenomes-Tr; EBT00001538688.
DR   EnsemblGenomes-Tr; EBT00001538689.
DR   EnsemblGenomes-Tr; EBT00001538690.
DR   EnsemblGenomes-Tr; EBT00001538691.
DR   EnsemblGenomes-Tr; EBT00001538692.
DR   EnsemblGenomes-Tr; EBT00001538693.
DR   EnsemblGenomes-Tr; EBT00001538694.
DR   EnsemblGenomes-Tr; EBT00001538695.
DR   EnsemblGenomes-Tr; EBT00001538696.
DR   EnsemblGenomes-Tr; EBT00001538697.
DR   EnsemblGenomes-Tr; EBT00001538698.
DR   EnsemblGenomes-Tr; EBT00001538699.
DR   EnsemblGenomes-Tr; EBT00001538700.
DR   EnsemblGenomes-Tr; EBT00001538701.
DR   EnsemblGenomes-Tr; EBT00001538702.
DR   EnsemblGenomes-Tr; EBT00001538703.
DR   EnsemblGenomes-Tr; EBT00001538704.
DR   EnsemblGenomes-Tr; EBT00001538705.
DR   EnsemblGenomes-Tr; EBT00001538706.
DR   EnsemblGenomes-Tr; EBT00001538707.
DR   EnsemblGenomes-Tr; EBT00001538708.
DR   EnsemblGenomes-Tr; EBT00001538709.
DR   EnsemblGenomes-Tr; EBT00001538710.
DR   EnsemblGenomes-Tr; EBT00001538711.
DR   EnsemblGenomes-Tr; EBT00001538712.
DR   EnsemblGenomes-Tr; EBT00001538713.
DR   EnsemblGenomes-Tr; EBT00001538714.
DR   EnsemblGenomes-Tr; EBT00001538715.
DR   EnsemblGenomes-Tr; EBT00001538716.
DR   EnsemblGenomes-Tr; EBT00001538717.
DR   EnsemblGenomes-Tr; EBT00001538718.
DR   EnsemblGenomes-Tr; EBT00001538719.
DR   EnsemblGenomes-Tr; EBT00001538720.
DR   EnsemblGenomes-Tr; EBT00001538721.
DR   EnsemblGenomes-Tr; EBT00001538722.
DR   EnsemblGenomes-Tr; EBT00001538723.
DR   EnsemblGenomes-Tr; EBT00001538724.
DR   EnsemblGenomes-Tr; EBT00001538725.
DR   EnsemblGenomes-Tr; EBT00001538726.
DR   EnsemblGenomes-Tr; EBT00001538727.
DR   EnsemblGenomes-Tr; EBT00001538728.
DR   EnsemblGenomes-Tr; EBT00001538730.
DR   EnsemblGenomes-Tr; EBT00001538731.
DR   EnsemblGenomes-Tr; EBT00001538732.
DR   EnsemblGenomes-Tr; EBT00001538733.
DR   EnsemblGenomes-Tr; EBT00001538734.
DR   EnsemblGenomes-Tr; EBT00001538735.
DR   EnsemblGenomes-Tr; EBT00001538736.
DR   EnsemblGenomes-Tr; EBT00001538737.
DR   EnsemblGenomes-Tr; EBT00001538739.
DR   EnsemblGenomes-Tr; EBT00001538740.
DR   EnsemblGenomes-Tr; EBT00001538741.
DR   EnsemblGenomes-Tr; EBT00001538742.
DR   EnsemblGenomes-Tr; EBT00001538743.
DR   EnsemblGenomes-Tr; EBT00001538744.
DR   EnsemblGenomes-Tr; EBT00001538745.
DR   EnsemblGenomes-Tr; EBT00001538746.
DR   EnsemblGenomes-Tr; Mrub_R0001-1.
DR   EnsemblGenomes-Tr; Mrub_R0002-1.
DR   EnsemblGenomes-Tr; Mrub_R0003-1.
DR   EnsemblGenomes-Tr; Mrub_R0004-1.
DR   EnsemblGenomes-Tr; Mrub_R0005-1.
DR   EnsemblGenomes-Tr; Mrub_R0006-1.
DR   EnsemblGenomes-Tr; Mrub_R0007-1.
DR   EnsemblGenomes-Tr; Mrub_R0008-1.
DR   EnsemblGenomes-Tr; Mrub_R0009-1.
DR   EnsemblGenomes-Tr; Mrub_R0010-1.
DR   EnsemblGenomes-Tr; Mrub_R0011-1.
DR   EnsemblGenomes-Tr; Mrub_R0012-1.
DR   EnsemblGenomes-Tr; Mrub_R0013-1.
DR   EnsemblGenomes-Tr; Mrub_R0014-1.
DR   EnsemblGenomes-Tr; Mrub_R0015-1.
DR   EnsemblGenomes-Tr; Mrub_R0016-1.
DR   EnsemblGenomes-Tr; Mrub_R0017-1.
DR   EnsemblGenomes-Tr; Mrub_R0018-1.
DR   EnsemblGenomes-Tr; Mrub_R0019-1.
DR   EnsemblGenomes-Tr; Mrub_R0020-1.
DR   EnsemblGenomes-Tr; Mrub_R0021-1.
DR   EnsemblGenomes-Tr; Mrub_R0022-1.
DR   EnsemblGenomes-Tr; Mrub_R0023-1.
DR   EnsemblGenomes-Tr; Mrub_R0024-1.
DR   EnsemblGenomes-Tr; Mrub_R0025-1.
DR   EnsemblGenomes-Tr; Mrub_R0026-1.
DR   EnsemblGenomes-Tr; Mrub_R0027-1.
DR   EnsemblGenomes-Tr; Mrub_R0028-1.
DR   EnsemblGenomes-Tr; Mrub_R0029-1.
DR   EnsemblGenomes-Tr; Mrub_R0030-1.
DR   EnsemblGenomes-Tr; Mrub_R0031-1.
DR   EnsemblGenomes-Tr; Mrub_R0032-1.
DR   EnsemblGenomes-Tr; Mrub_R0033-1.
DR   EnsemblGenomes-Tr; Mrub_R0034-1.
DR   EnsemblGenomes-Tr; Mrub_R0035-1.
DR   EnsemblGenomes-Tr; Mrub_R0036-1.
DR   EnsemblGenomes-Tr; Mrub_R0037-1.
DR   EnsemblGenomes-Tr; Mrub_R0038-1.
DR   EnsemblGenomes-Tr; Mrub_R0039-1.
DR   EnsemblGenomes-Tr; Mrub_R0040-1.
DR   EnsemblGenomes-Tr; Mrub_R0041-1.
DR   EnsemblGenomes-Tr; Mrub_R0042-1.
DR   EnsemblGenomes-Tr; Mrub_R0043-1.
DR   EnsemblGenomes-Tr; Mrub_R0047-1.
DR   EnsemblGenomes-Tr; Mrub_R0048-1.
DR   EnsemblGenomes-Tr; Mrub_R0049-1.
DR   EnsemblGenomes-Tr; Mrub_R0050-1.
DR   EnsemblGenomes-Tr; Mrub_R0051-1.
DR   EnsemblGenomes-Tr; Mrub_R0052-1.
DR   EnsemblGenomes-Tr; Mrub_R0053-1.
DR   EnsemblGenomes-Tr; Mrub_R0054-1.
DR   EnsemblGenomes-Tr; Mrub_R0055-1.
DR   EnsemblGenomes-Tr; Mrub_R0056-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP001743.
DR   SILVA-SSU; CP001743.
DR   StrainInfo; 157229; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083242
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Meiothermus ruber DSM 1279
CC   Culture Collection ID :: DSM 1279, ATCC 35948, VKM B-1258
CC   GOLD Stamp ID         :: Gi02300
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: Hot spring
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 50 - 60C
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3097457
FT                   /organism="Meiothermus ruber DSM 1279"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:504728"
FT                   /culture_collection="DSM:1279"
FT   gene            37..1356
FT                   /locus_tag="Mrub_0001"
FT   CDS_pept        37..1356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="InterPro IPR001957:IPR013159:IPR013317:IPR003593;
FT                   COGs: COG0593 ATPase involved in DNA replication
FT                   initiation; KEGG: bcr:BCAH187_A0001 chromosomal replication
FT                   initiator protein DnaA; SPTR: Q72H87 Chromosomal
FT                   replication initiator protein dnaA; SMART: Chromosomal
FT                   replication initiator DnaA domain; AAA ATPase; PFAM:
FT                   Chromosomal replication initiator DnaA; Chromosomal
FT                   replication initiator DnaA domain; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: Bacterial dnaA
FT                   protein; Bacterial dnaA protein helix-turn-helix domain;
FT                   TIGRFAM: chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26783"
FT                   /protein_id="ADD26783.1"
FT                   /translation="MTQNTVWQNVLEYVRQSITEVEYHTWFEKIQPLGVVNGSLELGVP
FT                   TSFFKGWIEDHYAELLTEALARLGAQAPRFELKVIPGKPVQEDIFSASTPNKPQEARAR
FT                   LNPKYIFENFVVGQNNNLAHAAAVAVAESPGNAYNPLFIYGGVGLGKTHLMHAVGHSVA
FT                   QRFPDKKIEYVSTETFTNELINAIREDRMSEFRDRYRSVDLLLVDDIQFIAGKERTQEE
FT                   FFHTFNALYEARKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRVAILKM
FT                   NSEYRNMRVPEEVLEYIARQITSNIRELEGALMRVIAYASLNGVQLSKAVAIKALSDVF
FT                   AATESGLAPEEILKAVAEHYNLRPEEIRGAGRRKEVVIPRQIAMYLIREMTHASLPEIG
FT                   QFFDGRDHTTVLYAIQKIQESLDTEPNLQQTLKSIRERLR"
FT   gene            1862..2947
FT                   /locus_tag="Mrub_0002"
FT   CDS_pept        1862..2947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); KEGG: rpt:Rpal_0002 DNA polymerase III,
FT                   beta subunit; SPTR: A3WSP5 DNA polymerase III subunit beta;
FT                   SMART: DNA polymerase III beta chain; PFAM: DNA polymerase
FT                   III beta chain; PRIAM: DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; InterPro
FT                   IPR001001; PFAM: DNA polymerase III beta subunit,
FT                   C-terminal domain; DNA polymerase III beta subunit,
FT                   N-terminal domain; DNA polymerase III beta subunit, central
FT                   domain; TIGRFAM: DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26784"
FT                   /protein_id="ADD26784.1"
FT                   /translation="MEVRIPKRTLAEGLSILERIIPSRSSNPILTYLPMELSDQGLILR
FT                   GTNGEVDIEVKLPAEVQGTGQVLVPAQTFVQIVRSAPGELVELIFGGKERLELHSGAFN
FT                   TQLATTGPDGYPELSFGPPGPEKIAASRLAQAITRVRYAASTEEFRAIFRGVQIEMSPT
FT                   SLRAVASDGYRLACYDLPMQLQTRKLVIPARSADEIVRVFKDAQGEVALAVAEGTLTLV
FT                   GEAVRMSVKLMEGEFPDYGRVIPQSFVLEATLQAEALRESLKRVAVLSDRNNHRVNLLF
FT                   NHNKLDIDAEGDYGRGREELGIEASGEPQLMVAYNAQFLIDALAPIEGAVRIKLSGPTS
FT                   PSLVQAVEDSGYLAVVVPLRV"
FT   gene            3114..4388
FT                   /locus_tag="Mrub_0003"
FT   CDS_pept        3114..4388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0003"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="TIGRFAM: enolase; PRIAM: Phosphopyruvate hydratase;
FT                   PFAM: enolase; SPTR: Q5SME1 Enolase; KEGG: aba:Acid345_1070
FT                   enolase; COGs: COG0148 Enolase; InterPro IPR000941; PFAM:
FT                   Enolase, N-terminal domain; Enolase, C-terminal TIM barrel
FT                   domain; TIGRFAM: phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26785"
FT                   /protein_id="ADD26785.1"
FT                   /translation="MTTIVEIKGREVLDSRGNPTVEAEVVLESGARGRAMVPSGASTGA
FT                   HEAVELRDGGPRFGGKGVLRAVAAINERIADEVIGLDALNQEAVDKTMLELDGTPNKGN
FT                   LGANAILAVSLATAHAAASGLGLPLYRYLGGVQGVTLPVPLMNVINGGKHADNNVDFQE
FT                   FMLVPGGLPTFSEALRAGVETFHALKSVLKAKGYNTNVGDEGGFAPDLKSNEEAVEVLL
FT                   TAIEKAGYKPGQEIAIALDPASSEFYQEGRYVLEADGKSLSGPEMVAYWENWVNQYPIV
FT                   SIEDGLAEDDWETWKLLTERLGRRIQLVGDDLFVTNPAILKRGIELGVGNSILVKVNQI
FT                   GTLSETLEAIRLAHRSGYTTILSHRSGETEDNTIADIAVAVNAGQIKTGSASRSDRLAK
FT                   YNQLLRIEEELGTGARFLGFGAFKK"
FT   gene            4406..5830
FT                   /locus_tag="Mrub_0004"
FT   CDS_pept        4406..5830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0004"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="TIGRFAM: pyruvate kinase; PRIAM: Pyruvate kinase;
FT                   PFAM: Pyruvate kinase barrel; Pyruvate kinase alpha/beta;
FT                   SPTR: A7CAK5 Pyruvate kinase; KEGG: acr:Acry_0178 pyruvate
FT                   kinase; COGs: COG0469 Pyruvate kinase; InterPro
FT                   IPR015793:IPR015794:IPR001697; PFAM: Pyruvate kinase,
FT                   alpha/beta domain; Pyruvate kinase, barrel domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26786"
FT                   /protein_id="ADD26786.1"
FT                   /translation="MGLLKRTKIVATLGPASRSPEVIRALIEAGVDVFRLNFSHGVPED
FT                   HRASVQMIREASSALGRTVAILQDLQGPKIRCGRFREGAVELQPGQKFIITAEPVEGDE
FT                   TRVSTTYRGLPNDVTPGQILLLDDGNIRLRVDEVRINDIHTTVLVGGRLSNNKGINIPG
FT                   ADLSIPALTDKDIDDIALGAELEVDWVAISFVRSRDDLLLARHYLTRHNSRARLMAKIE
FT                   KPSAVARFDEILEEADGIMVARGDLGVEMPLEEVPAVQKRIILKSVQAGKAVITATQML
FT                   ESMIKNPSPTRAEASDVANAIFDGTDAVMLSAETAAGQYPVEAVSFMTRVAKTIEATQE
FT                   YKDRLNALRPPATRTVQDAIARAVDDVVESTGAKAVVVFTSSGGAARRVARTRPPVPIL
FT                   ALTPNPHVRNQLALVSDVLPLLAPDPKDTDDMVQIAVAKAKETGLAEVGEYVVIAAGVP
FT                   FGVRGTTNMIRVERVS"
FT   gene            5855..6997
FT                   /locus_tag="Mrub_0005"
FT   CDS_pept        5855..6997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A3SC39 Putative uncharacterized protein; KEGG:
FT                   rde:RD1_2059 hypothetical protein; COGs: COG4188
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26787"
FT                   /protein_id="ADD26787.1"
FT                   /translation="MLKRLAMVLLLSGIAMAQGVNVKRPDAPPLAARGSAVVGVRTLQL
FT                   TDPGRQNRSITVEVWYPASGIQQNTVYPSVIGQTPVQIAGRANRDAAPASGKFPLIVAS
FT                   HGQPGTRFQFAYLNEHLASQGFVVAALDHPGSTYQTLTQPNYISSIVDRPLDILFAIGA
FT                   VAQQIPNADAGNVGLLGYSYGGYSVINAAGAGLDGAALSEYCRASNNEGPCFALPFFTQ
FT                   LEAQRGLNAVKPDARIKAVFAMAPYGQPWIGARSLANLRVPLFVAAGEDDDVATYRRDA
FT                   LEYFRQAGSQDKYLLSLAAAQHNPFVECPPEVRGREEDYWRCFEPVWDMERAHDLVKHF
FT                   ATAFFRRFLLNDNEAGRFLNPSLPGFKPRTTVGVRLETAR"
FT   gene            7104..7295
FT                   /locus_tag="Mrub_0006"
FT   CDS_pept        7104..7295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: threonine dehydratase protein ; K01754
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26788"
FT                   /protein_id="ADD26788.1"
FT                   /translation="MSHHLQIERLLEASRRIDPVFLHTHAGAAGLAVPFQYDHLKGRRV
FT                   AAVLCGSNLTPAQMEAWL"
FT   gene            7292..8032
FT                   /locus_tag="Mrub_0007"
FT   CDS_pept        7292..8032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0007"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: pmy:Pmen_3295 AzlC
FT                   family protein; COGs: COG1296 branched-chain amino acid
FT                   permease (azaleucine resistance); SPTR: A7D5P3 AzlC family
FT                   protein; InterPro IPR011606; PFAM: AzlC protein; TIGRFAM:
FT                   4-azaleucine resistance probable transporter AzlC"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26789"
FT                   /protein_id="ADD26789.1"
FT                   /translation="MNPSLNSPKAAFWRGFVEILPMTIGVIPFGLVTGIAGLRAGLSTL
FT                   EITLMSALVFAGASQLVALQLMHSGAAIPLVLLAGLVVNLRYVMYSSAIARHLEPFRGW
FT                   LKPLAAFLLVDQNFALTMERYQRLGPRCTPWYFLGGGVPQYITWVSSTYLGALLGARVP
FT                   ERWGLEFAIPLGFMVLLIPALRDRPSLAAALVGGLVATALVSLPYRLGLFIGALAGIAA
FT                   GVWLENRKRGRAWEDAPKEIKEGP"
FT   gene            8087..8410
FT                   /locus_tag="Mrub_0008"
FT   CDS_pept        8087..8410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0008"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; SPTR:
FT                   A7D5P4 Branched-chain amino acid transport; KEGG:
FT                   pmy:Pmen_3294 branched-chain amino acid transport; COGs:
FT                   COG4392 membrane protein; InterPro IPR008407; PFAM:
FT                   Branched-chain amino acid transport protein (AzlD)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26790"
FT                   /protein_id="ADD26790.1"
FT                   /translation="MTSLDIWLNILGLALIAFAVRYYPMALLERFRLPPLVRQGLRYVP
FT                   AATLAGLVFPALLTHNGRWAGLAHPELWAGLVAALVAWRFKNALLTIGVGLLALWLLRS
FT                   VGL"
FT   gene            8407..9276
FT                   /locus_tag="Mrub_0009"
FT   CDS_pept        8407..9276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0009"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="KEGG: maq:Maqu_2902 hypothetical protein; SPTR:
FT                   A4TWV7 Putative uncharacterized protein; PFAM: protein of
FT                   unknown function DUF6 transmembrane; InterPro IPR000620;
FT                   PFAM: Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26791"
FT                   /protein_id="ADD26791.1"
FT                   /translation="MRLAFWAPIIFVLLWSTGFVGAKFGLPYAEPFTFLWVRMLIVAGL
FT                   LSALAGVLRSAWPRGWALNLHIGVSGLLLHAGYLGGVFFAISRGMPAGLAALIVGLQPI
FT                   LTALLAQPLLRERVSAVQWAGLLLGFGGVGLVVGEKALSARILHIEPSAFVAIVLALLS
FT                   TTLGTLYQKRFAAQMPLIGGTVVQYLAAAAGLFVLSLLFRETMQIRWTPQFILAMAWLV
FT                   LVLSVGAILLLMYLIRNNSASRVASLFYLVPPATALEAYVLFGERLGVLALLGMGLTAL
FT                   GVALVVRR"
FT   gene            complement(9282..10352)
FT                   /locus_tag="Mrub_0010"
FT   CDS_pept        complement(9282..10352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0010"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="SPTR: A3HSK9 Putative oxidoreductase; PFAM:
FT                   Luciferase-like monooxygenase; KEGG: mlo:mlr4867
FT                   oxidoreductase, (N5,N10-methylenetetrahydromethanopterin
FT                   reductase); COGs: COG2141 Coenzyme F420-dependent N5
FT                   N10-methylene tetrahydromethanopterin reductase; InterPro
FT                   IPR016048; PFAM: Luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26792"
FT                   /protein_id="ADD26792.1"
FT                   /translation="MEPKPFEIGLYTFVENTPDPYTGQLQDPAQRMRDLLEQAHLADQV
FT                   GLDVFAVGEHHREEYLASAPAVVLAAIAARTRRIRLTSAVTVLSSDDPVRVFQQFATLD
FT                   LLSGGRAEIMAGRGSFIESFPLFGYDLDDYSALFEEKLELLLKIRAQERVTWSGRFRPA
FT                   LHDQPVYPRPVQNPLPVWVAVGGTPQSVVRAATLGLPMALAIIGGMPERFAPLFDLYRQ
FT                   TARRLGHAPQPLSINSHGFIADDPREALELAYTSSSYIMNRIGQERGWPPQSRAQYEAS
FT                   TGLRGANFVGHPEQIIEKILFQHKIFGHQRFLLQLTVGTLPHRKVLRAIELLGTEVAPV
FT                   VRKEIASKSNPSVATT"
FT   gene            complement(10411..11421)
FT                   /locus_tag="Mrub_0011"
FT   CDS_pept        complement(10411..11421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0011"
FT                   /product="Polyprenyl synthetase"
FT                   /note="SPTR: A0Z484 IdsA; PFAM: Polyprenyl synthetase;
FT                   KEGG: dvm:DvMF_2490 polyprenyl synthetase; InterPro
FT                   IPR000092; COGs: COG0142 Geranylgeranyl pyrophosphate
FT                   synthase; PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26793"
FT                   /protein_id="ADD26793.1"
FT                   /translation="MVADISPAQVRAAIQQYLLDALPKPEAATRLELAQFARMLRDYPE
FT                   RGGKMLRGTLLVYTGLAYGASLEGVLPVAAALELFQNWALIHDDIEDASDERRGKPALH
FT                   KLYGVPLALNAGDALHARQWALLVEAGASRAVLLEFVRMVEQTAQGQHLEMSWMEGQRF
FT                   DLGEPDYLEMVGQKAAYYTAVAPLRLGALAAGAEPPAIFSEAGLKLGIGFQIVDDVLNL
FT                   MGDPAKYGKEIAGDLWEGKRTLILLRFLQQASPEERRRAEALLRIPREQKPAPEVQWLH
FT                   QRLLQSGAVAQAQQVAERLLAEGLEALEPVLRGAPRGAYGALVLEILQSLVRREA"
FT   gene            12401..12622
FT                   /locus_tag="Mrub_0012"
FT   CDS_pept        12401..12622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26794"
FT                   /protein_id="ADD26794.1"
FT                   /translation="MAKLVRKYNPYTNKFEMVPEDWVLRYNPFQNRHEFAPADNRFSYL
FT                   PTNGEFSAIPAPPKYNPHQETFSPGKRD"
FT   gene            12797..13459
FT                   /locus_tag="Mrub_0013"
FT   CDS_pept        12797..13459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0013"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; SPTR: Q9RUB7 Phage
FT                   shock protein A homolog; COGs: COG1842 Phage shock protein
FT                   A (IM30) suppresses sigma54-dependent transcription; KEGG:
FT                   scl:sce5472 chloroplast membrane-associated 30 kD protein;
FT                   InterPro IPR007157; PFAM: PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26795"
FT                   /protein_id="ADD26795.1"
FT                   /translation="MGILDRLSRLIRANINDLIKRAEDPEKIVEQALEDMRSALREARM
FT                   EVAEAMAELRKLEREQQSYAEQARAWEQKAAEALKGGREDLAREALKRKQQAQALADGF
FT                   AQQVAQQQTLVNQLTTQLKALEGKIQESEAKKALLIARKKGVEAAETVRRFESKVDAHS
FT                   AVEAFEDMERRIEAMEDKHAALSELDKSDVEKELESLGSNKAVEDDLARLKRELGMA"
FT   gene            complement(13538..14296)
FT                   /locus_tag="Mrub_0014"
FT   CDS_pept        complement(13538..14296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26796"
FT                   /protein_id="ADD26796.1"
FT                   /translation="MPWQYVPLLHHLEELYRKPRDLTRFRAYLAKVLNAQGDDVELVPL
FT                   IAANPMAKEHALAYVQELLALQAEALAQAAMEEAAQQLPPVQAQLKVSLTVLDDARGGW
FT                   THRYTTQKGLWGLSERELALAHRYGWVSIPCWTSEKPSPEYIRQQTRLHLYQAAWSYHQ
FT                   AIPKTLREILVYEGQALRFAGAVQWLDDEELAYTRAVLEPHLDSTHYPTLLVALEGDPA
FT                   AQALGYPPLGLSPKAGLALALAEATTHNSS"
FT   gene            14322..14795
FT                   /locus_tag="Mrub_0015"
FT   CDS_pept        14322..14795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26797"
FT                   /protein_id="ADD26797.1"
FT                   /translation="MAGIALLELMLLLLAVGLLLWVFGASRNLPPAQEEQAHRLEAALA
FT                   EIGRLGGRLPHLHDALKPAQQYGRDLRKLLPQLAELERFLAKPSTEGPTRDRLLVRHHE
FT                   LLQGFERGVEYLERLGAELLLISGSEEPPALAELPQLLIELREILHPLSPTRG"
FT   gene            14805..15485
FT                   /locus_tag="Mrub_0016"
FT   CDS_pept        14805..15485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26798"
FT                   /protein_id="ADD26798.1"
FT                   /translation="MRRIALLLLLLLGACAPRATEPQSNTALIQGPVGFYPSQPGLDWV
FT                   YLPPRASLGDPPVRLSVLGPTTFEGQPAIRYRLSGRGLERSYYRQVDAAGVRLLGMEDF
FT                   DRLQVTRYTPPIQEYPPQASLVVGARWGGQTREVIELRAGNNVTRVSDRVLDYTYTVLG
FT                   KSNVTVPAGSFEVFRIAWEVRDPRNPNLREGFEIWFYPGVGEIYSSVNFGEQGGLSLID
FT                   RNFK"
FT   gene            15590..17449
FT                   /locus_tag="Mrub_0017"
FT   CDS_pept        15590..17449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0017"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="SPTR: Q72H81 1-deoxy-D-xylulose-5-phosphate
FT                   synthase; KEGG: mpt:Mpe_A2631
FT                   1-deoxy-D-xylulose-5-phosphate synthase; COGs: COG1154
FT                   Deoxyxylulose-5-phosphate synthase; InterPro
FT                   IPR005476:IPR005475:IPR005477; TIGRFAM:
FT                   deoxyxylulose-5-phosphate synthase; PFAM: Transketolase
FT                   central region; Transketolase domain protein; PFAM:
FT                   Transketolase, C-terminal domain; Transketolase, pyrimidine
FT                   binding domain; TIGRFAM: 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26799"
FT                   /protein_id="ADD26799.1"
FT                   /translation="MILQKVNQPQDLKTLTQEELLQLAQELRSEIIRVCAQNGGHLASS
FT                   LGAVELIVALHRVFDSPRDRLLFDVGHQAYAHKILTGRKEVFHTIRQEGGISGFTKVSE
FT                   SEHDAITVGHASTSLANALGMAIARDTLGENYHVVGIIGDGALTGGMALAALNVIGERK
FT                   PRLLMILNDNEMSISENVGALNRYFKEYQTKKWVQDTQKWGKQVLEGISPRLFSLVDRA
FT                   KEAAKLMLHQENPFYAWGIRYVGPVDGHDLPGLIHILEQIKELDGPTLLHIVTQKGKGY
FT                   GVAEEDPIYWHGPPGFNPQKPEKVSKGYSWSAAFGDAVTELAHKEPRLFVITPAMREGS
FT                   GLVKYSQTHPERYLDTGICEDVAATVAAGMALRGLKPVLAIYSTFMQRAYDQIIHDIAI
FT                   ENLSVVFAVDRAGIVGGDGATHNGVFDIAYLRTVPNVQIAAPKDALELRAMLKKALELG
FT                   GPIAIRYARDNVEKAPEGVWPEIEWGRWEVLKEGSKAYILAFGKTLKYALEAAQDHPEI
FT                   GVINARFLKPLDKGMLEALALEGYKLVTTEDHQKMGGFGSAVLEALNELGLKPDIRVLG
FT                   LPDVFFDHGSIPRMHREAGIDAAAIRAALAGMGLEVKTATRRV"
FT   gene            17645..17830
FT                   /locus_tag="Mrub_0018"
FT   CDS_pept        17645..17830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26800"
FT                   /protein_id="ADD26800.1"
FT                   /translation="MKKIFFKLLALLVGRLLARRFGYGRPYYPAHYDPHYRGGFFKPYK
FT                   YKRKKSWRKKLLDWLD"
FT   gene            17868..18491
FT                   /locus_tag="Mrub_0019"
FT   CDS_pept        17868..18491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0019"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG0491 Zn-dependent hydrolase including
FT                   glyoxylase; InterPro IPR001279; KEGG: met:M446_1047
FT                   beta-lactamase domain-containing protein; SPTR: A2UAT4
FT                   Beta-lactamase-like; PFAM: beta-lactamase domain protein;
FT                   PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26801"
FT                   /protein_id="ADD26801.1"
FT                   /translation="MKVFALAANTYLLDTPQGPLLVDSGLPGQRRRLERYLGSVKPAAL
FT                   LLTHHHLDHVGGAQMLWERYGLPIYAHPLDIPFISGEARRPPFPPIPGLGDWIANSPRP
FT                   VPKEALRPVEEGAEVMGWQVVHLPGHTPGQIGLLREGVLLAADALRVGVKGPWVPPAMV
FT                   NHDTQQARRTVGKIARLEAQKIYVGHGPPTTALAVRALAEKLGV"
FT   gene            complement(18502..18861)
FT                   /locus_tag="Mrub_0020"
FT   CDS_pept        complement(18502..18861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0020"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; PFAM: Rhodanese
FT                   domain protein; SPTR: A4AFL8 Putative uncharacterized
FT                   protein; InterPro IPR001763; COGs: COG0607
FT                   Rhodanese-related sulfurtransferase; KEGG: tgr:Tgr7_2218
FT                   rhodanese domain protein; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26802"
FT                   /protein_id="ADD26802.1"
FT                   /translation="MWGWFKNLLGLGPRVPRISALEAQEKLRAGALLIDVRTPLERKLS
FT                   KIPGSQGLPLAELARRWESLPKDRPIICFCESGSRSQQAAEFLAEKGLEVYNLAGGISA
FT                   WQAAGLPVKKGDLQR"
FT   gene            18965..19642
FT                   /locus_tag="Mrub_0021"
FT   CDS_pept        18965..19642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0021"
FT                   /product="glutaredoxin-like domain protein"
FT                   /note="TIGRFAM: glutaredoxin-like domain protein; COGs:
FT                   COG3634 Alkyl hydroperoxide reductase large subunit; KEGG:
FT                   ank:AnaeK_2804 glutaredoxin-like domain protein; SPTR:
FT                   B5IAV2 Glutaredoxin-like domain protein; InterPro
FT                   IPR011903; TIGRFAM: Glutaredoxin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26803"
FT                   /protein_id="ADD26803.1"
FT                   /translation="MFLDEKIQAQVREMLAPIQTPVEVVVFTTAGLELPGQEVGLQDET
FT                   LGLLKEVVALNPHLSLEQRSIHSDPEAQALGLRYAPTILLREKGSNRNNIRFLGLPAGY
FT                   EFSTLIETLLMLGTGESKLGEKSQADLQKVASPVRMQAFVTPTCPYCPQAVLATYKLAY
FT                   HNPNIIAEGVEASEFPLLSRRYNISGVPDTIISGATQQRILGGQPDRVFVEAAIKASAG
FT                   VVV"
FT   gene            19639..20007
FT                   /locus_tag="Mrub_0022"
FT   CDS_pept        19639..20007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0022"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   KEGG: gme:Gmet_3122 rhodanese-like protein; SPTR: A6CTX9
FT                   YrkF; SMART: Rhodanese domain protein; PFAM: Rhodanese
FT                   domain protein; InterPro IPR001763; PFAM: Rhodanese-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26804"
FT                   /protein_id="ADD26804.1"
FT                   /translation="MKAIASLVVFLVASAGLAQGFKVVTVDDLYRALPDPKTFVIDVRT
FT                   PQEYARGHVPGAVNWPLQQIEQWWSKVPKDRVVYVKCNTQNRSRVAVQYLLSRGYRNLN
FT                   LVTGGIQAWMARGYPTTR"
FT   gene            20021..20308
FT                   /locus_tag="Mrub_0023"
FT   CDS_pept        20021..20308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0023"
FT                   /product="protein of unknown function DUF156"
FT                   /note="COGs: COG1937 conserved hypothetical protein; KEGG:
FT                   pzu:PHZ_c1054 hypothetical protein; SPTR: A1BZQ7 Putative
FT                   uncharacterized protein; PFAM: protein of unknown function
FT                   DUF156; InterPro IPR003735; PFAM: Uncharacterised BCR,
FT                   COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26805"
FT                   /protein_id="ADD26805.1"
FT                   /translation="MTTVPEAPPNLRFDVQDKTRIIHRLRRLEGQVRGLQKMVEEDREC
FT                   REILTLLSGVKRALDSVGEEILEAYLARCQAGPGQPQPAQVIEVVRLLRK"
FT   gene            complement(20460..20921)
FT                   /pseudo
FT                   /locus_tag="Mrub_0024"
FT   gene            complement(20909..22066)
FT                   /locus_tag="Mrub_0025"
FT   CDS_pept        complement(20909..22066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26806"
FT                   /protein_id="ADD26806.1"
FT                   /translation="MKVMGVHPEVGLLLLAVASGLALCWPARAEPVWRWASLGTLLWGV
FT                   QAAVWLLERQGGLEAPLTPSGVLLFAAALTWAATLRQLPLYEPPRLTLALLPFALAALV
FT                   TALSVLPNRSSQMVWLTDLLPVLLALPLLESALHGQAGESRLIWGLGLIFKAGGSWALA
FT                   LGWPPGGFVYPVWALGFVLIGWGGYLEATEARLGKGLLGFVLGGLLGSLVLLGWPSQVA
FT                   HPFHSMVLVGWGYVVLVTLGGVGWGVYQRIIKAERQLELWINLLESLSSKAQSTQNLTP
FT                   QGVLHSVMEGLQPLYGNLVGIEVRSDVTIRAGQNGPYVYTFELALDTPTEGRLYFSSAP
FT                   KDTRRLEALAPLLTERLRLSLTLNEWRSKAYTDPLTGVLSARCSA"
FT   gene            22206..22688
FT                   /locus_tag="Mrub_0026"
FT   CDS_pept        22206..22688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0026"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0219 rRNA methylase (SpoU class); KEGG:
FT                   bba:Bd0271 rRNA methyltransferase; SPTR: A3Z2B0 Probable
FT                   tRNA/rRNA methyltransferase; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); InterPro IPR001537; PFAM: SpoU
FT                   rRNA Methylase family; TIGRFAM: rRNA methylase, putative,
FT                   group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26807"
FT                   /protein_id="ADD26807.1"
FT                   /translation="MFKVVLYQPEIPQNAGNIARTCAATGAELHLIRPLGFQWNSAKLR
FT                   RAGLDYWPEVDYVLHDSWRAFLETLPPDGRIWAFSSKVSRLYTEVRYQPGDYLLFGPES
FT                   RGLPSEVLERFPGVTIPMPGRGGRSLNLAVAVGVGLYEALRQVGWGFRAARNLGAT"
FT   gene            complement(22681..23748)
FT                   /locus_tag="Mrub_0027"
FT   CDS_pept        complement(22681..23748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0027"
FT                   /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /note="TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine
FT                   deacetylase; PFAM: peptidase M20; SPTR: Q5SHH3
FT                   Acetyl-lysine deacetylase; KEGG: dps:DP1385 peptidase;
FT                   COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR010175; PFAM:
FT                   Peptidase family M20/M25/M40; TIGRFAM:
FT                   N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26808"
FT                   /protein_id="ADD26808.1"
FT                   /translation="MNTGLSLDPVEFLKGALEIPSVSGQERAVAQYLAEGMRRLGFTKA
FT                   WVDEADNARGQIGTGPVQVVLLGHIDTVPGEVPVRLEGQKLFGRGSVDAKGPFVTFILA
FT                   AASLPPEVLQKLTIHLVGATEEEVPSSKGARYVVDKLKPDYVVIGEPSSWQGITLGYKG
FT                   RLLVRVRREKDNFHSAHHEPNAAEELISYFVSIKAWAEAMNSGQGPFNQVQYNLRDFRI
FT                   EHPDTRQLAEMKFDLRLPPRLSVEEAVRHLSAYAPPVLDLDFSGREVPYVGPKDTPLTR
FT                   ALRIGIRQAGGEPVFKYKTGTSDMNIVAPHWKVPMVAYGPGDSTLDHTPNEHLEIPEFL
FT                   KAIEALRFALTRLAK"
FT   gene            23912..24151
FT                   /locus_tag="Mrub_0028"
FT   CDS_pept        23912..24151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0028"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: P03942 Ferredoxin; KEGG: ank:AnaeK_2333
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   InterPro IPR000813:IPR001450:IPR017900; PFAM: 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26809"
FT                   /protein_id="ADD26809.1"
FT                   /translation="MPHVIVEPCIGTKDKSCVEVCPVECIYDGGDQFYIHPDECIDCGA
FT                   CVPACPVSAIYPEEDVPEQWQDYIAKNRKLAGLE"
FT   gene            complement(24199..25482)
FT                   /locus_tag="Mrub_0029"
FT   CDS_pept        complement(24199..25482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0029"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   A6CFW4 Major facilitator family transporter; KEGG:
FT                   afw:Anae109_0793 major facilitator transporter; InterPro
FT                   IPR011701:IPR007114; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26810"
FT                   /protein_id="ADD26810.1"
FT                   /translation="MTPPPGEPRRSQILAIWEGVLAILFINWSTGMVMTGYALWLGAPP
FT                   VALAILGALPMVGQMAAPLALFFRGSRKDLSANLSVFGRGLFVLALFVPLMPEAWRIPG
FT                   LLTIAALSQLILAPVSVLWTSWMADLVPDQLRGRYFGLRNGLLGLVGTLGNLAAGALID
FT                   ALGKPWGFLLVLGLAVGAGVGATFILRRQFEPPMTSSPPRLAEYIQPLSDRRFRGFLGF
FT                   VVLFLGAVSVGGPFVFPLFLEYARMSFTQVGLWTVIAASCGLVLSPLWGRLADRIGHWQ
FT                   VLLFSSSVAALVLPPLWLAGGPGRLETIWLAAVFDAVAWGGIGTALTNVALQSAPPQKR
FT                   NLYLAWYWTAYAVGGMLGSLLGGALGNLHKNHQLFPSPYHLPILASMGLRMVAVYYLGW
FT                   RIRRDKRRALLESTAEPPSSVENKASDA"
FT   gene            25774..26199
FT                   /locus_tag="Mrub_0030"
FT   CDS_pept        25774..26199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26811"
FT                   /protein_id="ADD26811.1"
FT                   /translation="MKKSILIASLTALALSFATAQDVRIDQGDPSAVLVQWVSLLPQEV
FT                   QLDALSQGQARLLYDALSGLSYAFTPAQAQEVVQAIRQALPQDEVQALERAAAQTASLS
FT                   DSDKEALVYFSGAQFEDSLRTALAQLSVAVTPDYSGE"
FT   gene            26438..27142
FT                   /locus_tag="Mrub_0031"
FT   CDS_pept        26438..27142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0031"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG: dac:Daci_0123
FT                   two component transcriptional regulator; COGs: COG0745
FT                   Response regulators consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain; SPTR: A3RYN8
FT                   Transcriptional regulator, two component response
FT                   regulator; PFAM: Transcriptional regulatory protein, C
FT                   terminal; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26812"
FT                   /protein_id="ADD26812.1"
FT                   /translation="MSSTADTLDSMALVLVVEDEPEIAEILEGYLRREGFRTERASDGR
FT                   QALNLVRAARPDLVLLDIMLPEMDGLEVLRRIRSSGHTPVILVTARTEDLDKLLGLELG
FT                   ADDYVTKPFSPREVVARVKAVLRRVVLAEAPKEVLRVGPLEIDSEKVVARLGGVRLELT
FT                   PTEFRLLEALARTPGKAFSRAELLEAALPDSDALERVVDVHLKNLRRKLEAAGGAGLLE
FT                   TVRGVGYRLWTE"
FT   gene            27163..28434
FT                   /locus_tag="Mrub_0032"
FT   CDS_pept        27163..28434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0032"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: psb:Psyr_2867 sensor histidine kinase; COGs: COG5002
FT                   Signal transduction histidine kinase; SPTR: A7CBG9 Sensor
FT                   protein; PFAM: His Kinase A (phosphoacceptor) domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26813"
FT                   /protein_id="ADD26813.1"
FT                   /translation="MRFFNRIEVRLSLLMALVVVATSLLTVGLNTYQRERTFRELPAEV
FT                   RDILRRSDSRLPALGFPSELRDVLLSGQEIRVRLEPNPDPENPNPVFVLSLPDGSGTEI
FT                   RVQPPPRLRRPNLETRLQQNLLIASLAATGLGVLLALIFARRIARPIEAISDAAGRLAQ
FT                   GDLKARVGPQPGEDEVARLARNFDQMAEALERLEAERRAMIADIAHELRTPLTVMQGRL
FT                   EAIQDGVMPLEMSEVDRLHQQARLLSRLVEDLRTLSLADAGRLNLTLQPLNLAELADRM
FT                   ADTFQAALEAKRITLERRLPEGPVLVRADSDRLAQVIGNLLSNALGHTPAGGWIGLEVA
FT                   AEAAQARLRVLDSGPGIPAEALNKVFDRFYRAEASRSRATGGSGLGLSIVKALVELHKG
FT                   TVTARNRPEGGAVFEVRLPLHQAG"
FT   gene            complement(28422..29762)
FT                   /locus_tag="Mrub_0033"
FT   CDS_pept        complement(28422..29762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0033"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: sfu:Sfum_2006 integral membrane sensor signal
FT                   transduction histidine kinase; COGs: COG0642 Signal
FT                   transduction histidine kinase; SPTR: A6F2K0 Sensor protein;
FT                   PFAM: His Kinase A (phosphoacceptor) domain; HAMP domain;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26814"
FT                   /protein_id="ADD26814.1"
FT                   /translation="MSLRLRLALFIALAIALALLVQGFLGYASFERLQMGNLERDLNAY
FT                   LARIADQLEGRRGPPRLFRRDRDGDSGTEWMERLRDNTPPLPLPNPAPVGTIAHARLVQ
FT                   GQVVLREWGSFPDEIPLDNRPEARLEQNWLYRSVRLGPELYLQGALEASQVRASLAGYQ
FT                   QTVLFTALVVALLGAWVAWLVSGPALRPLRHLQQAARRVADSGDLSLRVPAEGSGELLH
FT                   LSQTFNQMLERLSAFRQRETEFTRNAAHELRTPLTSLRLQLDALQQGLASPEETLSVVR
FT                   EEVERMTHLSESLLTLAREGRGQRVGLDVAQLAQEVAQKAGVPYQGPLHLETSGDPFLL
FT                   RQALENLLSNAQKYAPGAPVRLELAHSDDHRFAILRVQDEGPGMPPEVLKRAAEPFYRA
FT                   PGTRVPGNGLGLSVAAQVAQVHEGRLELRNLEPRGLAAELWIRIQPA"
FT   gene            complement(29759..30421)
FT                   /locus_tag="Mrub_0034"
FT   CDS_pept        complement(29759..30421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0034"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG: psa:PST_2709
FT                   probable two-component response regulator; COGs: COG0745
FT                   Response regulators consisting of a CheY-like receiver
FT                   domain and a winged-helix DNA-binding domain; SPTR: A5XX47
FT                   DNA-binding response regulator; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26815"
FT                   /protein_id="ADD26815.1"
FT                   /translation="MRLLLVEDEPNIARPVLRALEAQGHQVRHAPDLTTARALLAEAEP
FT                   DLMILDVRLPESEDGGFILAREARAAGYKGPILFMTARDALADRVMGLDEGGDDYVVKP
FT                   FDLPELLARVRALLRRMSEVKQSRVQLGPLELDLADRSVRWEGRLVELSGREYALLERL
FT                   ALFPGRVYSPEELLDLIWGEEASDTGVVKVCVHHLRNKLDSRVVRTVPGGYRLGVEP"
FT   gene            30591..31055
FT                   /locus_tag="Mrub_0035"
FT   CDS_pept        30591..31055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_02263 protein GlcG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26816"
FT                   /protein_id="ADD26816.1"
FT                   /translation="MNKTLKTLLVVSSLAVAGAFAQQTPAPQPTPMQPRAMQRMAAPKG
FT                   LIGNLYWSAAQFLGVTPAELAVLSGGTKTLAQVATDLGKTPAALEAALVTARNQAIDQA
FT                   VQAGRLTAEQANTLKASSQAVAKAFVAQPVQLRMGLGGRGDWDGPRGRGR"
FT   gene            31166..31426
FT                   /locus_tag="Mrub_0036"
FT   CDS_pept        31166..31426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2741 hypothetical protein; SPTR:
FT                   Q46BC1 Putative uncharacterized protein; PFAM: Predicted
FT                   membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26817"
FT                   /protein_id="ADD26817.1"
FT                   /translation="MWMMDYRGRWDGFGYYGFGWMDDVLWALLLLGLIALVAVLIVRLL
FT                   RSPTNGSKAAPDRALEIARERYAKGEISQAEFETLKKNLSG"
FT   gene            31522..32235
FT                   /locus_tag="Mrub_0037"
FT   CDS_pept        31522..32235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0037"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; SPTR:
FT                   A3VF44 Putative protocatechuate dioxygenase; InterPro
FT                   IPR000627:IPR002052:IPR006311; COGs: COG3485
FT                   Protocatechuate 3 4-dioxygenase beta subunit; KEGG:
FT                   noc:Noc_2416 intradiol ring-cleavage dioxygenase; PFAM:
FT                   Dioxygenase; TIGRFAM: Tat (twin-arginine translocation)
FT                   pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26818"
FT                   /protein_id="ADD26818.1"
FT                   /translation="MDNDDKPIGTILNRRKVLAALGLGGLAGVGGLMNGQRAAAQNNAL
FT                   PSCIVRPALTEGPYFVDVQLNRSDIRSDPTTGVVKPGVPLSLRFVVSRVSASGCTPLPG
FT                   AMVDIWQCDAQGLYSGVQDRFADTRGQKWLRGYQITDAQGVAQFTTIYPGWYPGRTVHI
FT                   HFKIRYQNRDFTSQLFFDDALSDRIFANPPYVKTGTRTRNANDSIYRNGGSQLLLNLTQ
FT                   SGQGYAATFDIGLNL"
FT   gene            32316..33224
FT                   /locus_tag="Mrub_0038"
FT   CDS_pept        32316..33224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0038"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; SPTR: A6C767 NosX
FT                   protein, putative; InterPro IPR003374; COGs: COG1477
FT                   Membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis; KEGG: sus:Acid_5642 ApbE family lipoprotein;
FT                   PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26819"
FT                   /protein_id="ADD26819.1"
FT                   /translation="MPLALFKPRPYRHQAHYEGVLGTTLTLQVRARGSQQARAAEAAVL
FT                   AEIDRLERIFSSFSPESEFARWQAQGVAQLSPELQALLRAAEGWMAHTHGAFNPAAAAI
FT                   QALYRQNPEPAEGELEALRRALQGPLWRLEGRTAHKLTALPLTLNALAKGHIADRAAQA
FT                   AVAQGAEEVLLNLGGEIRHIGSQPVRVAVANPWAGADNALPLARLTICSQGVATSGRSQ
FT                   RGAHLFDPRTARPATQVVQATVVAPDAATADVLATAFCVLEPMLSLALAEVFGVGCLLV
FT                   EANGRTHTNPRFAQEETEVTR"
FT   gene            33221..33757
FT                   /locus_tag="Mrub_0039"
FT   CDS_pept        33221..33757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0039"
FT                   /product="periplasmic protein"
FT                   /note="SPTR: A6C767 NosX protein, putative; InterPro
FT                   IPR006311; COGs: COG3656 periplasmic protein; KEGG:
FT                   sus:Acid_5642 ApbE family lipoprotein; PFAM: Predicted
FT                   periplasmic protein (DUF2271)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26820"
FT                   /protein_id="ADD26820.1"
FT                   /translation="MKRSLISRRNFIHRSIGLVLTLWAGQSLAQTRWAGMKLDITFEFV
FT                   GNGFRYRPPYVAVWLEDAQGLPVRTLAVWFEQSRKGPRWLNELRRWYRSNEPTEAVSGP
FT                   TRMPGRYTLSWDGKDDKGNLVNQGDYYVCVELVREHGPYELFREKVILAQTPFKRSYNV
FT                   AGELKEVSLSYDRQG"
FT   gene            33741..34367
FT                   /locus_tag="Mrub_0040"
FT   CDS_pept        33741..34367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0040"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   SPTR: A6C766 Putative uncharacterized protein; InterPro
FT                   IPR005625; COGs: COG3295 conserved hypothetical protein;
FT                   KEGG: sus:Acid_7488 PepSY-associated TM helix
FT                   domain-containing protein; PFAM: PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26821"
FT                   /protein_id="ADD26821.1"
FT                   /translation="MTGRVRMPVEKAQKPLRSRVYALARWLHLYASMLSLLVVLFFAAT
FT                   GITLNHPEWVFGNTQTIHTYQGTLPQGWQQGGEINWLKAAEALRAAHGLRGRVNDTRAD
FT                   DQEASISFRAPGYAADAFISRADGSYTLKVVAQGPVAVLNDLHRGRDAGPAWAWLIDLS
FT                   GGFLLLVALTGFVLSLYFRKTRSAALTVALTGLGVLLLLTWLAIR"
FT   gene            complement(34357..36069)
FT                   /locus_tag="Mrub_0041"
FT   CDS_pept        complement(34357..36069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; SPTR: A0BUP6
FT                   Chromosome undetermined scaffold_13, whole genome shotgun
FT                   sequence; InterPro IPR008313; COGs: COG3538 conserved
FT                   hypothetical protein; KEGG: hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF1237)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26822"
FT                   /protein_id="ADD26822.1"
FT                   /translation="MELMTPAPILDAPPEHLPTGNLEVHLEASPKAPSIARIGVASLGL
FT                   NGLLDWVGAPLLEVSGQGWQLSRLADWIPCWENEHLTVTLLAPYGERGVALHIEPRLPG
FT                   PIQVAGNLEYLGLRRFREEPLDCLFRSGHDTWTGSHVLEARAERTLLALGLQADPPPRH
FT                   IDWGLQFVLEWDAGPVTLYLGLAPEADGARTTALHLRRVGWENLLRKTLHKLALLSTNY
FT                   AGPLYEVYRRHLIFSYFYAQADTLEGEPVVLTSRSPHYYVSGAYWARDALLWFFPALLK
FT                   ADRKRARAVLKAVFQRYARWPGEHAQYLGGPPLYPGFELDQAAAYPLALARYLEATGPN
FT                   PELVAELREPLAWVLARVAEEKHPSLTLYRTFLSPTDDPVREPYLTYDNALWCVALERL
FT                   APFWPEAEALRLEARAIRETLYRQAERNGRFVFSFEPGGPHTFADEPAGSLLLLPHLGF
FT                   CSRQDPIWQATALWILGSDNPHHYKGRFPGEGSAHFPFPSGFGLANRILSGLMRPAGDA
FT                   LMILEQAPLDQGYACESFDPETGQARTGVGFAALAGFIAYALAAGKDPKGATV"
FT   gene            complement(36078..36269)
FT                   /locus_tag="Mrub_0042"
FT   CDS_pept        complement(36078..36269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26823"
FT                   /protein_id="ADD26823.1"
FT                   /translation="MKESLGRRIQRQYRTHLVSFAAGVLVGVMFADWLRGIVTALFVLL
FT                   VLLALYFIWVYFDNLKKQ"
FT   gene            complement(36340..37152)
FT                   /locus_tag="Mrub_0043"
FT   CDS_pept        complement(36340..37152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0043"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A0ZJR0 Permease protein of
FT                   sugar ABC transporter; InterPro IPR000515; COGs: COG0395
FT                   ABC-type sugar transport system permease component; KEGG:
FT                   oan:Oant_2483 binding-protein-dependent transport systems
FT                   inner membrane component; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26824"
FT                   /protein_id="ADD26824.1"
FT                   /translation="MKRLSTFLIYLLLTLGSLVMFFPFVWMFLTSLKPFAEIFELRLLP
FT                   QAPTLDNYREVLFDTQFPRWFLNSLIVAIITTASVLFFDSLVGYTLAKLRFPGKGFIFV
FT                   LILSTLMVPTEMLIIPWYVMSTEYGWSNTYWGLLFPGLISAFGVFLMRQFFDTLPTDLL
FT                   DAGRIDGLSEFGVFWRIAFPLVRPALAALGIFTFLGNWNAFLWPLIVVQTADMRTVPVG
FT                   VALFSSEAGTAWNLIMAASSLAVLPVLLVFLFFQRQIIEGVVLTGVKG"
FT   gene            complement(37152..38066)
FT                   /locus_tag="Mrub_0044"
FT   CDS_pept        complement(37152..38066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0044"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A4BGH5 Putative
FT                   binding-protein-dependent transport protein; InterPro
FT                   IPR000515; COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; KEGG: atc:AGR_L_458 sugar ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26825"
FT                   /protein_id="ADD26825.1"
FT                   /translation="MRPSEPARRGVSLAHREALWALAFLIVPLAFFLFIRIWPAFQALW
FT                   LSLFDWHADPSQRPFVGLEHYHQMLDDRLLLKALQNTLAYTLLGVPLQLLLGLCIALLL
FT                   NAVTRFRDVFRAIYFAPYVTPAAAIAWVFSWMLSPNFGIVNEILGVFGIPPQPFLTSPS
FT                   QALATVTMVVVWQNLGFQVVLFLAGLQNIPRDYYEAARIDGANNWQLFRHITLPLLNPV
FT                   MVFSAVIGTIGFLQLFTQVVNLNFTDQGGPLGSTLTLALYIYQQAFARFDLGYAAAITV
FT                   LLFVIILVITLVQLRLLSRRVEY"
FT   gene            complement(38205..39449)
FT                   /locus_tag="Mrub_0045"
FT   CDS_pept        complement(38205..39449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0045"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   oan:Oant_2485 extracellular solute-binding protein family
FT                   1; SPTR: B5IRL8 Bacterial extracellular solute-binding
FT                   protein, putative; PFAM: extracellular solute-binding
FT                   protein family 1; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26826"
FT                   /protein_id="ADD26826.1"
FT                   /translation="MRKALFILTVLLGAALAQGQVTITYWQYDFKSKVEAVNELIKKFE
FT                   AANPGIKVLHQTFPFDAYQQKVASSIPAGQGPDVVNLFYGWLPTWVKAGYLQPLPAEYT
FT                   RVLDNEFSSLAQAAKVGGRLYGMPTAVRSLALFYNRDLLNAAGFKNPPKTWDEFLSIAA
FT                   KLTVKDGNRFSQLGYAMAPDGQDHHLVREVLVRQFGGRPYSDDGRRVLYGDAAGLRAFT
FT                   FYTDWFKKYNVGTLGNQFFPGNNAYRDAFIAGRVGMIVDGSFAIGTIRSGAKFNWGVAE
FT                   LPVEKVGGRKVNYGSFWMHGLTPLATGPKLAASLKFLEFLVSEETQRYWLEKVGELPAR
FT                   KSLIKDPKLTLDRIFGPFVLSLSYAKATPFVDEIGQRKVMTDAINRVLLENRDPAESWR
FT                   IAAAEEQKLLDAFWK"
FT   gene            complement(39626..40051)
FT                   /locus_tag="Mrub_0046"
FT   CDS_pept        complement(39626..40051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0046"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; SPTR:
FT                   A7JPS5 Possible ATPase; InterPro IPR003442; COGs: COG0802
FT                   ATPase or kinase; KEGG: eba:ebA4453 hypothetical protein;
FT                   PFAM: Uncharacterised P-loop hydrolase UPF0079; TIGRFAM:
FT                   conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26827"
FT                   /protein_id="ADD26827.1"
FT                   /translation="MLLKHLEDTRSVAHRLAHSLPEGALVLLTGPMGAGKTTLVQFIAQ
FT                   ALGFRGEVTSPTYTLIHEYPSPQGLIVHIDAYRMADQEELFNLGLEDYLPEARLVLIEW
FT                   GKPEVFPDSLEIRLTPTEHGRRLELIPHGRASLPKLA"
FT   gene            40126..41331
FT                   /locus_tag="Mrub_0047"
FT   CDS_pept        40126..41331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0047"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   A6E7B4 Tetracycline resistance protein; InterPro
FT                   IPR001958:IPR011701:IPR007114:IPR005829; COGs: COG2814
FT                   Arabinose efflux permease; KEGG: rce:RC1_1688 tetracycline
FT                   resistance protein, class C; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26828"
FT                   /protein_id="ADD26828.1"
FT                   /translation="MSKSASIPFILISVLINVMGLGLVIPVLPKLIETLAGGVEAGARL
FT                   NGLFFAVYAVMQFAFGPILGMLSDRYGRRPVLLASLVGTAVDYLIAALTQSIWVLFAAR
FT                   VIAGALGASLSTANAYIADISKPEERARNFGLIGATFGMGFVLGPVLGGLLGNIDLRLP
FT                   FYFAAGLAFLNFLYGYFVLPESLKPENRNTQARSLNPFVALGILRKTPILRGLSLSLAL
FT                   IFLAFGSLQSVWVLYTAYKFGWEPLEVGFSLFLVGLGGVIVQAGLVRPVVAHLGERRAL
FT                   TLAQSMGLFSFTLYGLATQGWMMYAIIALAALSNLGQPLIQSFLTREVSPQEQGTLQGA
FT                   LAGLQSLTVAVGGLLGGFLFSVVARPEVAPWLVGLPFFVGALLYATAAANTARLFRGLR
FT                   GS"
FT   gene            complement(41328..41819)
FT                   /locus_tag="Mrub_0048"
FT   CDS_pept        complement(41328..41819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0048"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; InterPro IPR002589;
FT                   KEGG: sfu:Sfum_0998 Appr-1-p processing domain protein;
FT                   COGs: COG2110 phosphatase homologous to the C-terminal
FT                   domain of histone macroH2A1; SPTR: A8A9L9 Appr-1-p
FT                   processing domain protein; PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26829"
FT                   /protein_id="ADD26829.1"
FT                   /translation="MARIQVAQGDITEFAGDAIVNAANNHLILGSGVAGAIRRRGGPSI
FT                   QGECDRHGPIRVGEAALTGAGQLPVRKVIHAAVLGDQPATLDTVRSATQAALRLALEHR
FT                   LYRLAFPLLGTGVGGLGVPQVAEVMLDELEAAPDPLEITLYGYSQADAEAIRQALARRR
FT                   "
FT   gene            41858..42160
FT                   /locus_tag="Mrub_0049"
FT   CDS_pept        41858..42160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0049"
FT                   /product="Tchh; trichohyalin"
FT                   /note="KEGG: Tchh; trichohyalin"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26830"
FT                   /protein_id="ADD26830.1"
FT                   /translation="MYIMYNRVMVRKQLYLRPEHERLLKQKARETGLSEAELMRQALDQ
FT                   FFRDVDAPLPGHVEALGAFLREAQQISKQHRLPAEWRFRREEAYTREARWEREKT"
FT   gene            42157..42591
FT                   /locus_tag="Mrub_0050"
FT   CDS_pept        42157..42591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0050"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A7BSJ7
FT                   Putative uncharacterized protein; InterPro IPR002716; COGs:
FT                   COG5573 nucleic-acid-binding protein contains PIN domain;
FT                   KEGG: tgr:Tgr7_3220 PilT domain-containing protein; PFAM:
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26831"
FT                   /protein_id="ADD26831.1"
FT                   /translation="MKYRYLVDTNLLIYPLDARDPRKQQQAANVLLELVQEGRAALPVQ
FT                   ALSEFASVALRRLEPPLSPQQVGLEVERLMQAFPVLPLTAPVVLEALRGVTQHRLSYYD
FT                   AQVWATARLYQVPLVLSEDFPTGAVLEGVRFLNPLEDALG"
FT   gene            complement(42588..43694)
FT                   /locus_tag="Mrub_0051"
FT   CDS_pept        complement(42588..43694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0051"
FT                   /product="peptidase C45 acyl-coenzyme A:6-aminopenicillanic
FT                   acid acyl-transferase"
FT                   /note="PFAM: peptidase C45 acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase; InterPro
FT                   IPR005079; KEGG: pol:Bpro_1442 peptidase C45, acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase; SPTR: A5DPG6
FT                   Putative uncharacterized protein; PFAM: Acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26832"
FT                   /protein_id="ADD26832.1"
FT                   /translation="MAEGMLPYLQLSGPPYEQGHQQGTAWAGQIAHNLELYFHRFEVEC
FT                   KLSPSEARERGARYFQAIREQNPAYAQGLEGIAAGSGQPLVDIATLNVRYEIVYHQFAQ
FT                   DTPPVYPAREAPNGCTAFALMPAHSADGHLWLGQNWDWMEGVQGALQHITEPDGTRILA
FT                   FTEAGIFGGKIGLNSHGLGLCINGLVSVGDNWAGLGKPFHLRTYEALRQKTLEAAQAVV
FT                   LEEPRTASGNFLLGQGAQAVDIEVSPQGVCRWQDERQLVHANHYLAPERYGIEVPPIEW
FT                   LDRSHHRAERLALRLGEVEKPGLEDLKAALSDRDGAPYAVCRTASPEEYALGEPYRTIV
FT                   SVIMNLGTKELWISDGPPHENPYVHYQV"
FT   gene            complement(43702..44505)
FT                   /locus_tag="Mrub_0052"
FT   CDS_pept        complement(43702..44505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0052"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; InterPro
FT                   IPR006186:IPR004843; KEGG: mxa:MXAN_5467
FT                   metallophosphoesterase; SPTR: A4C405 Putative
FT                   uncharacterized protein; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26833"
FT                   /protein_id="ADD26833.1"
FT                   /translation="MIHCRAVHYVVGDIHGCLQPLIRLLQREGFIGEGLEWIGGSNQLW
FT                   FLGDYTDRGPDGVGVIELLMRLELEATAAGGAVHALLGNHDLMLLAAHHFTDTEIPSFK
FT                   RQGQSVTFREIWKQVGGQARDLERLNEAHIEWLSNRPALALVENTLLMHADSLFYLEWG
FT                   ESLAQINRNLYDILHSDRVETWDLLAEQFSSRFAFLEGGTALTEEFLGQLGGHRLVHGH
FT                   TPIYSLIGYPPQRVFYPLEYNDGLCFNVDHALWRGGPGFTFHLGP"
FT   gene            44519..45106
FT                   /locus_tag="Mrub_0053"
FT   CDS_pept        44519..45106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0053"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; SPTR: A7CMB6 Chromate
FT                   transporter; InterPro IPR003370; COGs: COG2059 Chromate
FT                   transport protein ChrA; KEGG: rpi:Rpic_0832 chromate
FT                   transporter; PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26834"
FT                   /protein_id="ADD26834.1"
FT                   /translation="MPRSRLFLAFLQVGLVAFGGGGQAQIYQSIVLKHRWMEEREFLET
FT                   TALCRILPGPVFANTAAHIGTRLGGVLGGVLALLGVLTPGASLMLLLSFAYFRFGAVPG
FT                   SLAEHALNGVAAAAIGLILATMLRQAPIALDSLKAIGLALVVFVTYGLLHWPLLLVLLL
FT                   TVPVGMGLYWSEAAENPAHHRAGQGMEADGRG"
FT   gene            45099..45617
FT                   /locus_tag="Mrub_0054"
FT   CDS_pept        45099..45617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0054"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; SPTR: A2W6U6 Putative
FT                   uncharacterized protein; InterPro IPR003370; COGs: COG2059
FT                   Chromate transport protein ChrA; KEGG: spe:Spro_2328
FT                   chromate transporter; PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26835"
FT                   /protein_id="ADD26835.1"
FT                   /translation="MGETLEVFLAFLRFGVLSFGGGMANLPEMARVIIGNGWVTRQEFA
FT                   DGFALGQFVPGPNMLAVLFYGLSAAGLGGALAAALGMFLPGAVGAMWLVWGWAWMSRAQ
FT                   WSRALRKALVPISMGLGASMVLVLVQLSVDSLFWGLGVLLACYLIYRGVSVVIVIAGGG
FT                   LLGLLTGLL"
FT   gene            complement(45628..46428)
FT                   /locus_tag="Mrub_0055"
FT   CDS_pept        complement(45628..46428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0055"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: hch:HCH_02205 acetyltransferase (GNAT)
FT                   family protein; SPTR: A4BBE4 Acetyltransferase (GNAT)
FT                   family protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26836"
FT                   /protein_id="ADD26836.1"
FT                   /translation="MKLKSLGLRTELMLRSFESHIEVKPSYIVVRTPQNPTYRWGNYLI
FT                   FQAPPEPGDLQRWKQIFHDELGLLNHFVFTWDFVNGEQGAAQEFLEAGFWLEQTVVQTT
FT                   QKVHPPRTLNTHCQCRAFHSDTDWAQWLEMALIQNAALPAEEREGEGYEIFLKHKAAEY
FT                   RRMIAAGWGNWFGAFVGGQLAASMGLFAKDGLGRFQSVDTHPDFRRQGLAGTLLYHVAQ
FT                   YGFGELGAKDLVILADLHYFAKDLYTSVGFRPTEHLVALEWALA"
FT   gene            complement(46558..47445)
FT                   /locus_tag="Mrub_0056"
FT   CDS_pept        complement(46558..47445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0056"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: mxa:MXAN_1686 acetyltransferase, GNAT
FT                   family; SPTR: A0YP58 Acetyltransferase, putative; PFAM:
FT                   Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26837"
FT                   /protein_id="ADD26837.1"
FT                   /translation="MTFDSRPYRPADLEPLTAFVIECWRRTPTPSELMCPGDFVWGVLQ
FT                   NASYKPEEGIRIWEQGGAVVGFVLQKRAKFDLYMAPWLSPEERSELLRAMVTHAETHAL
FT                   GLDPTARVSTSAARSNLETIQTLQALGYAQSPFMMYFLERPLDKDIPPPRLPEGFVVRH
FT                   LEPHEMGERVDIHLEVWHPSRFSMQSYLNIRSAPLYRPDLDLVTVSPEGRFASYCIIWY
FT                   DPVNRIGEFEPVGTRPTFEGRGLGRAVLTEGFRRLKALGAKTACVACEPDTLEFYQSAG
FT                   FTEVNQWLDFSKTL"
FT   gene            complement(47645..48610)
FT                   /locus_tag="Mrub_0057"
FT   CDS_pept        complement(47645..48610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0057"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: acp:A2cp1_1057 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26838"
FT                   /protein_id="ADD26838.1"
FT                   /translation="MSFSIRPFTPADYPEMARVRNLIWPDNPVLAETLKASDERRKPGL
FT                   ILRRLVAEKNGEVVGWASFFHMEWIYHPQKFGVGVSVHPTHQNQGIGTALYERMMQELQ
FT                   PHDPIKLLASTRADKPEALRFAEKRGFREEFRTWESKLELAKFDPAQWAKAVEKVLAQG
FT                   YEVRSFAELASDPEREHKMYELDKEGSHDVPLPPGESFTFPDMERYWENVRSNPDFRPE
FT                   LWFLAVKDGEYAGVSMLFHRPADNDLNTGFTTVKRAHRHKGVALALKVAALTHAKNLGK
FT                   TAVRTENAQTNRSMLGINEALGFEKMPAWIDLVKVLREEN"
FT   gene            complement(48607..49599)
FT                   /locus_tag="Mrub_0058"
FT   CDS_pept        complement(48607..49599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0058"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; COGs: COG3153 acetyltransferase; KEGG:
FT                   ank:AnaeK_1054 GCN5-related N-acetyltransferase; PFAM:
FT                   Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26839"
FT                   /protein_id="ADD26839.1"
FT                   /translation="MKPNLTIRPFEEHDYPAIAEVLKAAWPDEAHSVAGLREGDRHAPE
FT                   IKWGRFVAEQDGQVVGVAHYTQFEGMYHPQKFAVWVTVHPRFRSQGIGKALYRQAMEAL
FT                   KPHDPISILSTTREDQPQAMAWLKKLGYVEKMRYWESRLDVRNFDLASWAGKIEAVEAA
FT                   GFQLRSLKELEADPQHRQKLYDLWLEVRQDVPRPGELSEVRFEDYCKWIFESQYYLPEG
FT                   HFVAVDPHTGQYAALSTLWKTDGDYLQTGLTGTRRAYRRKGLALALKLKAIQFAQTMGI
FT                   REIRTGNESNNRAMLAINEALGFVKQPIWTDYVLALGEETSSPAEQELS"
FT   gene            complement(49619..50602)
FT                   /locus_tag="Mrub_0059"
FT   CDS_pept        complement(49619..50602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: ank:AnaeK_1054 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26840"
FT                   /protein_id="ADD26840.1"
FT                   /translation="MQVRPFLFSAADYQTYAAVRQAAHPESPPDLAGLQHLDRTRTQGD
FT                   VLARFVVEVAGEAVGVLEYATPYYDPRPGVLEVQYYLHPHHQALEGPLWQFLQGRIAPH
FT                   QPHALQTTVREDWPQYRFLTAQGFVEVERRWDSVLDLAHFDPSPLARPLPPGLTIQPLS
FT                   ALPWQEEAFQRDLYALEIELLGDVPTAEPITPWPFEVWQERSLKGPNLLPEGFFVALEG
FT                   THLVGLTMLFKSHRPQTLQTGLTGVRRSHRRRGLALALKLRAAEFARVYGARYIRTSNH
FT                   QINRPMLAINEALGFVKEPARVLLRLSPVPLKPGQPAFGGSSDPQP"
FT   gene            50784..52025
FT                   /locus_tag="Mrub_0060"
FT   CDS_pept        50784..52025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A3071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26841"
FT                   /protein_id="ADD26841.1"
FT                   /translation="MWGVVISSLLTTLLVVVFSHRGRWGHTPFYMLLGAVGLLVWSSAW
FT                   FPGLYFGLLALQVGLLLASLDQPPRWGRTWRGLLLLGGLGLGVDFLLRALGLPLPSRAG
FT                   HLVALGLGVLLGGGVVRWLYPRLAPKGPVRALAVVLPLLALTNSGLLFLATQERLDRLV
FT                   LGFLLQVISAGPLLAFYLEALQHQRRSASIESVYAALLDTVAALPHRSEAELWSRLLAS
FT                   AVQVVPGAQAGSIRLRQGADFVFVAQQGFDEGVLGLRSSAHEAMAWHGDPLQWRRGQPR
FT                   IANHADLQRIWATQAANCRLYERLNRASHQRIQQIRSTLCVPIPLGDEVMAEINLDAFH
FT                   DRAFDHRSIEVARQYAQQVRALLAVHRQQSELEARVRELEVIEALSGALRGLKGTSEIT
FT                   RRLHSSAAAARSRW"
FT   gene            52054..53451
FT                   /locus_tag="Mrub_0061"
FT   CDS_pept        52054..53451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0061"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SPTR: A0ZHS2 Two-component response regulator; KEGG:
FT                   mag:amb1211 response regulator; COGs: COG2206 HD-GYP
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; InterPro
FT                   IPR006674:IPR003607:IPR006675; PFAM: HD domain; GAF domain;
FT                   TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26842"
FT                   /protein_id="ADD26842.1"
FT                   /translation="MFLEIKDTLVPRGWGLGWAAIETRAPIWLDQAHLDQRAYGQFRHP
FT                   PEAYSEIVIPLLNSQGQPLGVLISARNGERAYLERDVRLLQIIGNIAANTLERVRANES
FT                   LEAEIAEKTALLELSQMLGGNDAALLPAAMEKIRQMGHADAIALGVQEPDGYHLRWLTG
FT                   HLGAEAKEFLQKPLPLEHPLVNLIPIEKAFRVGDTAAHPLLKPYARVGIRGLYLRTVVH
FT                   EPELKVVLALMRLEPSPGWGPAEDRLLEGAAQILGALLLRLERTRQLETAYEGALRAIG
FT                   LALEARDRETAGHTDRVAALVEQLGRALGLSEAELRDLRWGAYLHDVGKLALSDAILLK
FT                   PDKLTPEEFCTMRTHTHLGDDLVRNLPFVPLAARQIVRHHHERWDGRGYPDGLAGEDIP
FT                   LAARIFAVCDVFDALCSHRPYKTALSPEQAAQELWRSAQSGHLDQNLVKVFLETQGLEA
FT                   ATSQAAD"
FT   gene            53507..54226
FT                   /locus_tag="Mrub_0062"
FT   CDS_pept        53507..54226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0062"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; SPTR: A6C2N0 Putative short-chain
FT                   dehydrogenase; InterPro IPR002347:IPR013968:IPR002198;
FT                   COGs: COG1028 Dehydrogenase with different specificities
FT                   (related to short-chain alcohol dehydrogenase); KEGG:
FT                   oan:Oant_3756 short-chain dehydrogenase/reductase SDR;
FT                   PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26843"
FT                   /protein_id="ADD26843.1"
FT                   /translation="MVEFSRDLLGLEQRIVMVTGAGRGFGRSIARSYARNGATVITVDP
FT                   DVEMATAIASEVEQLGAPAIPIRGDMSVVLDVINTFEKIEELFGMLDGIVHVTSAESKT
FT                   PFVELLEAEWYDLLNADVKSSLYVLQQGLRYLSGGGFVTLVLPPLQREQPHVAAIRGAV
FT                   TGLIEGATRVFPTNVRVNGVIPSRDPVGEEHDRSLVRVAVALGSMVSEGVRGQLLEVLL
FT                   PDPPHQPEIYDLLRELP"
FT   gene            54264..54785
FT                   /locus_tag="Mrub_0063"
FT   CDS_pept        54264..54785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0063"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; SPTR: Q5SM09
FT                   Transcriptional repressor nrdR; InterPro
FT                   IPR005144:IPR003796; COGs: COG1327 transcriptional
FT                   regulator protein consists of a Zn-ribbon and ATP-cone
FT                   domains; KEGG: smd:Smed_0817 hypothetical protein; PFAM:
FT                   ATP cone domain; TIGRFAM: transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26844"
FT                   /protein_id="ADD26844.1"
FT                   /translation="MNCPFCGNPDSRVLDSRPSDEGSVIRRRRECPVCKRRFTTYERAQ
FT                   VEPLLVIKRSGRKETFDPNKLLRGLSLAARKRPIDPEVLQEFAFGFEDTVKEMEITSEE
FT                   IGLRSLAFLKELDPVAYIRFASVYREFDSLENFIEEVRKLDRKPGKGKKAQKAEEETPD
FT                   LADEAKLGTV"
FT   gene            54821..55558
FT                   /locus_tag="Mrub_0064"
FT   CDS_pept        54821..55558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0064"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; SPTR:
FT                   A6DEI7 Putative uncharacterized protein; InterPro
FT                   IPR003743; COGs: COG1579 Zn-ribbon protein possibly nucleic
FT                   acid-binding; KEGG: protein of unknown function DUF164 ;
FT                   K07164; PFAM: Putative zinc ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26845"
FT                   /protein_id="ADD26845.1"
FT                   /translation="MSDPLAELNRLQERDLELDQIREDQSRVPDELAQAREHFRKLEIS
FT                   LGDLQEQLREVRLAYNKLDLELQDLKSKREKAKAAQAQATGAKEQTQYGEQIRQLSGLI
FT                   EDLEGNNKDIVGQIMPLLEQIEKLEAELAQVKAQMEEARPKLEALETANQARVDALEAE
FT                   YQSKKVSRDQLAATIPTAIVKEYESIRRARKGTGLTKMAKAGNGYRCTACNVQLPMHVA
FT                   QQVHQASKVVRCPSCGRILWKGA"
FT   gene            55575..56066
FT                   /locus_tag="Mrub_0065"
FT   CDS_pept        55575..56066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0065"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; InterPro IPR000086; KEGG:
FT                   smt:Smal_2419 NUDIX hydrolase; SPTR: A6DL70 8-oxodGTP
FT                   nucleoside triphosphatase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26846"
FT                   /protein_id="ADD26846.1"
FT                   /translation="MPYTPILATLGFVLSPDRQEVLLVYRNARSQDPAYGLYNGLGGKL
FT                   EPHEDVVAGMRREILEESGLTALQLHLRGTISWPGFGRQGEDWFGFIFLITEWTGSPHA
FT                   ANGEGELHWVPIQKILRQELPMWPGDRYFLPLVFDADPRPFHGVMPYRGGQVLSWSFSR
FT                   "
FT   gene            56244..56522
FT                   /locus_tag="Mrub_0066"
FT   CDS_pept        56244..56522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26847"
FT                   /protein_id="ADD26847.1"
FT                   /translation="MITIHRSGQYRFYVNSGYNLEPPYICVKHEGHVAKFSLQPLALQS
FT                   NNGFSRTELSRIQQAVLDARDQLLKHWANVRGTEGEKPSGELLLHQE"
FT   gene            complement(56527..57291)
FT                   /locus_tag="Mrub_0067"
FT   CDS_pept        complement(56527..57291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0067"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   A3SKK6 Short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mno:Mnod_3437 short-chain dehydrogenase/reductase SDR;
FT                   COGs: COG1028 Dehydrogenase with different specificities
FT                   (related to short-chain alcohol dehydrogenase); InterPro
FT                   IPR002347:IPR002424:IPR002198; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26848"
FT                   /protein_id="ADD26848.1"
FT                   /translation="MFHGKVVLVTGAARGIGRAIAEAFAEEQALLVLCDVRPEGLEVAK
FT                   RLGGLFVYADLAQPEHRERLVEQAVKQWGGVHVLVNNAAIAPPGSALKVGLADWRQALE
FT                   VNLTAPMHLSALAAREMVKEGGGAIVNVASVQGLFAEQNNAAYNASKGGLVNLTRSLAL
FT                   DLAPMKIRVNAVAPGAIATENVLEAIQMSPHPELTRQDWEDLHALRRLGRPEEVAQAVV
FT                   FLASEKASFITGAILPVDGGMTASFMMAGRPV"
FT   gene            57383..57637
FT                   /locus_tag="Mrub_0068"
FT   CDS_pept        57383..57637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0068"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   InterPro IPR007159:IPR006339; KEGG: tgr:Tgr7_2437
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain protein; PFAM: SpoVT / AbrB like domain; TIGRFAM:
FT                   looped-hinge helix DNA binding domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26849"
FT                   /protein_id="ADD26849.1"
FT                   /translation="MAQGLVSGKYQLTLPVEVRKALGIKPGDRVEYVVKEGRLEIWVIR
FT                   PDLSKVLDEVLAEHDFAALRAETHDDAVRYVREMRSLDD"
FT   gene            57630..57875
FT                   /locus_tag="Mrub_0069"
FT   CDS_pept        57630..57875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26850"
FT                   /protein_id="ADD26850.1"
FT                   /translation="MISLDTNVIFSALNKAGVHHDRARQLLKKYGALVLSPVVHAELMA
FT                   SSDAPGIQLFLQKAQISTLWEVPPAVWEAAGRGFGQ"
FT   gene            complement(58025..58906)
FT                   /locus_tag="Mrub_0070"
FT   CDS_pept        complement(58025..58906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0070"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="TIGRFAM: N-carbamoylputrescine amidase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; InterPro IPR003010:IPR017755; KEGG:
FT                   rce:RC1_0659 hydrolase, carbon-nitrogen family; COGs:
FT                   COG0388 amidohydrolase; SPTR: A3LHA0 N-carbamoylputrescine
FT                   amidohydrolase; PFAM: Carbon-nitrogen hydrolase; TIGRFAM:
FT                   N-carbamoylputrescine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26851"
FT                   /protein_id="ADD26851.1"
FT                   /translation="MTKLAVVQMSMTADREQNVAKATQMVREAAAQGAQIVLLPELFES
FT                   LYFCQVERERFFALAHPVEHHPFLPHFQQLARELQVVLPISFFEKAGQAYFNSLALIDA
FT                   SGEVLGVYRKSHIPDGPGYEEKYYFNPGDTGFKAFPTRFGHVGAGICWDQWFPECARSM
FT                   ALLGAEILLYPTAIGSEPAEAGGVDTKDMWQRAMIGHAVANLCYLAAANRVGTEVVEGH
FT                   TQTYYGSSFIADYMGNKLAEAGRSEETILLAELNLEEARAFRAGFGFFRDRRPELYGPL
FT                   LTLDGKTRAPRS"
FT   gene            complement(58917..59963)
FT                   /locus_tag="Mrub_0071"
FT   CDS_pept        complement(58917..59963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0071"
FT                   /product="Agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PRIAM: Agmatine deiminase; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase; InterPro IPR007466; KEGG:
FT                   sat:SYN_02393 peptidylarginine deiminase related enzyme;
FT                   COGs: COG2957 Peptidylarginine deiminase; SPTR: A3HZY5
FT                   Peptidylarginine deiminase related enzyme; PFAM:
FT                   Porphyromonas-type peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26852"
FT                   /protein_id="ADD26852.1"
FT                   /translation="MENLTPRALGFRMPAEWAPHAATWTAWPYDEEKWLGYLEPVRQEF
FT                   AAFVNTLARFEPVHLVLHDEESERDARQRLAGPITFHRIPHDDLWLRDSGAIFVTRTPP
FT                   SGPVEVAAVNWEFNGWGGKYPAQQDNQMPLQMARILGMGLFEAGIVMEGGSLEVNGQGV
FT                   GLTTRQCLLSPARNPGLDEEALEGYLQQFLGIEHLIWLGNGLEGDHTDGHIDTLTRFAS
FT                   PYTIVTAVCPDPDDPNHRPLQENLEILRSLGGFRIVELPLPKNPLWLDSETRLPLTYAN
FT                   FYIANGAVLVPIYGDPHDEQALEILRPLFPGREVIGLQSRYLITGGGSFHCVTQQQPAG
FT                   AIWPGQTR"
FT   gene            complement(59993..61099)
FT                   /locus_tag="Mrub_0072"
FT   CDS_pept        complement(59993..61099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0072"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: A3TR96
FT                   Putative L,L-Cystathionine gamma-Lyase; InterPro IPR000277;
FT                   COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; KEGG: pol:Bpro_2831 cystathionine
FT                   gamma-lyase; PFAM: Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26853"
FT                   /protein_id="ADD26853.1"
FT                   /translation="MDKPSRLRPASWLVAAGRPTAPGEPLNTPLVPASNFILGQERAYA
FT                   RDGGTPTWEALEALVGGLEDGKAVAFASGMAAVAAVFDQLPVGALVVLPDDCYQGVVGL
FT                   ALAGAEKKRWSVRRLALEDTEGWVRACGEADLIWLESPSNPLLTVVDLAAIGQAPRKPG
FT                   AILAVDNTFATPLNQQPLAFGATVSIQSATKFIGGHSDLLGGVATTRDEALWQALRKSR
FT                   ELSGATPGTLEAFLAVRGARTLALRLQKAQENAQTLALRLEQHPRVARVRYPGLPSHPT
FT                   HATARRVLKGFGSIISFELHGGAAEADAVCRRVRLIRHATSLGGVESTMERRAAIPGQE
FT                   HLPPSLLRLSVGIEDVEDLWADLEAALQ"
FT   gene            61134..61367
FT                   /locus_tag="Mrub_0073"
FT   CDS_pept        61134..61367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26854"
FT                   /protein_id="ADD26854.1"
FT                   /translation="MVQLFNADTGAPIGQISEAQLSFLVAQMEEEHAQDQDYYLNADLL
FT                   ETWREQGADPALIELLAKAMGDGEELSIRWSR"
FT   gene            complement(61368..62000)
FT                   /locus_tag="Mrub_0074"
FT   CDS_pept        complement(61368..62000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0074"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; SPTR: A2VSV8
FT                   Phosphoglycerate/bisphosphoglycerate mutase; InterPro
FT                   IPR013078:IPR001345; COGs: COG0406 Fructose-2
FT                   6-bisphosphatase; KEGG: afr:AFE_0621 phosphoglycerate
FT                   mutase family protein; PFAM: Phosphoglycerate mutase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26855"
FT                   /protein_id="ADD26855.1"
FT                   /translation="MKELWLVRHGETPWNAEGRFQGHYDINLSPQGLHQAFRVAERLAA
FT                   CRQGFDGLYSSDLQRAALTAKPIAEALRLTPTFDPRLREIYAGELQGLLRSEMQVLYPE
FT                   FHEAIQRDPWNTKRPGGESMADLAARVQEFIEELPEGRFIVVTHGGVIRAALKIVLELE
FT                   NGSWRKFQIQNTSITRLLYPEGTALSIGDVGHLEAWAEGLMDEATLS"
FT   gene            complement(62016..63023)
FT                   /locus_tag="Mrub_0075"
FT   CDS_pept        complement(62016..63023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0075"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PRIAM: Phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein; InterPro
FT                   IPR010918:IPR000728:IPR004733; KEGG: ftn:FTN_0419
FT                   phosphoribosylaminoimidazole synthetase; COGs: COG0150
FT                   Phosphoribosylaminoimidazole (AIR) synthetase; SPTR: Q24QH4
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein, C-terminal domain; AIR synthase
FT                   related protein, N-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26856"
FT                   /protein_id="ADD26856.1"
FT                   /translation="MNYREAGVDIERKAGALKAAASKIKETYTPEVLRGLGAFGGMLEV
FT                   AWLKAMAEPVLVASTDGVGTKTLLAAQTGRYGGLGFDIVNHSVNDLLVQGARPLFFMDY
FT                   IASARLEAEVLAQILASLAEACKAVGIPLLGGETAEMPGVYQEGGLDLVGTIVGVVDKA
FT                   QVVDGSRVQPGDVLLALPSSGLHTNGYSLARKVFAGWNLEEPRPELGGQSLAEALLEPH
FT                   RCYLNEVEILQREGLEIRAMAHITGGGVFENLPRVLPEGLGAEIRRGSFPIPPIFELIQ
FT                   RAGQVPEQEMYRVFNMGLGYILVLSPDVASKARQRLPQSYPVGYIMEGSGIRVV"
FT   gene            complement(63020..64444)
FT                   /locus_tag="Mrub_0076"
FT   CDS_pept        complement(63020..64444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0076"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="SPTR: Q72H75 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit B; KEGG: afw:Anae109_4336
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B; PFAM:
FT                   GatB region; GatB/Yqey domain protein; GatB central domain
FT                   protein; InterPro IPR006075:IPR003789:IPR006107:IPR004413;
FT                   TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B subunit;
FT                   COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog); PFAM: PET112 family, C terminal
FT                   region; PET112 family, N terminal region; GatB domain;
FT                   TIGRFAM: glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26857"
FT                   /protein_id="ADD26857.1"
FT                   /translation="MPDFEAVVGLEVHLHLKTKSKMFCGCDASYFGDPPNTHTCPVCLG
FT                   LPGVLPVVNAQAVEYGILFGLALNCQIAPWTQFHRKSYYYPDMPKNYQISQYDLPIAAH
FT                   GYLEVEGQRVRIKRVHLEEDAAKSTHPEGASYSLIDLNRAGSPLIEMVTEPDIRTPEQA
FT                   RVFLSHIRSIAQTLGVSDANPEEGKMRADVNVSVRRVGEPLGTKVEIKNLNSFRSVARA
FT                   LEYEIRRQQEILRSGRRVEQATLGFDEAAGKTYVMRLKEGEADYRYFPDPDLPPIVVDE
FT                   AWLERLRAAMPELPAQKYARYVEAGVRPYDAEILAYNPSLARFFDQTLAHHQGNPQTVA
FT                   NLLNAEVAGYLNERLVEVQETALTPQHLAALAGLFERREITNRVLSQLLPEVMEGADPL
FT                   KLVEERGLRAVADEGALRPLVERVVAANPKVVEQVKGGNLKAANALLGPIMKETKGTAK
FT                   ADVVKKMLGEMLGVEL"
FT   gene            64653..64730
FT                   /locus_tag="Mrub_R0001"
FT   tRNA            64653..64730
FT                   /locus_tag="Mrub_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(64795..65304)
FT                   /locus_tag="Mrub_0077"
FT   CDS_pept        complement(64795..65304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0077"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; InterPro
FT                   IPR008258; KEGG: zmo:ZMO1186 lytic murein transglycosylase;
FT                   SPTR: Q859R5 ORF27; PFAM: Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26858"
FT                   /protein_id="ADD26858.1"
FT                   /translation="MEANPRLKNTSCSECGGRSLAAVVAGALAQAEGLEVPPDLVVAVA
FT                   WHESTFNPHVDRVAEALRISNNGANCASGTEIGPMQVKPCAFRTVRLDPTLLLNMPTPV
FT                   RIQYAVSAGILYLRWLKNIRLPGASWCEVLHAYNVGPGAFLAGQRNASYVQAILGKVGE
FT                   YSELRV"
FT   gene            complement(65613..66083)
FT                   /locus_tag="Mrub_0078"
FT   CDS_pept        complement(65613..66083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0078"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26859"
FT                   /protein_id="ADD26859.1"
FT                   /translation="MFNLLGMKPEEIITQAQGAVKALEERLACLEDRLAAIQRTLEYEY
FT                   GRPRRDVAGHDPARLPLISQIDVYGIPTGEVFGYNRSHLDVAGVLGKPATRGHLVNMGY
FT                   SNVQIWFSYGSSKVGPYILPPSAALEISFLVEKVEFEVDLEGGYSKIQVLFQ"
FT   gene            complement(66062..66259)
FT                   /locus_tag="Mrub_0079"
FT   CDS_pept        complement(66062..66259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26860"
FT                   /protein_id="ADD26860.1"
FT                   /translation="MAAATNSGTNLWQAYKQGVGVGLGLLTVYALALLILALLVRQSIG
FT                   NLPTQPPQEGGPTKCSTSWA"
FT   gene            complement(66368..66790)
FT                   /locus_tag="Mrub_0080"
FT   CDS_pept        complement(66368..66790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26861"
FT                   /protein_id="ADD26861.1"
FT                   /translation="MNWTDFIPSGNLWIVWLLQASLAVGVITLFAGGLIALLGKIPIVG
FT                   PILAGIVRIIAGNYERWLSERVPKLAEQVVLSVEERYRKSNLSFEERAQTKLEEAISAL
FT                   QQMAPGLGRDIAQRQVEAALSRIRATGMEQKAGGAK"
FT   gene            complement(67303..67581)
FT                   /locus_tag="Mrub_0081"
FT   CDS_pept        complement(67303..67581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26862"
FT                   /protein_id="ADD26862.1"
FT                   /translation="MDAKTLVLLAVGGVLVYFGWKALGQPQAQTDPAEPDNQQQEQPGS
FT                   GWNDGWNPDYQNPGGGAPGFGYGSFSNPCAIFPSLCRPSTPLGGYEI"
FT   gene            complement(67571..67762)
FT                   /locus_tag="Mrub_0082"
FT   CDS_pept        complement(67571..67762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26863"
FT                   /protein_id="ADD26863.1"
FT                   /translation="MEFLDAVDKGLGVVAFLAFLKLVFSDLQEIKAAMRQIEKHLAIQV
FT                   ELSAQARARKKEEVRNGR"
FT   gene            complement(67762..68403)
FT                   /locus_tag="Mrub_0083"
FT   CDS_pept        complement(67762..68403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10367 gene product from transcript
FT                   GH10367-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26864"
FT                   /protein_id="ADD26864.1"
FT                   /translation="MKPIEVFAVVGAGGLAAFGLYTYARSRPKAEETVPGIPPQVPTHP
FT                   GVSGQERTSLCQVLTGYRSKLKEYEDLRADAEKKMRDLESLAQGNCRSYAQDPTFQYHC
FT                   NGFPICGINEWWTVSGTQTNQDAYNACMTFLQAGGGLEQRKHPKKEGSSWDDTWADIDR
FT                   INSQIGAAYNQVQNLRNQYQEAQRQAEEARQQINNLRRRIADLEAQGVFC"
FT   gene            complement(68390..68731)
FT                   /locus_tag="Mrub_0084"
FT   CDS_pept        complement(68390..68731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26865"
FT                   /protein_id="ADD26865.1"
FT                   /translation="MELLGFLGSALGGLFGFLGEDRKARAIEEAARAQVQTSRNLVDGA
FT                   IAQWAELRRAEEAKAAAQRDLGYWQEDTQRTRIYYNYQAARSGQAALLLVTGAGLLGVI
FT                   LWRLGREAD"
FT   gene            complement(68733..69071)
FT                   /locus_tag="Mrub_0085"
FT   CDS_pept        complement(68733..69071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0085"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26866"
FT                   /protein_id="ADD26866.1"
FT                   /translation="MSFSTGNAYQITFNDNNLATSGPAEPPLWKQILGGLGDVSSLLDP
FT                   YIYTDQEKARYDLLKAQAEAEKARALAEAEKARAAGIAVQPQPAVPAWVWVVGAAALVL
FT                   VLVLMLRD"
FT   gene            complement(69086..69961)
FT                   /locus_tag="Mrub_0086"
FT   CDS_pept        complement(69086..69961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0086"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26867"
FT                   /protein_id="ADD26867.1"
FT                   /translation="MAILDNLGNLLRRGLDTFRDLPRLETSNSQQAAAPVRPAPAAVQM
FT                   SDWAFAWIDGEDIESTGFPYRANEWFPLAQMRTPETAHFRVMAGEKRLRVYLKGQQTVA
FT                   GQNLGAPQARTVNLPYLIQSAQGAPTLPSAYHPDVAVWAQVGGVWQKLVITSVNYAGGQ
FT                   VTFTEPAGVPTTSNIEIYYTHADGQFRFRVARDAGGIDDSVATVFNQSFGTMHSVDQNN
FT                   LETMLAWPQQVELVPGTRLVLEVRTTQVPMVWNDRAGHYVHIAALARRVQVLDKGQINR
FT                   LAELENRAGL"
FT   gene            complement(69974..70483)
FT                   /locus_tag="Mrub_0087"
FT   CDS_pept        complement(69974..70483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0087"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26868"
FT                   /protein_id="ADD26868.1"
FT                   /translation="MQEAFNRIKTIRPSARPITLIKGGPDYRDYTGRQRVKVAEFVVPQ
FT                   GASWVIANPLPVVLKLYDTGGNQLPHDTDVFLARKTRGFDAPEFLGKIQYAGYYDLSEA
FT                   QQRDAKYYQNILATLSPAKGGVTPQGFAFREGDILEVYVESSATPALADARTRIELPVG
FT                   VDNSTI"
FT   gene            complement(70499..70915)
FT                   /locus_tag="Mrub_0088"
FT   CDS_pept        complement(70499..70915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0088"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S9 Major structure protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26869"
FT                   /protein_id="ADD26869.1"
FT                   /translation="MAEQAAIQAGRDMQKLASTSNPLEVVQNPIVVATSLGVLGAYMAR
FT                   KTIYTSRRDLFGWAAKGPDGKVRYYKVGSDGKPTTTEVPNAYTNRLLLNLGGVLLGTLL
FT                   INNKLTDDPMVDYIGLGVAAGSFANLVMTLLAID"
FT   gene            complement(71064..71738)
FT                   /locus_tag="Mrub_0089"
FT   CDS_pept        complement(71064..71738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0089"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26870"
FT                   /protein_id="ADD26870.1"
FT                   /translation="MAGRQTFRILIVGKSGSGKSTLARQILLRMVGRFRKLVIVNRKTE
FT                   FSDLCEARFRVKEEGDPSRALRRHSRVFFHVTGYDPRAFLDALGAEIMRQRDVLLLVDE
FT                   AYHFFPRGAVPKGLFEVLTGGREAGHNAIFVTQMLQGLTGGIDPGVRKQASHLVTFRVT
FT                   EPNDVRAVSEHFPELGERVRTLARPDDGLPPEYGVKNLDREEGGLVLRNPQNPRRRMWV
FT                   RL"
FT   gene            complement(72362..72556)
FT                   /locus_tag="Mrub_0090"
FT   CDS_pept        complement(72362..72556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0090"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: B3XVS9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26871"
FT                   /protein_id="ADD26871.1"
FT                   /translation="MNFDAIKNNAFPIAVLAGSLYLGLGRLKNLREGQGCPKCETAQAV
FT                   VAFALAAWAGWELWQQYQV"
FT   gene            complement(72553..73122)
FT                   /locus_tag="Mrub_0091"
FT   CDS_pept        complement(72553..73122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0091"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; SPTR: A3UD36
FT                   N-acetylmuramoyl-L-alanine amidase; InterPro IPR002508;
FT                   COGs: COG0860 N-acetylmuramoyl-L-alanine amidase; KEGG:
FT                   ngk:NGK_1784 putative amidase; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26872"
FT                   /protein_id="ADD26872.1"
FT                   /translation="MLLILLLGVVLMNQPRPRKSAYLVLDPGHGGRDPGAVDPNSGTRE
FT                   SDLNLAQALTLKEYLVALGYTVGFTRTTDVFVPLAERTRMAQAQGARVFVSVHHDTPTA
FT                   PGPGVYYSAHPLSRSLAERIAAVLRGAWVRPSSASRFGRLYIDDFPGPAVLVEFGPTRP
FT                   VSREERIARAQAVASPIASYVQEVVV"
FT   gene            complement(73070..73402)
FT                   /locus_tag="Mrub_0092"
FT   CDS_pept        complement(73070..73402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0092"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26873"
FT                   /protein_id="ADD26873.1"
FT                   /translation="MLILGLRLQTQEEVEAFTRAFQGGVLPMLPPAPVLDALKVGEALA
FT                   AYGIGKNRLPLQGGVEHLPPWLRILLGAGVMAMSVYGGMRAVQEIRARSAPNPPAGGSA
FT                   DEPAQA"
FT   gene            complement(73521..73934)
FT                   /locus_tag="Mrub_0093"
FT   CDS_pept        complement(73521..73934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbk:BARBAKC583_0145 TolA domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26874"
FT                   /protein_id="ADD26874.1"
FT                   /translation="MTLRLPEPLLAEPVEMPALQPEAPRQVEAVPLGPDELDPVVTQAV
FT                   ESQPEVSMPKTAAVENENPSEKVSKEKAEPANPKPTPKSVQGYAVAVLGAVLVVAAAVL
FT                   GMKGGTGATTPCGNCGGNRTGGSAVSGSGPIIY"
FT   gene            complement(73938..74450)
FT                   /locus_tag="Mrub_0094"
FT   CDS_pept        complement(73938..74450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0094"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26875"
FT                   /protein_id="ADD26875.1"
FT                   /translation="MAFQRVPVNSDKPLGPGTYEIVLAHQSGDISRVTRSDLERALQAK
FT                   YGSSIKVLDWGKKGSDLVIRLQVTATPTASTSGAQDPWAITPALSWYTPDDLIQPAFLP
FT                   ALPAIFTAAAVIAILYLTWRIVATIKETVQLVPEPARSVAVTGSGVGLAALGIGVLALA
FT                   VWPRGRR"
FT   gene            complement(74556..74849)
FT                   /locus_tag="Mrub_0095"
FT   CDS_pept        complement(74556..74849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0095"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26876"
FT                   /protein_id="ADD26876.1"
FT                   /translation="MEDIRKGRPSRRLLDLASRKREPVPLESQPLEMLLYALFGNLQAA
FT                   RSIGQALGGDIRNIHGWDIRDLESLPGVGRGVIGKLAALVEIVRRLHQKKAT"
FT   gene            complement(74854..75225)
FT                   /locus_tag="Mrub_0096"
FT   CDS_pept        complement(74854..75225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_2992 Smr domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26877"
FT                   /protein_id="ADD26877.1"
FT                   /translation="MNDKKLNPLRLVLLTVLIGYFAFLFTRPQPEEPLVTQAPAPATTP
FT                   APTATPTNCLGQITQVAQGANEIRLTITGSAERILVYTDQGNITAATPEVGSGGEYRIR
FT                   TPGPATAVQLDDCPVLNLR"
FT   gene            75307..75813
FT                   /locus_tag="Mrub_0097"
FT   CDS_pept        75307..75813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0097"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_1491 hypothetical protein; SPTR:
FT                   A7KH28 NapU3"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26878"
FT                   /protein_id="ADD26878.1"
FT                   /translation="MERLQRTPRLFDRLDRRITFFLARNSLGVLRVSLGLVFLWFGLLK
FT                   FFPGLSPAQDLAGRTIEVLSFGLVPPAWGLLILAAWESLIGLGLIFAQPHSFVMRATLL
FT                   LMALQMLGTLLPIFFFPAEVFTRFPYAPTLEGQYIIKNLVLVAAAMVVGATVRGGYLKP
FT                   EPAES"
FT   gene            complement(75820..78300)
FT                   /locus_tag="Mrub_0098"
FT   CDS_pept        complement(75820..78300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0098"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="TIGRFAM: ATP-dependent helicase HrpB; PFAM: Helicase
FT                   ATP-dependent domain protein; helicase-associated domain
FT                   protein; helicase domain protein; SMART: helicase domain
FT                   protein; DEAD-like helicase;
FT                   InterProIPR007502:IPR001650:IPR013689:IPR014001:IPR
FT                   014021:IPR010225; KEGG: pae:PA3961 ATP-dependent helicase;
FT                   COGs: COG1643 HrpA-like helicase; SPTR: A3KYL5 Putative
FT                   uncharacterized protein; PFAM: Helicase conserved
FT                   C-terminal domain; ATP-dependent helicase C-terminal;
FT                   Helicase associated domain (HA2); TIGRFAM: ATP-dependent
FT                   helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26879"
FT                   /protein_id="ADD26879.1"
FT                   /translation="MKDASLPIYTVLPALRKALGTHRTVVLQAPPGAGKSTLLPLELLK
FT                   EPWLEGQKIWMLQPRRLAARNVAARMADLLGEPVGQTVGYQVRFERRVGPATRIEVLTE
FT                   GILTRRLQQDPGLEGVGLILFDEFHERSLQADLGLVLCREVQQALRPDLRLLLMSATLD
FT                   AEGLGAFLQAPVLTAEGRQYPVEIRYLPKDPEGPLPGVVAGAVSRALAEQAGDVLVFLP
FT                   GVGEITRVERLLTERHPEIKITPLYGDLPLAAQQAAILPDPARRKVVLATSIAETSLTI
FT                   EGIRVVVDSGYSRLPRFEARSGLTRLVTVRVTRDAAQQRAGRAGRLGPGVCYRLWSPAT
FT                   DAQLLPQRRPEILEADLASLVLELARWGVQDPFALDWVTPPPAGALRQARDLLEALGAL
FT                   EGPTLTERGKALLEWPTHPRLAHLLLEGLALGQGALATDLAALLEERDPLPRETGADLG
FT                   LRIEALRHWRQTRQALHSAETGVLSRVERLSQEWRKRLGVTADNRPPEPHMVGLLVAQA
FT                   YPDRLAHLREGDRLRYRLSGGRGVRLGEDDPLAGTPWLAVAHLDAGQEEGRIFLAAPVE
FT                   PEHLAPRARPVEHIAWDARNGVLLAQRELRIGEVVLSKEPLARLEPARRREVLCRAVRS
FT                   EGLGLLPWTEALRQWQARVLSLRSWRPQEGWPDVSDAHLLETLEDWLAPWLDGVSRRED
FT                   FGRLELQSLLGGLLPWPLPARLEALAPTRLEVPSGSKIKLTYSPDGSPPVLAVKLQELF
FT                   GLADTPTVNEGRTPVLLHLLSPAGRPIQVTQDLKSFWNNTYPEVRKELRGRYSKHPWPE
FT                   DPWNAEPTRKTKPR"
FT   gene            78367..78588
FT                   /locus_tag="Mrub_0099"
FT   CDS_pept        78367..78588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26880"
FT                   /protein_id="ADD26880.1"
FT                   /translation="MFGFIWFLFTVFAAFVAAQLVRKPRFWRTDSPALGEVISVWLILT
FT                   LVMAGSLVGLRKLLAQLWPQSPVWLSAR"
FT   gene            78721..78924
FT                   /locus_tag="Mrub_0100"
FT   CDS_pept        78721..78924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26881"
FT                   /protein_id="ADD26881.1"
FT                   /translation="MSRVEEYLPWAEIFIQTRRVVAVRVDAERGEYEALSETGSSYFIE
FT                   RLEQAQALLQVLQAAEQCIEKV"
FT   gene            79172..80362
FT                   /locus_tag="Mrub_0101"
FT   CDS_pept        79172..80362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0101"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; Arsenical pump membrane
FT                   protein; SPTR: A7CSU5 Citrate transporter; InterPro
FT                   IPR000802:IPR004680; COGs: COG1055 Na+/H+ antiporter NhaD
FT                   and related arsenite permease; KEGG: sus:Acid_4340 citrate
FT                   transporter; PFAM: Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26882"
FT                   /protein_id="ADD26882.1"
FT                   /translation="MELLAYLVLGLTYLGLGLGYWPGYRMNRAAIALTGAAFLIVLGVL
FT                   NFEEAWRALEPHTLGFLFGVMVLNAHLAYAGFFQLTLNGLVHLARSPLGLLVWLTFGTG
FT                   LLSALFLNDTIAILFTPLVLALTRTLGLPPVPYLLALAGATNLGSVATLTGNPQNIVVG
FT                   SLSRITYLDFAAALTPVALVGLAVQVGLLYALYPAVRSRAPLPPLPPLRFRFNRALLFK
FT                   GAWITLALLAAFVLGYPLAQAALIAAGLLLWSRRIRSERFFMRVDWELLVMFSGLFMVT
FT                   AAVKKLGILTLLEPLAATAPGLAGVTVLLSNLISNVPAVLLLYPLIPAGDTQGWLLLAA
FT                   ASTLAGNLTLLGSVANLIVAEAARREGYRLSFGEHLRFGLPLTLITLLVAYAWIYR"
FT   gene            80343..81008
FT                   /locus_tag="Mrub_0102"
FT   CDS_pept        80343..81008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0102"
FT                   /product="protein of unknown function DUF633"
FT                   /note="PFAM: protein of unknown function DUF633; SPTR:
FT                   A1HPB2 Putative uncharacterized protein; InterPro
FT                   IPR006901; COGs: COG2384 SAM-dependent methyltransferase;
FT                   KEGG: pfl:PFL_2370 hypothetical protein; PFAM: Family of
FT                   unknown function (DUF633)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26883"
FT                   /protein_id="ADD26883.1"
FT                   /translation="MPGFTAKLEPRLEAVAQEISAPTHADIGADHALLPRHLLLSGRVQ
FT                   RVIVVEKHRGPWENSRRALEGLCAEVRLGDGLGPLAPGEADSLSLCGMGARLMVKILSA
FT                   HPERLPPRLVLQPNDSALPLRRWALEAGYALVNEQMVQGFWRYSILTLVRGPCTAYRGL
FT                   PLEAALRYGPLLLKARHPLLWAELQEKQQHLASLPPVKQVQQERVYLEQALALWEQRL"
FT   gene            complement(81005..81487)
FT                   /locus_tag="Mrub_0103"
FT   CDS_pept        complement(81005..81487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0103"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   InterPro IPR007272; KEGG: tcx:Tcr_0170 hypothetical
FT                   protein; SPTR: A3UA77 Putative uncharacterized protein;
FT                   PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26884"
FT                   /protein_id="ADD26884.1"
FT                   /translation="MALPIRDEFELHNKARTPGVAGLLAYLPYLLAGAFFGFVAIRSEI
FT                   ASWYRIYEMFRFESFHMYGVIGSAVVTAALSLWLLRKLGVKAPDGEPLRVRPADPGRYR
FT                   YLLGGVVFGLGWGLVGACPGPIYALLGSGYAGALVILLGALLGTYVYGLVQRHLPH"
FT   gene            complement(81491..82054)
FT                   /locus_tag="Mrub_0104"
FT   CDS_pept        complement(81491..82054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0104"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   InterPro IPR007272; KEGG: rfr:Rfer_1811 protein of unknown
FT                   function DUF395, YeeE/YedE; SPTR: A3I1E7 Putative
FT                   uncharacterized protein; PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26885"
FT                   /protein_id="ADD26885.1"
FT                   /translation="MDWLTQPWPWYVAGPLIGLTVPLLLIIGNRRFGISSSLRHVCAAL
FT                   GSRLPFFRYDWRAESWNLAFVLGIVLGGFVAGVLLTNPNPVQLNPQTAGALQQMGVSAD
FT                   SGFLPKELFSWQAVLSPVGFLFLLLGGFLIGFGARWAAGCTSGHSITGLAALQLPSLLA
FT                   TLGFFAGGLVAAHFILPWALGLLR"
FT   gene            complement(82150..83430)
FT                   /locus_tag="Mrub_0105"
FT   CDS_pept        complement(82150..83430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0105"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; InterPro IPR013229; KEGG:
FT                   aba:Acid345_2682 serine/threonine protein kinase; SPTR:
FT                   B7R0L3 Serine/threonine-protein kinase; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26886"
FT                   /protein_id="ADD26886.1"
FT                   /translation="MRYLLGILALLGLALGQALTPKSIIVNPTPPSDLQVRVWVDKDPN
FT                   KTGNPVYQFGENIQISVQVTQPAFVYLFSVRATGEISGILPNAFEQENFLQAGEVRTFP
FT                   GIGAPYTFTVEGPAGQDRVLAVASRRPLDVSEIVDIQTGRARIQGEGNLARALSIVVTP
FT                   IPANDWVTDEAYYIAGQLPPPPPRTGTLSLSSNPSGAQALINGRLVGNTPLNLELLPGT
FT                   YNLELRRGGYNPLRTAFTIQAGQVTRLNLTLVATPPPTGVLAVDSNPRGAQVLVDGRVV
FT                   GNTPLNLTLNPGSYTVELRRGGFSPFRTLVTIQAGRTTRLTVNLVSIAPPPPPVQPVQP
FT                   VQPVQPVQPVRPPSGSFTYTCQGGTLVVNYISSNQVRLFYDGAFQTLPLVRGGAELVYS
FT                   NNIYTWEIGQVGRLIVRGQVVLSNCRI"
FT   gene            complement(83442..83807)
FT                   /locus_tag="Mrub_0106"
FT   CDS_pept        complement(83442..83807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26887"
FT                   /protein_id="ADD26887.1"
FT                   /translation="MLRPLLLLLLAFALSSCILLVEEDEPRRPVQPVTPVTPVQPSIVT
FT                   PGPGSFTYRCSGGTLVVNYLDSNNLRLFYDGAFQSLSLVRRSPTLLFSGGAYTWEWTGS
FT                   RGTLTVRGQVVLSNCAL"
FT   gene            complement(83823..84320)
FT                   /locus_tag="Mrub_0107"
FT   CDS_pept        complement(83823..84320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26888"
FT                   /protein_id="ADD26888.1"
FT                   /translation="MRKIPWLLLLLPLVLSSCILVVDLPVSNFRFDSNWQRNTDLRYVF
FT                   CTNKTTYMRYKFRAPDSSVISSIQEVYQGYASGNTLTLNRPITDLTRDGNDLVFVGIVN
FT                   FGQGQVPQSLPAGVSQQSITVTPITPPPSITGKTTVTVTVTTTSGRPYSGSYTYDVYSN
FT                   CP"
FT   gene            complement(84449..85753)
FT                   /locus_tag="Mrub_0108"
FT   CDS_pept        complement(84449..85753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0108"
FT                   /product="E3 binding domain protein"
FT                   /note="PFAM: E3 binding domain protein; InterPro IPR004167;
FT                   KEGG: actin binding; SPTR: Q58NA5 Plus agglutinin
FT                   (Fragment); PFAM: e3 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26889"
FT                   /protein_id="ADD26889.1"
FT                   /translation="MSEVKITPLARRLAEENSIDWRQIKGTGPDGTVVERDILAFLAKV
FT                   MAGEVNLPPTPEEVAPPTGAIPDMAQAQAVLQKEGVQLDDLVPSSPSAPPPPESALPTL
FT                   EDIEFDLDLEPAPPPPVPPASAAFEEAPTLAPEPEIVPNFEEPEPLTSTGPLSTLQWEE
FT                   PEPLSPLPEVNPELASLPPLPSEPDLEPPSSANKLIWETQEVLTAPEVPAPAPEPLAPG
FT                   MSFTNTPEAPSAEPAVPPAPEHQAPVEAAAAPLTPPAASIPTPFANTGLGVGPAPSTQM
FT                   LRVQAWQRLVAIGPAQEAAQTLSEAWRMEVGLDALLYRAADKALSDTQTPLRPTKGHLE
FT                   GNELKSLRVAPAQSLRGTLDSLRMASDPAEGLVVLSLANSAFDQVIFPGLSTLTLGRAS
FT                   GGHALLTLSGDMSSELAGQLLARVAYYLERPILLA"
FT   gene            85878..86951
FT                   /locus_tag="Mrub_0109"
FT   CDS_pept        85878..86951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0109"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="COGs: COG2309 Leucyl aminopeptidase (aminopeptidase
FT                   T); InterPro IPR000787; KEGG: gur:Gura_1909 peptidase M29,
FT                   aminopeptidase II; SPTR: A2BKG8 Leucyl aminopeptidase,
FT                   AmpS; PFAM: peptidase M29 aminopeptidase II; PFAM:
FT                   Thermophilic metalloprotease (M29)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26890"
FT                   /protein_id="ADD26890.1"
FT                   /translation="MESRFAWLLARYCLDLQPGQTVLIEAEPAALPLLEALHEVVLQCG
FT                   AYPIVQLFPAAVSRPFFMLGEAWLDRPPKPQMQLMEQVDASLRIESAQNPLELSEVPPA
FT                   RIAQFEAGWRPYKRMRARKRWCLTLYPTAGYAQQAGMSTTGFRAFVERALYLDRPDPIA
FT                   AWHELSAFQAALIERLHKVKEIRIQADETDLRLSVEGRTWINSDGKRNMPSGEVFTSPL
FT                   EASVEGPVRFNLPVVVAGQRVEGVRLVFRAGRVVEASAQTGEEYLLKMLEADPGARCLG
FT                   EVGIGTNFGITHPTGLILYDEKIGGTVHLALGQSYPETGGTNTSSIHWDLILDLRRGGR
FT                   LLADGEVLQEDGRFVGL"
FT   gene            complement(87023..88699)
FT                   /locus_tag="Mrub_0110"
FT   CDS_pept        complement(87023..88699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0110"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; InterPro IPR000110:IPR003029;
FT                   KEGG: mxa:MXAN_3793 30S ribosomal protein S1; COGs: COG0539
FT                   Ribosomal protein S1; SPTR: A7CXU2 Ribosomal protein S1;
FT                   PFAM: S1 RNA binding domain; TIGRFAM: ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26891"
FT                   /protein_id="ADD26891.1"
FT                   /translation="MEDQATQTPVETGKEPQAFSMEQALQDAEARLEKTVQRGQIVTGT
FT                   VVLVTNDGVMVDIGARTEAVIPFNQLTEENLSEEELKNLLKPGDTVTAYVVRADLENGQ
FT                   VVLSKKRAEADQSWVKIQALYEQGEPVMVQVKEKVKGGLVATIEGLRAFLPASQVDLKR
FT                   TPDLDEYVGQSFLVKIIELNRKKGRIILSRRTVLEAEQKAARSQVLASLKEGEVVEGQV
FT                   VEVTDFGVFVALGGVDGLVHRSEITWGRFNHPRDVVQKGQTVKAKVLSVDTERERVNLS
FT                   MKALTQDPWLTVSEKYPVGSRLTGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKH
FT                   PGEILKEGQEVEAQVLRIDPEERRLSLGLKQTQPDPWKSLPDRYPPGTPVKGKVTGLTD
FT                   FGVFVEIEPGIEGLIHVSELAYERVEKPSEIFKKGDEVEAAILQIDPVEQRISLSRKRL
FT                   LPPPAHAVSIPGGEEGEGRKGRREGKEGERPKRSKGKGGAREGRGRDHDYDYGMGGGAA
FT                   SYTNYDPSVVATSNTNVKLGDVFGDLLSQIALEEDKDKEKA"
FT   gene            complement(88965..89672)
FT                   /locus_tag="Mrub_0111"
FT   CDS_pept        complement(88965..89672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0111"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: molybdopterin biosynthesis MoaE protein; thiamineS
FT                   protein; InterPro IPR003749:IPR003448:IPR010034; KEGG:
FT                   mxa:MXAN_2564 molybdopterin converting factor, subunits
FT                   1/2; COGs: COG0314 Molybdopterin converting factor large
FT                   subunit; SPTR: A4KLL7 MoaD-moaE fusion protein moaX; PFAM:
FT                   MoaE protein; ThiS family; TIGRFAM: molybdopterin
FT                   converting factor, subunit 1, non-archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26892"
FT                   /protein_id="ADD26892.1"
FT                   /translation="MRVQVLLFALFREQAGQARLQLELPEGSTVADVKALLEAQYPLRL
FT                   SGGLAAINEQLAQPHQPLKDGDELAFLPPVSGGSTTPAADPALATGNESFGLTYEALAL
FT                   QPWVDWASDHPYGAVVSFLGTTRSPNKGLLVSYLEYEAYPGMAEKVMQQIIAEMRARWV
FT                   LGRVALWHRLGRVLPGEGSILIVVSAPHRPEAFEACRYAIERVKQILPVWKKEFLPDGS
FT                   HWVEGHAPEEHRL"
FT   gene            complement(89736..90641)
FT                   /locus_tag="Mrub_0112"
FT   CDS_pept        complement(89736..90641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0112"
FT                   /product="regulatory protein DeoR"
FT                   /note="PFAM: regulatory protein DeoR; SPTR: A2UB58
FT                   Heat-inducible transcription repressor HrcA; InterPro
FT                   IPR001034; COGs: COG1420 Transcriptional regulator of heat
FT                   shock gene; KEGG: cvi:CV_1608 heat-inducible transcription
FT                   repressor; PFAM: DeoR-like helix-turn-helix domain;
FT                   TIGRFAM: heat shock gene repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26893"
FT                   /protein_id="ADD26893.1"
FT                   /translation="MTERQRRILHLLVDIYIQTQAPVPSGVLAQQLSLSPATVRYDLIE
FT                   LEQQGLIGKPHTSAGRVPTRAGFHHYALSKLPPNPLPQAMLEKLAQVLEDAGPRREALL
FT                   VQVASKLAGYPATLRLRPQRAPKLLQVHLSNLTSGKVLAVAVLEGGRVREARIELSFTP
FT                   TEAQLNEAEQRLYKASEPVKASTPAMMELYESIGRAFAQGSQEEYREGMGLLLSEPEAQ
FT                   NPLFLRQAIAVFEAPSDSTFTPPGGVNVRVGENEGLSLVQAGIKVNDQIGELTLLGPVR
FT                   MRYERALSVAFTMSQVYMGK"
FT   gene            90682..90813
FT                   /locus_tag="Mrub_0113"
FT   CDS_pept        90682..90813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26894"
FT                   /protein_id="ADD26894.1"
FT                   /translation="MVGCIVGQLAVARRVGLFVTKFVGHLVFIDPNQAIYFMRMCKV"
FT   gene            90898..92259
FT                   /locus_tag="Mrub_0114"
FT   CDS_pept        90898..92259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0114"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; InterPro IPR010256:IPR001905;
FT                   KEGG: scl:sce2376 ammonium transporter; COGs: COG0004
FT                   Ammonia permease; SPTR: Q8PYW6 Ammonium transporter; PFAM:
FT                   Ammonium Transporter Family; TIGRFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26895"
FT                   /protein_id="ADD26895.1"
FT                   /translation="MKNLRLPFGLAALLGGLAFAQDPEFSAADTAWMLVATGLVLLMTP
FT                   ALAFFYGGMVRSKNALNTMMMSFSALGFVAVAWALLGYTLALSGDGNFIGDLRYLFLNN
FT                   VGMENKGAIVSITIPHMLWMIFQGTFAIITAALISGAVVERMRFPAFLLFITLWSLLVY
FT                   APIAKWVWGGGFLADLGAWDFAGGTVVHINSGIAAVVAALVLGARKDFGRQAVLPHNVP
FT                   FVLLGAALLWFGWFGFNAGSAWAASATAGLALTNTILAPAATIVAWSLIDLMRTGRVTA
FT                   VGLATAIVVGLVVITPAAAFVSPFYALVMGAIGAFPSYFVLLWRARSGMDDSLDVFAAH
FT                   GVGGITGAILTGVFAQKSVNGLFDGLIAGNPAQVLIQAFAVLIAVVYSGAITFVLLKLV
FT                   GAITPLKATIKEEGVGMDVSQHGEEAYTSGEGAILVKSETAMPMARPKPAGGTD"
FT   gene            92271..92621
FT                   /locus_tag="Mrub_0115"
FT   CDS_pept        92271..92621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0115"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; SPTR: A6PUC8
FT                   Nitrogen regulatory protein P-II; InterPro
FT                   IPR002187:IPR017918; COGs: COG0347 Nitrogen regulatory
FT                   protein PII; KEGG: cak:Caul_0380 nitrogen regulatory
FT                   protein P-II; PFAM: Nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26896"
FT                   /protein_id="ADD26896.1"
FT                   /translation="MKLIVAIIRSEKLNDVLEALFKAEVRGLSISRIQGHGGETERVET
FT                   YRGTTVKMELSEKVRLEIGVSDHFVEPTVRAILAGARTGEVGDGKIFVLPVEKVYRIRT
FT                   GEQDTAAVTPVS"
FT   gene            complement(92704..93420)
FT                   /locus_tag="Mrub_0116"
FT   CDS_pept        complement(92704..93420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0116"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; InterPro
FT                   IPR001537:IPR013123:IPR004441; KEGG: bha:BH0113 tRNA/rRNA
FT                   methyltransferase; COGs: COG0566 rRNA methylase; SPTR:
FT                   Q06753 Putative trmH family tRNA/rRNA methyltransferase
FT                   yacO; PFAM: RNA 2'-O ribose methyltransferase substrate
FT                   binding; SpoU rRNA Methylase family; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26897"
FT                   /protein_id="ADD26897.1"
FT                   /translation="MLIYGRNPVLEALREGRVEQVWVARGVEAWLLKELDKLGASYQTV
FT                   PRIQLDQMVRTTQHQGLVAEITELAYADLEAPFRLAKERGERVLLVVLDGITDPRNYGA
FT                   IIRSAFALGAHGVVTEERRSAPLSALVMKASAGTASKIPLVQVKNIPRYLEQLKQQGIW
FT                   VYGTSGKASKTIAELDYQRPLALVIGSEGEGMRRLVAEHCDELARIPLSEGAESLNAAV
FT                   ALGVVLYQAGINRRPK"
FT   gene            complement(93543..94655)
FT                   /locus_tag="Mrub_0117"
FT   CDS_pept        complement(93543..94655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0117"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase; InterPro
FT                   IPR001482:IPR003593:IPR006321; KEGG: ppd:Ppro_3178
FT                   twitching motility protein; COGs: COG2805 Tfp pilus
FT                   assembly protein pilus retraction ATPase PilT; SPTR: A1HQ23
FT                   Twitching motility protein; PFAM: Type II/IV secretion
FT                   system protein; TIGRFAM: pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26898"
FT                   /protein_id="ADD26898.1"
FT                   /translation="MTFPELLASLVAKGVSDIHLHVGLPIMARLHGRLIPITQSPLTPQ
FT                   YTEALVDLMCNERQKALFAERSQVDLAYGVPGVARFRVNLFKQRGSVSCVMRVVNSDES
FT                   KLKIVSLPQDTINYFRDKEKGLVLVTGPTGSGKSTTLARIIDEINQHHSKMIVTLEDPI
FT                   EYLHRSKKSIVVQREIGQDAPSFKDGLVAAMRQDPDVIMIGEIRDHATAAAALEAAQTG
FT                   HLVFSTLHTLDTVRTVNRVLDLFPPHEREVARILFAESLVGIVSQRLLPSKQGGRVCAM
FT                   EILKGNLRIRDLIRDPDRTNEIYEALKDSSLDGMQTFDDHLAELYARDQIDLETALAHA
FT                   TSAQYVKVKALQINAARQTLIDESVVQQSN"
FT   gene            94902..95336
FT                   /locus_tag="Mrub_0118"
FT   CDS_pept        94902..95336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0118"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; SPTR: Q8PYN7 Universal
FT                   stress protein; InterPro IPR006015:IPR006016; COGs: COG0589
FT                   Universal stress protein UspA and related
FT                   nucleotide-binding protein; KEGG: pol:Bpro_1197 UspA; PFAM:
FT                   Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26899"
FT                   /protein_id="ADD26899.1"
FT                   /translation="MYKRILMPTDGSNCSQQAIREGLEVAKNMGARVTFLYALENISSS
FT                   FWISPESVPYGLELLEDLKRVGNEALSKASELAQAAGVEAETKLVEARPVEAILDEAKN
FT                   HDLVVMGTHGRSGLDRFMLGSVTEAVLHRSERPVLVLRCK"
FT   gene            95389..96174
FT                   /locus_tag="Mrub_0119"
FT   CDS_pept        95389..96174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0119"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; SPTR:
FT                   A3IZC8 Putative ABC-2 type transport system permease
FT                   protein; InterPro IPR010390; COGs: COG4587 ABC-type
FT                   uncharacterized transport system permease component; KEGG:
FT                   ade:Adeh_0399 ABC transporter, inner membrane subunit;
FT                   PFAM: Protein of unknown function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26900"
FT                   /protein_id="ADD26900.1"
FT                   /translation="MLRKLRALLTTWYAYFLEYRAEVLLWALSAMLPLILMGVWTQAAE
FT                   GGGFALSAPEFARYFLCVFLVRQLTIVWVIWEFQDDVVQGRLSFKLLKPIDPGWDHLMQ
FT                   HLAERLTRLPFGLLIVAVFLLVYPQARFVPDVEGVLLGVAASVAAFLLRFLMQYTFAML
FT                   CFWTERGAAVEELWFVAYLFLSGLIAPLSVFPEAVRSLALLTPFPYLVYFPAALFAGLP
FT                   VPGGVGQGFLVLGVWFAVFWVINRWLWRKGLQQFSGMGA"
FT   gene            complement(96316..98529)
FT                   /pseudo
FT                   /locus_tag="Mrub_0120"
FT   gene            98639..99538
FT                   /locus_tag="Mrub_0121"
FT   CDS_pept        98639..99538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26901"
FT                   /protein_id="ADD26901.1"
FT                   /translation="MKTSSIQNSILGLLVIGMIGCVPTQTTAQQPAAPDPIAVAQQYIQ
FT                   VLNAGNLDRALAFYADDAIVHTPVGLFIGKAQIARWLASENQATRVTPRDWKMQGALVV
FT                   STGTVLLERFVKAGVGAVEFRSEYLVDRSGKIRFFGPVLTLTPEQQQKMREAQAGAPPA
FT                   PAPSVNPIEVVKAYHETANTGDFEKTFAFFADDSGAFVMNGTLLLSGKKQIADLWLRED
FT                   VKTTRVMPREYQANGNLVISMGKVSLERFRRIGVDPIAYRAQFVVENDKIRFFYPTLQF
FT                   TPEQLEKIQAAQRTPANR"
FT   gene            99554..99808
FT                   /locus_tag="Mrub_0122"
FT   CDS_pept        99554..99808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26902"
FT                   /protein_id="ADD26902.1"
FT                   /translation="MQYFKSSAQGAKHWLEMIRDKAPSWTGLPVGDEGGLMRPDQSASY
FT                   NLVFRYREYAFLLSNHPDDSPAFYRKWAQAIIQRIQRFK"
FT   gene            99818..100483
FT                   /locus_tag="Mrub_0123"
FT   CDS_pept        99818..100483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26903"
FT                   /protein_id="ADD26903.1"
FT                   /translation="MKFWQVVMAVGLALAQSTQRLILNGQVASTRVITVQGTAYVPVAD
FT                   LAKALGQSVVKVQGGYEIRAAGGANQLMGQFQGKVGDQILTGLFRVQVQKVERMESYTT
FT                   RFDKSSLTVQPRNPDEELVVVTGSLRNAKQSGAVAPSLGINNPGNTALAGADGRSFPPI
FT                   AYDSPSGSNTGGGFTLLPGAAMSFAVVFSVPKGTEVKALVLRVGEYGDTGSKDVRVGL"
FT   gene            101137..103350
FT                   /locus_tag="Mrub_0124"
FT   CDS_pept        101137..103350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_00157 QXW lectin repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26904"
FT                   /protein_id="ADD26904.1"
FT                   /translation="MGWQNFASTLWLRWIIVVLILGLPACSGTPPDPRAREAIIPATTK
FT                   VSDPSTRDALTLYDPETGILRFSTSTPLLDSLKIDNVLVSEPSSAAPYGYLRKIKAIRR
FT                   EGAQVVLETVQANLTDAIHQGWLEAADDLEASDLASAMALVEGLSVGVVQPTANVGDGF
FT                   RFEARFDETVLDINEGDVRVKVRVNGVFYFNAGYNIAVGIKPRFGIPPAYVDHFEAWIG
FT                   FEQRAQLQVSGEANAQVNKEKKVAEYRFKPLCFAIGPVPVCVVPTVYIFVGATGEVNLR
FT                   FSYNAVQTAQAKMGARWTDSRGWEEIEPTPAFNTSFDQNFDINAGLKTRAYTKAEGALM
FT                   LYGIAGPTIGAQMSIELDVAVPRDPFWILRGSLRAYYSFIVDIPVIGRVAEHSGTLYEI
FT                   GREFGRSPAPPPTITIRTSPATVQLRVETDLAQFFRVAHPLGNVDLTVTSNLDGTLYSG
FT                   SWSTNPNSLFGPELKRTFNTVGSRTLTLIARYVNSQTSSSLVLDVVNTPPTLNLQYGGD
FT                   PRQGQIYPITVLITDPNEPDTTRLCGSTQWSVEAPDTLSATTGCSVSVTFGTTGARQIR
FT                   VTARDSEGATTTRTLTLDVLPPPVNPYPKITGYGVYSDEYTGGPIRCGSVRVADGRTID
FT                   LNNRGCVTPHRYYGGITVENPSNEALTYDWKLYVSPPGFDNLLLSETASTSYIFELYNV
FT                   HNSGLTTNDCRVTVKVNAPDPSRSKGPITVWTGRCTYYSFTLR"
FT   gene            103483..104136
FT                   /locus_tag="Mrub_0125"
FT   CDS_pept        103483..104136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0125"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; InterPro IPR005834:IPR006385:IPR006383; KEGG:
FT                   pae:PA1143 hypothetical protein; COGs: COG0560
FT                   Phosphoserine phosphatase; SPTR: P66802 Uncharacterized
FT                   protein Mb0517c; PFAM: haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: Haloacid Dehalogenase superfamily,
FT                   subfamily IB, phosphoserine phosphatase-like;
FT                   HAD-superfamily subfamily IB hydrolase, TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26905"
FT                   /protein_id="ADD26905.1"
FT                   /translation="MSTIAADLEGTLTTGETWRGMAAWMQAHGRAAQYQWFFYRNLPGA
FT                   VAARLGLQDKRAFQDRFMEGAAGLLAGLEQAELAAMSEWVVTNELWPKRRQDVLDELLR
FT                   LRQDGRRLVLCSATYQPILEAFARRMGAGVVALGTPLEVEGGVFSGRLRGPVRSGAHKA
FT                   EHLRKFLDGEVLYRAYGDSLPDVPMLELAEEPVAVYPEPKLRALAVERNWRVIG"
FT   gene            104133..104729
FT                   /locus_tag="Mrub_0126"
FT   CDS_pept        104133..104729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0126"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="KEGG: AGAP009786-PA; COGs: COG0299 Folate-dependent
FT                   phosphoribosylglycinamide formyltransferase PurN; SPTR:
FT                   Q7Q1H5 AGAP009786-PA; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   InterPro IPR002376:IPR001555:IPR004607; PFAM: Formyl
FT                   transferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase, formyltetrahydrofolate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26906"
FT                   /protein_id="ADD26906.1"
FT                   /translation="MSYFPLGRPARMAVMASGRGSNLEALLKAFPHDNPLGHIVLVISD
FT                   RREALALQKAVEAQIEAEYVPWPKERGREQFERVAGQLLRDHRIDLVLLAGFMRLLSPG
FT                   FVQAWEGRILNIHPSLLPQFPGLHAQRQALEAGVSETGCTVHFVDAGMDTGPIVLQRRV
FT                   PVLPGDTEETLAARILEQEHLAYPEAVRRVLKGEI"
FT   gene            104800..106041
FT                   /locus_tag="Mrub_0127"
FT   CDS_pept        104800..106041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0127"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; PRIAM:
FT                   Phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201; InterPro IPR003806:IPR000115:IPR011761;
FT                   KEGG: pca:Pcar_2231 phosphoribosylamine--glycine ligase;
FT                   COGs: COG0151 Phosphoribosylamine-glycine ligase; SPTR:
FT                   A1HSW5 Phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N domain;
FT                   Phosphoribosylglycinamide synthetase, C domain; TIGRFAM:
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26907"
FT                   /protein_id="ADD26907.1"
FT                   /translation="MKVLVVGSGGREHAICWKVAQSPLVSQLYAAPGNPGMAELAECVP
FT                   WDGNVRGLAEWALQEGIELTLVGPEGPLVEGIADAFLEKGLKIFGPTQQAAMIEGSKAF
FT                   AKGLMTRFGIPTAKHRSFSDVLDALAYLEAVGAPIVVKDSGLAAGKGVTVATSLQQAKQ
FT                   AVTNILSGPERAEIVIEEFLSGSEVTVLAVTDGVTIKPLLPSQDHKRLLDGDTGPMTGG
FT                   MGAICPYPLAPGLMTEIVERVLKPLVDGLRAEGIVYKGVIYAGLMLTDDGPKVLEFNAR
FT                   FGDPECQAILPLLETDLVELALAVVEGRLHELEIRWRAQASACVVMAAPGYPDDPHKGL
FT                   PLSLPQLPPEQVLYFQAGTRRGPQGLVTNGGRVLSVVGLGRDLREALERAYAGVGAVRF
FT                   EHALYRRDIGRKVI"
FT   gene            complement(106276..107052)
FT                   /locus_tag="Mrub_0128"
FT   CDS_pept        complement(106276..107052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0128"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; SPTR: A3EQI5
FT                   Archaeal fructose-1,6-bisphosphatase; KEGG: ppd:Ppro_0018
FT                   inositol monophosphatase; COGs: COG0483 fructose-1
FT                   6-bisphosphatase of inositol monophosphatase family;
FT                   InterPro IPR000760:IPR001220; PFAM: Inositol
FT                   monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26908"
FT                   /protein_id="ADD26908.1"
FT                   /translation="MDLRAYLQTALDAAYLAKGIHQYYQEKGFTQSTKSTPTDLVTQAD
FT                   HESEAAIRELIASRHPDHVVLGEEQGQDKEGAFRWIVDPLDGTVNYAHGFPFYAVSIGL
FT                   EAHGEVVLGVVLDTARGELFTATKGGGAYLNGRPIRVSTRSTLVGSLLATGFPYDVSKD
FT                   TENLVYFQRALTKGLMVRRPGAAALDLAYVAAGRLDGFWEVKLNPWDVAAGWLIVSEAG
FT                   GRITGLQGEDYRLGNRYLVASNGLIHGPLLDTIHGR"
FT   gene            complement(107056..107979)
FT                   /locus_tag="Mrub_0129"
FT   CDS_pept        complement(107056..107979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0129"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; Methyltransferase type 12;
FT                   InterPro IPR007848:IPR013217:IPR002052:IPR004556; KEGG:
FT                   mxa:MXAN_4908 putative protein methyltransferase HemK;
FT                   COGs: COG2890 Methylase of polypeptide chain release
FT                   factors; SPTR: A0Z9B6 Protoporphyrinogen oxidase; PFAM:
FT                   Methyltransferase small domain; TIGRFAM:
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; HemK family putative methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26909"
FT                   /protein_id="ADD26909.1"
FT                   /translation="MTSSKSHLALLQALQQKLVAAGKPAVESRWILTHAARLNDAQLAA
FT                   RLTQPVPPDVEEAAWAMLDLRLSGHPLQLLLGESEFYGLRLKVARGVLIPRPETEGLVE
FT                   RALTHLPLDAPAWVLDVGTGSGAIALAIKAMRPQATVWATDINPKALELAKENALHLGL
FT                   EVSFLEAPFTANLTGLDLVISNPPYLPESYREEAPPELAYEDERALYAGPEGLDVARAL
FT                   LPQAWDALQPGGWLWLELAPENVYTLLEEAIAQGWREARVFRDLAQRPRYLGAQKPGLA
FT                   TVAPKDEKNSLPVWDISSTNKNRDRI"
FT   gene            complement(107966..108580)
FT                   /locus_tag="Mrub_0130"
FT   CDS_pept        complement(107966..108580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0130"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: single-stranded nucleic acid binding
FT                   R3H domain protein; InterPro IPR001374; KEGG: scl:sce2518
FT                   RNA-binding protein; COGs: COG1847 RNA-binding protein;
FT                   SPTR: A7B003 Putative uncharacterized protein; PFAM: R3H
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26910"
FT                   /protein_id="ADD26910.1"
FT                   /translation="MDDKKRGLDDLLSDLGIGENETAPEVVLKEEEAAPIVTQPTPAQD
FT                   PKSVLEHFMVGLLLRLDPAYSVDIVQEENLFRVEILGGDSGRVIGREGKTLQSLEFIAN
FT                   VAMAKHFGSAYRVVLDAAGYRRRNEERIRRMAADAVLQVEVSGQPIELPPMRPSERRLI
FT                   HVMLKQHPKVTTTSVGEGEARHVVVLPRTATPPASPENDLE"
FT   gene            complement(108966..110345)
FT                   /locus_tag="Mrub_0131"
FT   CDS_pept        complement(108966..110345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0131"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; SPTR:
FT                   Q9RSH5 Membrane protein oxaA; InterPro IPR001708; COGs:
FT                   COG0706 Preprotein translocase subunit YidC; KEGG:
FT                   sat:SYN_01014 60 kDa inner membrane protein; PFAM: 60Kd
FT                   inner membrane protein; TIGRFAM: membrane protein
FT                   insertase, YidC/Oxa1 family, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26911"
FT                   /protein_id="ADD26911.1"
FT                   /translation="MKRWFWISLAVFALAPALALSPEWRDVDVNKDGKPEKVAVTNLAD
FT                   IAFNEQGQIVGWYIKTVRATDFKGNYERAPNLVRAGQTPPGTLEGFTPTSREFTRREQG
FT                   NPDADFIARFSDGSTTLTYTIHPRFLTIDVDVQSPTPRKLVWTGIGGTDTPITKWLGQG
FT                   NNQPLNAGQGPAVYVGWQTHKASGFAMFIRPQTPTPITLTQLNGAGIAEISVPAGSLNL
FT                   KVYGGANELVRLSVENFYELPGVFQPNIWGQISLGLLWLLEEAHRLVGGSWVLAIVLVT
FT                   ILIRLLMWPLMHQQYKSMAEMQKIQPLLKKIQEKYKDNKEKQQEEMMKLYQEHKINPLG
FT                   GCFPLLLQMPILFLMYKIMVGYEFGQGFLWIPDLALPDPIYVLPLIYIAVIFISTLLTS
FT                   AGNKDAIRQGIIFNLVFAFILFSFPAGVNLYYTFFTILGIGQQFYINKQLGISKPSMLA
FT                   K"
FT   gene            complement(110359..110616)
FT                   /locus_tag="Mrub_0132"
FT   CDS_pept        complement(110359..110616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0132"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; SPTR:
FT                   Q5SL49 UPF0161 protein TTHA0444; InterPro IPR002696; COGs:
FT                   COG0759 conserved hypothetical protein; KEGG:
FT                   bcb:BCB4264_A4918 conserved hypothetical protein TIGR00278;
FT                   PFAM: Domain of unknown function DUF37; TIGRFAM: conserved
FT                   hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26912"
FT                   /protein_id="ADD26912.1"
FT                   /translation="MINLFLKGSVRFYRRFISPLKPPTCRFYPTCSHYALEALERHGPF
FT                   WGLYLSVKRILKCHPLHPGGLDYVPTERPRVRWNPLDSLK"
FT   gene            complement(110661..110993)
FT                   /locus_tag="Mrub_0133"
FT   CDS_pept        complement(110661..110993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0133"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; InterPro IPR000100; KEGG:
FT                   azo:azo3991 ribonuclease P; COGs: COG0594 RNase P protein
FT                   component; SPTR: Q7X5K8 Ribonuclease P protein component;
FT                   PFAM: Ribonuclease P; TIGRFAM: ribonuclease P protein
FT                   component, eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26913"
FT                   /protein_id="ADD26913.1"
FT                   /translation="MPFSSLKGEKAFQRLRGGRVGRGKYLTVRWFPLRPTAFNPVRVGI
FT                   VVSNKVSKKATVRNKIRRRLREILRKMHLPPCEMVVVAQPEAVEASYWDLLKDLTHALK
FT                   KSGLVQ"
FT   gene            complement(111054..111212)
FT                   /locus_tag="Mrub_0134"
FT   CDS_pept        complement(111054..111212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0134"
FT                   /product="ribosomal protein L34"
FT                   /note="TIGRFAM: ribosomal protein L34; PFAM: ribosomal
FT                   protein L34; InterPro IPR000271; KEGG: sus:Acid_1093 50S
FT                   ribosomal protein L34P; SPTR: Q9RSH2 50S ribosomal protein
FT                   L34; PFAM: Ribosomal protein L34; TIGRFAM: ribosomal
FT                   protein L34, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26914"
FT                   /protein_id="ADD26914.1"
FT                   /translation="MKRTWQPNKRKRAKTHGFRARMKTANGRKVLARRRAKGRVKLTVS
FT                   SEPQLRR"
FT   gene            111525..112292
FT                   /locus_tag="Mrub_0135"
FT   CDS_pept        111525..112292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0135"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593; KEGG: met:M446_2309 ABC
FT                   transporter related; COGs: COG0411 ABC-type branched-chain
FT                   amino acid transport systems ATPase component; SPTR: A0NNM9
FT                   ABC branched amino acid transporter family, ATPase subunit;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26915"
FT                   /protein_id="ADD26915.1"
FT                   /translation="MQLKVERVSLNFGGVKALSEVSLEVAQGELVSVIGPNGAGKTSLL
FT                   NCISGFYHPSAGKITFEGHDLTHASPHQVTKFGIARAFQNIELFTGMSVLENLLMARHT
FT                   FGHYNLLDNILIYGRAMRVGVENRRFCEEIIDFMELEPYRKALVGDLPYGVRKRVEVAR
FT                   ALALSPKLLLLDEPMAGMTLEEKEDMVRFILDIRAERGTTIILIEHDLGVVMDISDRVY
FT                   VLDFGQVIASGLPEEVSQNPRVQEAYVGVDHAV"
FT   gene            112356..114296
FT                   /locus_tag="Mrub_0136"
FT   CDS_pept        112356..114296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0136"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   A4TXS6 AMP-dependent synthetase and ligase; InterPro
FT                   IPR000873; COGs: COG1022 Long-chain acyl-CoA synthetase
FT                   (AMP-forming); KEGG: dal:Dalk_3803 AMP-dependent synthetase
FT                   and ligase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26916"
FT                   /protein_id="ADD26916.1"
FT                   /translation="MMPSGYELKKYTLPQVLQMRAKAMPKQVAIREKDLGIWNEITFAD
FT                   YYRHVTRFAAGLLALGFEKGERLAVIADNIPEWLYAELATQALGGISVGVYQSSLPPEI
FT                   AYVLSYTGAAFVVAEDQEQVDKLLEIRSEIPSVRKVIYEDPKGMRAYRDDPWIIGFDEV
FT                   ERLGEEYLQKHPQAVEERIAQGHPEDVCHLSLTSGTTGRPKAAMLRHRNLLHMGVALQE
FT                   IDPLKPTDDYLSFLPFAWIGEQMMSVGMALAGGFAVNMPESVETAMSDLKEIGPHVMFS
FT                   PPRVWEGTQSQIWVRISETYAFNRWVYQQMLKIGYRAADYRMRGRPMPLGLRLAYWFAD
FT                   QIMFKPLRDQLGFLRLRRAYTGGAALGPDVFRFYHAIGVNLKQIYGQTEIIGIAFVHRD
FT                   GDVRADTVGLPIPGGEVKISERGEILCRSDAVVAGYWQNPEATAETFADGWLHTGDAGY
FT                   LTPEGHLVVIDRVSDVMHTSAQQMFSPQFIENKLKFSPYIKEAVVFGDQKPFLTAFINV
FT                   DPQTVGKWAEDRRIAYTTYIDLSQKPQVAELIRKEVQRVNEGLPEHLRIQRFVLLYKLL
FT                   DADDDELTRTGKVRRKFIMQRYQPIVDALYSGTDKVQVDTEFKYQDGTVQKVSVEVRVL
FT                   EADGKPEIVGV"
FT   gene            114298..115206
FT                   /locus_tag="Mrub_0137"
FT   CDS_pept        114298..115206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0137"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; SPTR: A6AZ51
FT                   Branched-chain amino acid ABC-type transport system,
FT                   permease component; InterPro IPR001851; COGs: COG0559
FT                   Branched-chain amino acid ABC-type transport system
FT                   permease components; KEGG: vpa:VPA1151 putative ABC
FT                   transporter, membrane spanning protein; PFAM:
FT                   Branched-chain amino acid transport system / permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26917"
FT                   /protein_id="ADD26917.1"
FT                   /translation="MVDFVQNLISGVAVGCIYALAALGFVLIYKSSRVINFANGQFIAI
FT                   GAFMAYALAVWGKLPVLLAALLAMLLTAGLGFLVERVFLRRLVGQPIISVIMVTIGLAS
FT                   VLDGLMYLTPFGSGNFTFPQFLPQGGLSLGGVSVSYPQLLAIGFTAIFLVLFGWFFQRS
FT                   VLGVSMRAVADDQMAAMSVGVSVQRVFALAWAVAGLTAAAAGIVVGMVSGLNQDGLIAI
FT                   GLAVFPAVILGGLDSVPGAVVGGIIIGVLQSFSTAYLDGLFSQIGLVGGGSQYVMPFVV
FT                   LLVMLWFKPHGLFGTEEIERV"
FT   gene            115246..116322
FT                   /locus_tag="Mrub_0138"
FT   CDS_pept        115246..116322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0138"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; SPTR: A6EZ42
FT                   Inner-membrane translocator; InterPro IPR001851; COGs:
FT                   COG4177 ABC-type branched-chain amino acid transport system
FT                   permease component; KEGG: bpt:Bpet1128 high-affinity
FT                   branched-chain amino acid transport system permease
FT                   protein; PFAM: Branched-chain amino acid transport system /
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26918"
FT                   /protein_id="ADD26918.1"
FT                   /translation="MRNPWAQTGNYRTSYVQDTTIFANYREIVSVVLLLVGLCILPLFL
FT                   ERSQVLVLNFILIYAIAVLGLNITTGYAGLISVGQAAFMGVGAYTVALSAPSLPFWLTI
FT                   PLGGFTAAIIGFIVGIPSLRVKHLYLVLATLAFQEIFVWVVGRSPALAQGAAIPVEMRN
FT                   FLGLEIGFRNHNYFWYYVILFVLVLMVMAWRNLLRGKYGRALIAVRDNDRAADAMGMDP
FT                   GRTKLMAFALGAFYGGVAGGLLAYMQRAVVVEEFTLSRSVALLAMAIVGGLGTVVGSLL
FT                   GPAFIEFLRLYVERLSEWMKSNAFIQSITPAGVDVASALLPLSFGLVIVLFLIFEPRGL
FT                   YNWWRLLRSYFRTWPFRY"
FT   gene            116388..117596
FT                   /locus_tag="Mrub_0139"
FT   CDS_pept        116388..117596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0139"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component"
FT                   /note="SPTR: A6EZ41 Extracellular ligand-binding receptor;
FT                   COGs: COG0683 ABC-type branched-chain amino acid transport
FT                   systems periplasmic component; KEGG: rfr:Rfer_4065
FT                   extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26919"
FT                   /protein_id="ADD26919.1"
FT                   /translation="MKRAMILATMAFLGLAMAQGRTVNLLWSGAVTGPTSDVGGPYGAG
FT                   VEDYCRYANEQKLIPNVTLNCTVRDDQYQNPNTQRIFEEALDRAKPAIYLGYSTGAMLQ
FT                   LKPLINEVKMPTIPASAHIGLIDPPNNQYMFLPVSSYSEQVVALMEYINRTTKNAKIAL
FT                   VINPSPFGRAVVDHARRAAQRLGQTIVDVREVGSGNLDNTALLRALDAAGAQFIIHQNV
FT                   AGPVANILKDAQRLGLNRKIRQMGAVYTGGSDLIRLAGEAAEGFLWASSYYTLDENAPG
FT                   INLQKQLAQKYNRSADILNSTNYTAGMLAAAIAVEAMRRAGQRFNGRIDNETVYQALIG
FT                   MNGPNAFKPGFAVSTKAGIEIDFTRSEQTGAEGLRVLEARGGKFVPVTEPFTSALFRQV
FT                   RNP"
FT   gene            117668..118486
FT                   /locus_tag="Mrub_0140"
FT   CDS_pept        117668..118486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0140"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: mag:amb3593
FT                   ABC-type branched-chain amino acid transport systems,
FT                   ATPase component; COGs: COG0410 ABC-type branched-chain
FT                   amino acid transport systems ATPase component; SPTR: A4TXT0
FT                   Branched chain amino acid ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26920"
FT                   /protein_id="ADD26920.1"
FT                   /translation="MRPEDLGNILLEVNNIEVVYKDIIQVLRGVSLKVPEGQITALLGP
FT                   NGAGKTTTLRAISGLLVPEDGKVVSGSILYRGENIANKPPEQIVLKGIVQVPEGRRVFK
FT                   HLTVEENLRVGAVTRRDGAKVREDLERIYHYFPKLALIRTRLAGYCSGGEQQMLAIGRA
FT                   LLANPKLLLLDEPSLGLAPLLVREIFDIVAQINAEEGVTVLVVEQNARVALSVAHYGYI
FT                   MESGRIALEGTREYLETNPDVKEFYLGVAKSGGRKSFKDVKSYRRRKRFM"
FT   gene            118525..118899
FT                   /locus_tag="Mrub_0141"
FT   CDS_pept        118525..118899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0141"
FT                   /product="protein of unknown function DUF59"
FT                   /note="SPTR: Q8TN95 Putative uncharacterized protein; KEGG:
FT                   gdi:GDI3054 putative phenylacetic acid degradation protein
FT                   PaaD; PFAM: protein of unknown function DUF59; InterPro
FT                   IPR002744; COGs: COG2151 metal-sulfur cluster biosynthetic
FT                   protein; PFAM: Domain of unknown function DUF59; TIGRFAM:
FT                   phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26921"
FT                   /protein_id="ADD26921.1"
FT                   /translation="MQLSLCGSGLKYHGAMSETTLPTKEQVLEALKVVRDPEIPVNVVD
FT                   LGLVYEVEVKEGGIVDITMTLTSIGCPAQDIVKADAEIAVMRLAGVNAVNVEFVWTPPW
FT                   TPARMTEDGKRQMRMFGFNV"
FT   gene            complement(119005..119424)
FT                   /locus_tag="Mrub_0142"
FT   CDS_pept        complement(119005..119424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26922"
FT                   /protein_id="ADD26922.1"
FT                   /translation="MVAMEIVGLRGAPQETLRALKEALKGVSFPEALAIYITDWQDQRA
FT                   QARFALFVRQGKHRVLSRDAFGPRFGLEGDAALKDLTLWLIERGVTDFKEAVVAPSEFA
FT                   ALFELEAEEAQKLIMASANPTDPMLYIKREFTSRM"
FT   gene            119526..119948
FT                   /locus_tag="Mrub_0143"
FT   CDS_pept        119526..119948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0143"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; transcriptional
FT                   regulator PadR family protein; SMART: regulatory protein
FT                   MarR; InterPro IPR000835:IPR005149; KEGG: scl:sce8982 MarR
FT                   family transcriptional regulator; SPTR: A4KJ81 Putative
FT                   uncharacterized protein; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26923"
FT                   /protein_id="ADD26923.1"
FT                   /translation="MAWGLLTNLWRLSRGLREEVVPHLEHLGLAPTDPWLLAEIERHHY
FT                   PTEAVRAMQMPAPTISQMLKRLEQAGLVVRSLDPADLRRYRFELTEAGRAVLEESRQHI
FT                   LKALERRLERLNPQQRRQFAEWLEILAREEAPVSKE"
FT   gene            119955..122627
FT                   /locus_tag="Mrub_0144"
FT   CDS_pept        119955..122627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0144"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1;
FT                   InterProIPR001411:IPR001958:IPR011701:IPR007114:IPR 004638;
FT                   KEGG: mxa:MXAN_0105 drug resistance transporter, EmrB/QacA
FT                   family; COGs: COG2814 Arabinose efflux permease; SPTR:
FT                   A3VM32 Putative multidrug-efflux transporter; PFAM: Major
FT                   Facilitator Superfamily; TIGRFAM: drug resistance
FT                   transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26924"
FT                   /protein_id="ADD26924.1"
FT                   /translation="MNPSTQTPSQSTSRETQLTFIGILLGLFLAALDQTIVSTALPKII
FT                   ADLNGAELYAWVTTAYLLASTVSAPIFGRLTELFSRKTILLVAISIFLLGSALAGLSQN
FT                   MPELIAFRGLQGIGGGALFALALTTIAVLFPPRERGRVGGFFGAIFGVSSAVGPWLGGL
FT                   LTDHFSWHWVFYINMPVGAVALWFILRYMPRLSPEHRERFDYLGAVLLVAWTVPLMLAF
FT                   SWGGSTYPWLSAQILGLLGLSALALVLWVWSQNRVQHPLFDLSILRVRSFSLASAATFF
FT                   YGPAFLGAVAFLPLYLQVVKGVSASASGVTVLPLTLGVVLGATGSGLLSGRLGRFKPLL
FT                   LLGTGWLLAIFLTLHFLIKVDTPLWLAVLFFFLLGLGLGPAQSLLQIAAQNNVPPQRLG
FT                   SATAFTQLMRQIGSTVGIALMGTLLAKNLTAETCKVFPDNAACRPGALVQRSNEAGVGF
FT                   NLDEQFAKLEAQIVAALKGDTQAYATLLQDAQVPTQVKEGLIKGGIPAQFQQLEGRVVA
FT                   ALRGDAQAYEALMQDPNLPAEFKSKLTRGGIPAQFERMEGLMVSALEGDTKAYEALMQD
FT                   PNLPAEFKAKLVKGGIPAQFAQLQDLVIAALEGDVAAYNQLIHNPQVPADLKARLVKGG
FT                   IPAQFAQLEKLLLAALNGDAQAYQAVQQNPQIPPAFKSQIPQGGLAAQVEAQLQATARL
FT                   LEAAWQGDESAQQALRQNPRLDPRLRSLLDNPPPVEARAGVLAQVRAQAPQLKAAALQQ
FT                   ATAQLQAGLEQAQAQALAQAIAGVKAGLAQAQAKAQAAAIAAVRENLRKAQAQALEQAV
FT                   QATHENLVKAEQQALEEVPHKVVAQLEETKLKLHQALSNGITNAEKNIFLYAALFVLLS
FT                   MAFILPLPNEELRGRGARA"
FT   gene            complement(122689..124131)
FT                   /locus_tag="Mrub_0145"
FT   CDS_pept        complement(122689..124131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0145"
FT                   /product="Succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.24"
FT                   /note="PRIAM: Succinate-semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; InterPro IPR015590:IPR016160; KEGG:
FT                   afr:AFE_1546 succinate-semialdehyde dehydrogenase,
FT                   putative; COGs: COG1012 NAD-dependent aldehyde
FT                   dehydrogenase; SPTR: A4U2G2 Succinate-semialdehyde
FT                   dehydrogenase [NADP+; PFAM: Aldehyde dehydrogenase family;
FT                   TIGRFAM: succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26925"
FT                   /protein_id="ADD26925.1"
FT                   /translation="MVKDFDFPSLAYVGGRWQPTSKTFAVKSPYSGELVAEVADCGEAE
FT                   ARLAADAAVAAFKEWKKLTGFERGKILRKWNDLLIAHQEELGRLTALEMGKPITEAKGE
FT                   VLYAASFVEWCAEEAPRVNGELIHSRFPNKRQMAVYEPVGPVYAVTPWNFPTSMITRKA
FT                   APALAAGCTIIIKPAEQTPLCALYLARLWEEAGGPAGTLQVLPASDPVPVSRVLMEDMR
FT                   IRKITFTGSTPVGKILYRQGADTLKRVSLELGGNAPFIVFEDADIEKAVQFTLLSKYRN
FT                   SGQTCVTTNRIYVHRKLEADYASALAEAVGKLKVGDPLDPSTNVGPLVEQQGLDKVVSH
FT                   VEDALAKGAKVVTGGKALGGLLYAPTVLTGIQPGMRILEEETFGPVAPLMPFEDEEQAI
FT                   AWANNTDYGLAAYIWTKDLSRAFRVAEALEYGIVGVNDPVPSAMGSNLPFGGYKNSGLG
FT                   REGGHWGMEEFLETKLISFLLP"
FT   gene            complement(124239..124931)
FT                   /locus_tag="Mrub_0146"
FT   CDS_pept        complement(124239..124931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0146"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; SPTR: A5PDJ9 Putative
FT                   uncharacterized protein; InterPro IPR016047; COGs: COG0739
FT                   Membrane protein related to metalloendopeptidase; KEGG:
FT                   sml:Smlt3998 putative endopeptidase; PFAM: Peptidase family
FT                   M23"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26926"
FT                   /protein_id="ADD26926.1"
FT                   /translation="MLARQVGFSALLCVLLWGSESLAQNRSGEPDSEPGRVCTPASSSR
FT                   PEPRTEAERRERERWAAYREKLQSYLALLPKEPDRRLAMPVQGVRVRQVANTFGAPRGG
FT                   WRTHEGQDIFAPRGTPVYSATSGFVWRIGQGQLGGLYVFVVGPGGRRYYYAHLDRYAPG
FT                   LREGQRVTPQTLLGYVGNTGNARTTPPHLHFGVYAGSRRTCDYQVIDPLPLLVDRDWRN
FT                   MLNPARNR"
FT   gene            125034..125972
FT                   /locus_tag="Mrub_0147"
FT   CDS_pept        125034..125972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0147"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; SPTR: A3YCI8 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119; COGs: COG0583 Transcriptional
FT                   regulator; KEGG: transcriptional regulator protein; PFAM:
FT                   LysR substrate binding domain; Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26927"
FT                   /protein_id="ADD26927.1"
FT                   /translation="MQISLKQLVYFIAVAESGSISKALTSLNVTQSVVTEAIKKLEETL
FT                   GAELFTRHARGMILTHAGHQFLRHAHEVLAALRNAEQAIRERPDATTGQLNLGVTSLVT
FT                   AYYLPYLLDRFERVFPGVQVAVVEDRRGYIEHLLINGELDVAVMNVSMVDKQALETRTL
FT                   LRAPWRVWLPTNHPLVQQEAVSLENLREERFLYLKNDELEEVTQQIYRLSGFPRVAVRT
FT                   DSIEAMRSLVALGIGVAVLPNLMYRPWSLEGDRLESRPLLENLPRLEIGVAWRRGSALS
FT                   EAARQFLVVVGEHSRVQTYGISYSDLLSPAE"
FT   gene            126131..127300
FT                   /locus_tag="Mrub_0148"
FT   CDS_pept        126131..127300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0148"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: P76108 Putative ABC transporter periplasmic-binding
FT                   protein ydcS; InterPro IPR001188:IPR006059; COGs: COG0687
FT                   Spermidine/putrescine-binding periplasmic protein; KEGG:
FT                   ppf:Pput_4236 extracellular solute-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26928"
FT                   /protein_id="ADD26928.1"
FT                   /translation="MRTQWFLAVVGLAAVAGLAVAQLPASRAKQSLGPSEGQLNILAWP
FT                   GYVENGSTDKSADWVTGFEKETGCKVTVKVFGSSDEAVRLMNQGGYDLVTASGDATQRL
FT                   IAGNVVAPINWNLIPNTRNIDRRLLNAPWYVVNGVRYGVPYQFGVNVLAYNTNVFKTPP
FT                   DSWKVVFEEMILPDGKSNKGRIQAYYGPIYVADAALYLMRTRPELGIKDPYELNERQYQ
FT                   EVLKLLRQQRALLQRYWNDANAQVQDFTNEGVVASTSWIFQVNTLKANKRPIDWVVPKE
FT                   GATGWADTTMLAANSKNSNCAYRWLNWQLTNKVQADIAGWFGSNPVVPAACNTPGSLLP
FT                   ADGCKNQGFNDFDKIFFWRTPTTQCRTQNNQCVPYSRWVSDYIAIQGGR"
FT   gene            127455..128486
FT                   /locus_tag="Mrub_0149"
FT   CDS_pept        127455..128486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0149"
FT                   /product="ABC transporter related protein"
FT                   /EC_number="3.6.3.30"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR013611:IPR003593:IPR017871; KEGG:
FT                   pen:PSEEN1241 ABC transporter, ATP-binding protein; COGs:
FT                   COG3842 ABC-type spermidine/putrescine transport systems
FT                   ATPase components; SPTR: P77795 Uncharacterized ABC
FT                   transporter ATP-binding protein ydcT; PFAM: ABC
FT                   transporter; TOBE domain; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26929"
FT                   /protein_id="ADD26929.1"
FT                   /translation="MVQMYKEPETQSVQAAVELRGVSCYFGPVKAVDGVDLEILPGEFF
FT                   SMLGPSGSGKTTCLRLIGGFEQPTAGQIVLFGQDASKLPPYARDVNTVFQDYALFPHMN
FT                   VRDNVAYALMVRGVPKPERHRRAEEMLELVKLSGLGDRRPGQLSGGQRQRVALARALIN
FT                   RPRLLLLDEPLGALDLKLREEMQIELKALQRQLGITFIYVTHDQGEALSMSDRVAVFNH
FT                   GKIEQLDNPKTLYEYPKTEFVARFVGSANVLEGRLLGLGTGKYALRPERIAIQAGSHNG
FT                   PNSLCGTLLDIHYLGAQTRYEVQVGNERLTVLTSSEEQGLQVGGAVTLRWEHSALRPLQ
FT                   EVS"
FT   gene            128483..129406
FT                   /locus_tag="Mrub_0150"
FT   CDS_pept        128483..129406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0150"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P77156 Inner membrane ABC
FT                   transporter permease protein ydcU; InterPro IPR000515;
FT                   COGs: COG1176 ABC-type spermidine/putrescine transport
FT                   system permease component I; KEGG: rlt:Rleg2_3425
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26930"
FT                   /protein_id="ADD26930.1"
FT                   /translation="MSGMTLRRRLSDALYVRPLLLLLLLLIPPLLWLGIIYLGSLFNLM
FT                   LYSFYSLNDFTGQVEYKFSLSAFQQLFSSPANVDIVLRTTLMALAVTLACAAIGFPIAY
FT                   YIAFYTQGTARTFWYLMVLLPLWSSYLVKVYAWRLILAGEGVVSWFFNLLGLGWLLQGI
FT                   LGLPVIGGPSLSNSYLGMFLVFTYIWLPYMILPIIAALERVPRSLIQASADLGARPGQT
FT                   FRKVIWPLVIPGVAAGSIFTFSLTLGDYIIPQVVGQPGFFIGQMVYVQQGTAGNLPLAA
FT                   AFSVVPVVIIAIYLLIVRRLGAFNAL"
FT   gene            129439..130248
FT                   /locus_tag="Mrub_0151"
FT   CDS_pept        129439..130248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0151"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P0AFS0 Inner membrane ABC
FT                   transporter permease protein ydcV; InterPro IPR000515;
FT                   COGs: COG1177 ABC-type spermidine/putrescine transport
FT                   system permease component II; KEGG: pen:PSEEN1239 ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26931"
FT                   /protein_id="ADD26931.1"
FT                   /translation="MPGKPSLGLRLAFYLGMLFLHFPILIIVLYALTTEDRTYQFPPPG
FT                   LTLRWFGEAFQRQDMWAALWLSLKVAAMATAIALVLGTMVAAAMYRFQFWGKDFITVLL
FT                   ILPIALPGILTGIALLTTFKRLALEPGFWTIVIGHATFCIVTVYNNVVARFRRTGYSQI
FT                   EASMDLGADWFTTWRMVVLPSIATALLAGGMLSFALSFDEVIVTTFTAADQKTLPIWFL
FT                   NELFRPRERPITNVVAVFVMLITFLPIVLAQWLTRDTDDLHGGGKTG"
FT   gene            130298..131740
FT                   /locus_tag="Mrub_0152"
FT   CDS_pept        130298..131740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0152"
FT                   /product="Aminobutyraldehyde dehydrogenase"
FT                   /EC_number="1.2.1.19"
FT                   /note="PRIAM: Aminobutyraldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; InterPro IPR015590:IPR016160; KEGG:
FT                   aha:AHA_3818 gamma-aminobutyraldehyde dehydrogenase; COGs:
FT                   COG1012 NAD-dependent aldehyde dehydrogenase; SPTR: A8GHZ8
FT                   Gamma-aminobutyraldehyde dehydrogenase; PFAM: Aldehyde
FT                   dehydrogenase family; TIGRFAM: 1-pyrroline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26932"
FT                   /protein_id="ADD26932.1"
FT                   /translation="MLKTRITQDKMLIGGEFVAGESTPLEILNPATGEVLLKLPEASVE
FT                   QVKQAVAAAEKAFEAWSQTTPKDRSMMLLKLADKIDEHAEELARLESLNCGKPYLAALN
FT                   DEIPAISDCFRFFAGAVRSMTGALAGEYLAGHTSMIRRDPIGVVASIAPWNYPLMMAAW
FT                   KLAPALAAGNTVVLKPSEQTPLTTLKLAEFMAEIFPPGVVNVITGVGESVGSTLIHQPA
FT                   VRMISLTGDVATGKRVLEAAAGSLKRTHLELGGKAPVIVMDDADLEAAVQGIKIFGYYN
FT                   AGQDCTAACRVYAGKKIYDKFVAELSDAVKSIKVGAQTDEGVEMGPLITERQRARVASF
FT                   VERAKMQKHIEITAGGHPVEGRGFFYEPTVVAGALQSDEIVRREVFGPVVSVTRFSDPE
FT                   EAIAWANDSDYGLASSVWTQDVGKAMRIASRLQYGCTWINTHFMLVNEMPHGGLKQSGY
FT                   GKDMSLYALEDYTVARHIMVKH"
FT   gene            131800..132405
FT                   /locus_tag="Mrub_0153"
FT   CDS_pept        131800..132405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0153"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   InterPro IPR006674:IPR003607; KEGG: bra:BRADO3875 putative
FT                   guanosine polyphosphate pyrophosphohydrolases/synthetases;
FT                   COGs: COG0317 Guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase; SPTR: A0YYY4 Putative
FT                   uncharacterized protein; PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26933"
FT                   /protein_id="ADD26933.1"
FT                   /translation="MELTNRYAEALELAYELHKHQYRKGTEIPYLSHLLAVSALVMEHG
FT                   GGEDEAIAALLHDAVEDAGKVLQSEAGVRVLEHIRQRFGEAVAQIVRECSDTETEPKPP
FT                   YLERKQAYLRHLTEASPPARLVSAADKLHNLRAIVADYRTHGEALWQRFVSEAETIEEK
FT                   RRLTLWYYRELAKEFSSDGGSRLIGAELERLLSGFDGM"
FT   gene            complement(132417..133775)
FT                   /locus_tag="Mrub_0154"
FT   CDS_pept        complement(132417..133775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0154"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; SPTR: A8DJI4 FAD
FT                   dependent oxidoreductase; InterPro IPR006076; COGs: COG0665
FT                   Glycine/D-amino acid oxidase (deaminating); KEGG: FAD
FT                   dependent oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26934"
FT                   /protein_id="ADD26934.1"
FT                   /translation="MPEQTAEVVICGAGIAGVAAAYHLAVKRGLKEVVIVEQGDPLSLT
FT                   SDKSTEAYRNWWPGPDGAMVAFMNRSIELLEEIAQQSANRIQLNRRGYLYATAEASKID
FT                   RLAQAAEQAAQQGAGALRVHSHPSAAYPGGPQDGADLLTSQSLIRQHFPYLSPDTQAVL
FT                   HVRRAGWLSAQQLGMYLLEEARGHGVRLLSGQVVGVETAGGAVQGVQVRQKDGALRFIQ
FT                   APVFVNAAGPMQKEVAALLGLELPVFAELHRKMSFSEHLGVVPREAPMLIWLDEVELPW
FT                   SPQERALLAEDASTRWLLERLPSGVHGRPDGHGESTTLIVLYNYHTEPLTPTFPIPPEP
FT                   HYADVALRGFSVMLPGLRQYFDKAPRPWIDGGYYLKTQENRPLIGPLPVKGAYLVGALS
FT                   GFGVMAACAAGELLAAHLTGAALPSYAPAFLLSRYQDPVYQQRLKGWGDTGQL"
FT   gene            134129..135727
FT                   /locus_tag="Mrub_0155"
FT   CDS_pept        134129..135727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26935"
FT                   /protein_id="ADD26935.1"
FT                   /translation="MKVSAGGVSLQEAKTYKFASEIVYDLSLKPLHHLLLVGPETTDFW
FT                   GTIANPGDKNYALYAVGATDKRSFFSFIIPAGSFKSLAETRAKAGSFRRFLSPSVGVLY
FT                   LEDNTGRVWDVNTATEVGAEQMKVWRQAQRVLFEQRQKDGILDKIKEDWDRLRTEASQK
FT                   GLAQSGGLPTLDEVTLPNGHLDVPKLITALEAQKAAKGVSANYTNERAWCMGWFCAGMG
FT                   YASVVRKNRYNGDLANNNLYNPDNPQDYSDCNISGQKCRIANDIHNADPLGNLQWINYY
FT                   RYAPADGYWGAWDAGLSGLGRLNNIGCGPLAITRLFAWYATERQNYGSYNVNFINSGTA
FT                   PSTAYVIAQEMFEPVYLGTRDGQNVYQPRIARYTDTWWFQNSDQGLTRDTNMIPGANNW
FT                   IRDRASAEGKNWEMRGSHKAWVNIVYAATGWTVVAIPIAWIDFSQHTWRVRDIARGKIG
FT                   RDNEPVIAMYGQGTLGHFAMSQAYIVHEGWFSANLFLWIRREANSWAQDLLQGGFVNVT
FT                   DMASYYSGAFGMYRR"
FT   gene            135737..136183
FT                   /locus_tag="Mrub_0156"
FT   CDS_pept        135737..136183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26936"
FT                   /protein_id="ADD26936.1"
FT                   /translation="MKFYRLFPLLAIALVGCQLSYYVSVTEVEYTSKGVCSGVELTTNN
FT                   QKITGIGYLYRTEGRADSVRLTPGQPVRIPDPNPEPRRTSYILGFDGPVRNSAEVDLTW
FT                   RCLPDKQPLGVQFTYYGGQSTIKGLRITENPASPHGFDIEVVDF"
FT   gene            complement(136254..137615)
FT                   /locus_tag="Mrub_0157"
FT   CDS_pept        complement(136254..137615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0157"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; SPTR: A2WH22
FT                   Glutamate-1-semialdehyde aminotransferase; InterPro
FT                   IPR005814; COGs: COG0001 Glutamate-1-semialdehyde
FT                   aminotransferase; KEGG: bcj:BCAM2784 putative
FT                   aminotransferase; PFAM: Aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26937"
FT                   /protein_id="ADD26937.1"
FT                   /translation="MPHTATIDRNKVRALMQAEQQRFAEQHPRSLELYRRAQHSLLAGV
FT                   PMHWMTRWPGGFPIFVAEARGATFRDVDGHEYIDLCLGDTGAMTGHAPAAALPAITEQL
FT                   HKGITTMLPSENAFWVAEELQRRFGLKYWQFALSATDANRFALRLARAITARPRVLVFH
FT                   GCYHGTVDEAYAWLVEGKPASRPGNIGPQVDPTLTTKVVEWNDPEALEEALRPGDVAAV
FT                   LAEPVMTNVGIVQPAPGFHQALRELTRRYGTLLILDETHTLSAGPGGYTRAHGLEPDML
FT                   TVGKPLGSGIPSAAYGFTEEVGRRAQAVIQPPYADTGGIGGTLAANALSLAAMRATLEH
FT                   VLTEAAYQHMIALGRQLEAEVQEVMTRYRLPWHVTRVGCRVEYLFRPNPAQNGSEALAG
FT                   QDPDLDPFIHLFMLNRGILLTPFHNMTLISPETTAAQVRRHTEVFEEAVRALIG"
FT   gene            complement(137628..138059)
FT                   /locus_tag="Mrub_0158"
FT   CDS_pept        complement(137628..138059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0158"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: ccs:CCNA_03676 GNAT acetyltranferase
FT                   protein; SPTR: P50858 Aminoglycoside
FT                   N(6')-acetyltransferase type 1; PFAM: Acetyltransferase
FT                   (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26938"
FT                   /protein_id="ADD26938.1"
FT                   /translation="MTIRPLQPQDLPAYFVLRTALWPDSAADFELEVSKILNHPHLASF
FT                   VAEQKGRLAGFVEVSLREYAEGCDSSPVGYLEGWYVAPKHRKTGIGRRLVQAAEDWARA
FT                   KGCSEMASDSELSNTPSHQAHARLGYQEVERTVCFRKSL"
FT   gene            complement(138066..138902)
FT                   /locus_tag="Mrub_0159"
FT   CDS_pept        complement(138066..138902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0159"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; InterPro
FT                   IPR013105:IPR013026; KEGG: pca:Pcar_1474 hypothetical
FT                   protein; SPTR: A3ZQA2 Putative uncharacterized protein;
FT                   PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26939"
FT                   /protein_id="ADD26939.1"
FT                   /translation="MPRTAKTPKPDRLAELRLEARRVLHAALDLEAEQATPEAAYRSQE
FT                   LFYGAMQLSREDAVIKRCIKALRINPNNPDPMLLLARFVGGSPDEQIALHERIVLAGER
FT                   DLGKKNIEIFKGHFWGFVETRPYMRALHTLARLYEKAGQLPKAVQIYEQMLKLNPNDNQ
FT                   GVRYALLGHYLALNKLGDARKLWNRYDQEHSAFWAWGKVLLEFLAGNLEAAQEALGVAR
FT                   KINPHAESYLGGWKPLPKELPGFYSPGQDSEAIYCFVELGAAWVKNPHAQRWLEQH"
FT   gene            complement(138905..140443)
FT                   /locus_tag="Mrub_0160"
FT   CDS_pept        complement(138905..140443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0160"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; amidohydrolase; SPTR: A1HLV8
FT                   Amidohydrolase 3; InterPro IPR006680:IPR013108; COGs:
FT                   COG1574 metal-dependent hydrolase with the TIM-barrel fold;
FT                   KEGG: oan:Oant_3788 amidohydrolase 3; PFAM: Amidohydrolase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26940"
FT                   /protein_id="ADD26940.1"
FT                   /translation="MPQHLLFGGNILSPTLEGSGYVLKPLEALLIRDGKIAAAGRLSEV
FT                   EPLATPDTQRIHLEGRTVLPGFNDAHIHVWKVGQLRTTLLDLRGVKSLEELYCLVGARA
FT                   KTLKPGEWLWGRGWNEALLAERAMPDKAALDRLAPHNPVLLTRTCAHIHAVNSQALQLA
FT                   GITLETQVPGGEINFEQGLLYETAYGLVFRAMGEPSQAQYEHWIRAGLEYLRSLGITSA
FT                   TDPAVDPPLYAAYRALEARGELPIRVNLLYIRRPDGGSETFPLPEKHRSDWLRCDSVKF
FT                   FADGGLSGATAAISQPYKTLEPPQYGLLRFAEEELLELALEAHRAGFRIGTHAIGDRAL
FT                   DQVLRVYERLYQEAPGPRHRIEHFGLAGPEHLQKARQLGVIAVPQPIFLRELRANYLRY
FT                   VPDAWLARCFNLRAMFEAGLTVAFSSDGPVVQQVEPLKGLQAALREPLVEGNQVTLEQA
FT                   LWAYTVGGAVAQGDEANRGTLEVGQWADLVVLEGDLRDPYSLSVHRTLVSGIES"
FT   gene            complement(140567..142084)
FT                   /locus_tag="Mrub_0161"
FT   CDS_pept        complement(140567..142084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0161"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   SPTR: A5WXX3 AgaA; InterPro IPR000914; COGs: COG0747
FT                   ABC-type dipeptide transport system periplasmic component;
FT                   KEGG: bxe:Bxe_B1961 ABC peptide transporter, periplasmic
FT                   ligand binding protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26941"
FT                   /protein_id="ADD26941.1"
FT                   /translation="MKKLLVLLVLVLATVSLAQKAGGILRAGMQTDPVGLDPHTTNATA
FT                   SRNVLENIYDTLVMLDSKGRIVPGLAQSWSVSADGLTWTFRLRPGVTFHNGDPLKASDV
FT                   VFSINRIKDPATKSPRANDFALVRSVTAPNNNTVVITLSQPFSPLLAKLAFSTNAIVSE
FT                   KVAKEHNNDLNKAVIGTGPFRFVEYIPQTRLVVRKWDKYWQKDNQGRPLPYLDGITYTF
FT                   YPDPAARSTALRAGAVDWIEYVTAADVRPLKADRNLVVVGGPSANFRALYFNTTREPYN
FT                   NPKVRQAIAYAIDKKAIVDLALFGTGGIVARGTTIPSGAYAYTNSPYNTRDVAKAKQLL
FT                   AEAGLPNGFTMNLYVTSTYDFLRTPADVIRDNLAEVGIRVNIQAEDWNVYLPKALRSEF
FT                   DVTLLGTSGQADPDDYLFNTFHPSSALNLSKYKNDRVTQLLEQGRRVSSQSERQRIYTQ
FT                   VQELVLQDSPMVFLFHSAQYEAMNRRVQGFLHFPNTSYLAFRYTWLQ"
FT   gene            complement(142126..142986)
FT                   /locus_tag="Mrub_0162"
FT   CDS_pept        complement(142126..142986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0162"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P94312 Dipeptide transport
FT                   system permease protein dppC; InterPro IPR000515; COGs:
FT                   COG1173 ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems permease components; KEGG: bpt:Bpet2850 ABC
FT                   transporter inner membrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26942"
FT                   /protein_id="ADD26942.1"
FT                   /translation="MTTASPNSHLALVIRALLRNRSAVIGGLITLVVLLGALLAPILAP
FT                   WDPLKFDPPNRLSGPSSEHWLGTDQYGRDLLSRVLYGARFSLSVAAVSVLAGLLVGGTL
FT                   GLLAGYFRGWLDLVISRLADILIAYPAILLAIAFLAFLGGGFINLVLAISVVFVGPFIR
FT                   VARAAVLTVREELYVEAGRAMGASDARMIFRTILPNAAAPLIVEVTLRFAYAVLAEAAL
FT                   SFLGLGIQPPFPALGSMVSEGRAFLSLSPWGSLVPGCAIVLMVLGFNLLGDGLRDALDP
FT                   RLQKA"
FT   gene            complement(143053..144003)
FT                   /locus_tag="Mrub_0163"
FT   CDS_pept        complement(143053..144003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0163"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A0P1D1 ABC transporter,
FT                   membrane spanning protein (Dipeptide); InterPro IPR000515;
FT                   COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; KEGG: mes:Meso_1505
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26943"
FT                   /protein_id="ADD26943.1"
FT                   /translation="MVGYVVNRLLAAIPTLLGVAIITFLLMRAVPGDVVTQLVGLEANV
FT                   SPERMAELRRLFGLDLPLHVQFGQWLGAVLQGDLGSSLRTGREVAQDLALRFPVTLQLT
FT                   LMGLFTALLIAVPLGVLAAIRRGGFVDYFASLFAILGLSVPGFFLALLLILLFALALGW
FT                   LPPAGFVPLTENPLENLRHMLLPALSLGLILAGAVTRILRSSMLEVLSRDYIRTARAKG
FT                   LAERVVIFRHALRNALIPVVTVIGIQFGSLLGGAVIIEQVFSLPGVGRFALEGINLRDY
FT                   PVVQGTVLFVASAAVLVNLLVDLLYSLIDPRIRYE"
FT   gene            144141..144557
FT                   /locus_tag="Mrub_0164"
FT   CDS_pept        144141..144557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0164"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; SPTR: A2WGW6
FT                   Putative uncharacterized protein; InterPro
FT                   IPR006683:IPR003736; COGs: COG2050 Uncharacterized protein
FT                   possibly involved in aromatic compounds catabolism; KEGG:
FT                   aav:Aave_2878 uncharacterized domain 1; PFAM: Thioesterase
FT                   superfamily; TIGRFAM: uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26944"
FT                   /protein_id="ADD26944.1"
FT                   /translation="MEPTLEAAQAVLRSQPFSLLLNAQITSFGPDAVELRIPITDQLQQ
FT                   QHGFVHGGVISYAADNALTFVGGAALGPAVVTSEYKINYIRPAKGQALVARANLVHAGK
FT                   SQAVCQCQVFVVADDREILCALAQGTIVSMNQPK"
FT   gene            144568..145488
FT                   /locus_tag="Mrub_0165"
FT   CDS_pept        144568..145488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0165"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; SPTR: A4AD48
FT                   ADP-ribosylglycohydrolase; InterPro IPR005502; COGs:
FT                   COG1397 ADP-ribosylglycohydrolase; KEGG: pfo:Pfl01_3893
FT                   ADP-ribosylation/crystallin J1; PFAM:
FT                   ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26945"
FT                   /protein_id="ADD26945.1"
FT                   /translation="MNLKDRFRGCLLGLAVGDAVGAAVEFCPRGSFEPLTDMVGGGPHH
FT                   LLPGQWTDDTSMALCLATSLKECGGFDALDQMNRYCLWQETGYLSSTGSCFGIGTTIRT
FT                   ALDRFRQTKDPYAGSSHPRTAGNGCIMRLAPVPMFYFPNLQAAEHYAAESARTTHGAAE
FT                   CLDACRLLARIICRALLGRPKDEVVLADSNTFTGAEKIVAIAQGAYLEKPREALRGSGY
FT                   VVESLEAALWCFVHTDSFAEAVLAAANLGEDADTTAAVCGQVAGAYYGVQGIPAAWLER
FT                   LALGSEITALADGLYGSSQEKAGWF"
FT   gene            complement(145614..146426)
FT                   /locus_tag="Mrub_0166"
FT   CDS_pept        complement(145614..146426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0166"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A4AKA0
FT                   Binding-protein-dependent transport permease; InterPro
FT                   IPR000515; COGs: COG0395 ABC-type sugar transport system
FT                   permease component; KEGG: bha:BH3847 ABC transporter
FT                   (permease); PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26946"
FT                   /protein_id="ADD26946.1"
FT                   /translation="MIGRILQYTILFIATLFFLLPVYLVIVTAFKEPSAITLSSTWQLP
FT                   QVWYWESFAQAWTAFAPKLQNSFFLTITATILSALLGSLNGYVLAKWKFPGANIVFPLM
FT                   LFGMFIPYQAVLIPLFQFVREIGLGGSLWGLILVHVVYGLPITTLIFRNYYAEIPDEMI
FT                   EAGRIDGAGFFGIYSRIVFPLSVPGFVVVIIWQFTQIWNEFLFAVTLVSSPANQPITVA
FT                   LAQLAGGEAVKWNLPMAGALLAALPTLLVYIFLGRYFIRGLLAGSVKG"
FT   gene            complement(146423..147547)
FT                   /locus_tag="Mrub_0167"
FT   CDS_pept        complement(146423..147547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0167"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: B5IRR6 ABC transporter,
FT                   permease protein, putative; InterPro IPR000515; COGs:
FT                   COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: dde:Dde_3658 glucose transport system
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26947"
FT                   /protein_id="ADD26947.1"
FT                   /translation="MRWFNNKDTLYGFLVILPSLLLLGIFVYGFIFQTFYTSLTDWGKD
FT                   PAQALSANPQIRFIGFENYRELFTGLVDSRFRQDLVNTFFFTVFFILGCLSVGLGLAIV
FT                   LDRSPRGEGFFRTIFLFPMSLSFIVTGTIWRWMLQPEGGVNQLPTLVGLPKGEFAWLTS
FT                   REQIWQVSWNDLPFITALVVSAVLIFIAITAFRGGERRRGYIASGSAALLLLWAFTLGR
FT                   SLQPLPYDEPHGFNLAFIGIILAAVWQMSGYTMALYLAGLRGIPEELREAARVDGASEW
FT                   QLYQRVIFPLLAPITLSAMIILGHISLKIFDLIFAMAGADNAPTDVPALLMYLTTFRAN
FT                   QIAKGAAIGMILLLLVAAVIVPYLYSQLKSEVRR"
FT   gene            complement(147700..148938)
FT                   /locus_tag="Mrub_0168"
FT   CDS_pept        complement(147700..148938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0168"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A4AJ89 Bacterial extracellular solute-binding
FT                   protein; InterPro IPR006059; COGs: COG1653 ABC-type sugar
FT                   transport system periplasmic component; KEGG: dde:Dde_3657
FT                   sugar ABC transporter, substrate-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26948"
FT                   /protein_id="ADD26948.1"
FT                   /translation="MKKLFLTLAALALGTAGLAQSGKLEIFSWWAGDEGPALQALIDLY
FT                   KKRYPNVEVINATVTGGSGVNARAVLKTRMLGGDPPDSFQVHAGQELIGTWVVADRMED
FT                   LTPLFNQEGWMTKFPKGLIDLLSYKGKIYSVPVNIHRSNVMWYVPAKLREWGVQPPKTW
FT                   AEFLTVCQTLKSKGLEAPLALGENWTQQHLWESVALGVLGATDYANLWTGKLRFNDPKA
FT                   VAVWNTFGRVLDCANKDASGLSWQQAIDRVLEGRAAFNIMGDWAAGYMTTTKGLKPGEG
FT                   FGWAPAPGTAGVFMMLSDSFGLPKGVKNRTNVLNWLRLLGSKEGQDTFNPLKGSIAART
FT                   DSDPSKYNAYLQSAMRDWKSNRIVGSLVHGAVAPESFMSQFGTVMEIYLSSRNAQAAAN
FT                   AAQAIATQVRLGQ"
FT   gene            complement(148959..150152)
FT                   /locus_tag="Mrub_0169"
FT   CDS_pept        complement(148959..150152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0169"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; SPTR: P16557 Xylose
FT                   repressor; InterPro IPR000600; COGs: COG1940
FT                   Transcriptional regulator/sugar kinase; KEGG: bha:BH2758
FT                   transcriptional repressor of the xylose operon; PFAM: MarR
FT                   family; ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26949"
FT                   /protein_id="ADD26949.1"
FT                   /translation="MARTTPLDQQAIKRLNRRLILEALRRHGPQSRAALARAVGLTKST
FT                   VSTLVQEMLEEGLLDEGSRHKPGLGRPGTALEFSPRHTLALGVELGVENTQLVLLDLNN
FT                   TIHDKWDWVESPHTPLAERLTKLAEQVQSRLSDPTRLLGIGLAVPGVVNGRRLLYAPGP
FT                   GWHNEQPAEMLEALLKVPTLVDNDANAAALGETFWGEQQSPLVYVLMTTGLGTGLVVDG
FT                   QVYRGRLGAAGELGHWLTGQPHSRSRAGDVEGTLSLRAMVERYQAASNRKEGFWGILQR
FT                   AEHQDPYALQALQNLAYELGRFVVNLCVAFDPAVVVLGGAGAEAWKWLEAPLRQTIHNL
FT                   AFIPEHAEIPVKPSAFGHLAPAMGAAALVLQRFLANGGTGEWSPPISPLGTRSTIGV"
FT   gene            complement(150236..150700)
FT                   /locus_tag="Mrub_0170"
FT   CDS_pept        complement(150236..150700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0170"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; InterPro IPR003732; KEGG:
FT                   ade:Adeh_0179 D-tyrosyl-tRNA deacylase; COGs: COG1490
FT                   D-Tyr-tRNAtyr deacylase; SPTR: Q5SJQ9 D-tyrosyl-tRNA(Tyr)
FT                   deacylase; PFAM: D-Tyr-tRNA(Tyr) deacylase; TIGRFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26950"
FT                   /protein_id="ADD26950.1"
FT                   /translation="MRAVVQRVSQASVEVDGHIVGQIGRGLLVLLGVGQHDTLEDAAYL
FT                   ARKIAGLRVFADAEGKMNLALADVGGGVLVVSQFTLYGDTRRGNRPSFVEAAPPAVGRR
FT                   LYEQFCDLLAGQGLPVETGVFQAHMQVHLINDGPVTLWLDSAERLSPRRT"
FT   gene            complement(150772..151602)
FT                   /locus_tag="Mrub_0171"
FT   CDS_pept        complement(150772..151602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0171"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; InterPro IPR003797; KEGG: bcy:Bcer98_1648 DegV
FT                   family protein; COGs: COG1307 conserved hypothetical
FT                   protein; SPTR: A8CTV0 DegV family protein; PFAM:
FT                   Uncharacterised protein, DegV family COG1307; TIGRFAM: EDD
FT                   domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26951"
FT                   /protein_id="ADD26951.1"
FT                   /translation="MERTAFVADSTLGLSPQEALERGIYLVPQQVILEGQSYRDYLEMT
FT                   PDQVIQAQLAGKKVSTSQVSAADLEALYKALLEKFDRIVSVHVSSKLSGTYSTARKVAE
FT                   QFGNRVKVIDGLTLNGGLSFVIEEVRRKLAAGVPWDRLEEAIAPLVQRIRGFVLPATLE
FT                   YLHRGGRIGGLQHFIGSLLKLLPVLEVRDGLVRPLERARGWHRGLQQLAEAFHKAFPEG
FT                   ARVVLAHAYNPQGAEELRRLISQEGVIVEDVRACGPAVAAHTGPGTVALFAAPR"
FT   gene            complement(151683..152522)
FT                   /locus_tag="Mrub_0172"
FT   CDS_pept        complement(151683..152522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0172"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; InterPro IPR003797:IPR001555; KEGG:
FT                   bcy:Bcer98_1648 DegV family protein; COGs: COG1307
FT                   conserved hypothetical protein; SPTR: Q9RSY3 UPF0230
FT                   protein DR_1986; PFAM: Uncharacterised protein, DegV family
FT                   COG1307; TIGRFAM: EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26952"
FT                   /protein_id="ADD26952.1"
FT                   /translation="MKIAIVTDSTSDLQSRAAEMGVEIVPLYVNFKGKIHKDWVEITPS
FT                   DIFEGVKAGAGMPSTSQPSPTDFKLAYERALQKADHVLSIHISSKLSGTVQSAQLASQE
FT                   FPGKVTIFDTQAASMGIGMMVERAKELLDQGADLGQVLVELERIRADHTVRFTLATLDY
FT                   LKKNGRIGGAQALLGSLLGIKPILTLKDGRVEAAGRARGEKKALAEMVEALKSWAAGRQ
FT                   KIRIYYLYNAEESDLAAFKAAVQAAGLPLEERLTTSIGGVISTHTGPGVYGFYAYSL"
FT   gene            152782..154347
FT                   /locus_tag="Mrub_0173"
FT   CDS_pept        152782..154347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0173"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein; InterPro
FT                   IPR006139:IPR002912:IPR006140:IPR006236; KEGG:
FT                   glo:Glov_2087 D-3-phosphoglycerate dehydrogenase; COGs:
FT                   COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenase; SPTR: O29445 D-3-phosphoglycerate
FT                   dehydrogenase; PFAM: ACT domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26953"
FT                   /protein_id="ADD26953.1"
FT                   /translation="MWKVLVTDEMRLGEVKHPQVRLDYKPGMAREELLQVIGAYDALIT
FT                   RSRTQVDARVLEAGVNLKVVGRGGVGVDNVDLEAASRRGILVVNVPEANTRSAAELAWA
FT                   LLLATARGLVESDQKIRQGQWDRKYLGLELNHKTLGIVGLGRIGGQVAKFAKGFDMRVL
FT                   AYDPYIPRSRAQTLGVELFDDLADMLRQCHFLTVHTPLTEETRGLIGRRELYLLPKGAV
FT                   VVNAARGGIVDEKALVEVLNDGHLWGAGLDVFVEEPPNAEHPLVHHPKVVHTAHLGANT
FT                   IEAQERVGEAVLERVIETLQGNLAHALNTGFDAEGLQLFSAWLPLGEALGKLLAQITQG
FT                   RPQAVEVSYYGDFEKNPDPIASAVAKGLLEQVLEAGAINLVSARPLLRDRGIALVTRQV
FT                   QEPLDYRQVLEVRLETDKETRKVRGAVLGGKPRIVGIDDHTVEAVPRGFMLVCINRDRP
FT                   GVVGKVGTLLGENNINIAGMQLGRDNPGGKALFVLAIDERPGEAVLSALRGLDVLERVD
FT                   LAEL"
FT   gene            154351..155433
FT                   /locus_tag="Mrub_0174"
FT   CDS_pept        154351..155433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0174"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; SPTR: A3EWA6
FT                   Serine-pyruvate aminotransferase; InterPro IPR000192; COGs:
FT                   COG0075 Serine-pyruvate aminotransferase/ aspartate
FT                   aminotransferase; KEGG: sus:Acid_1660 phosphoserine
FT                   aminotransferase / L-aspartate aminotransferase; PFAM:
FT                   Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26954"
FT                   /protein_id="ADD26954.1"
FT                   /translation="MPSDKIPGMYRPRLLTPGPVELHPRALEALARPQLHHRSDAARQV
FT                   FLQAKTGLEAAFKTQGQVLLLTGSGTAAMDALVQNLFAPGARVLVPVHGNFSERWAKIA
FT                   QQAGLEVVRLELEWGRVVRPEHLESAQGPFDGLLLTHSESSTGALNDVRTLAQAFKARF
FT                   PEGLVVVDAITSLFVSEFELEGWGLDAAACGSQKGIMCPPGLGYAALSPRAIEHLKPRG
FT                   FYLNLASELKVQSTGESAWTPAINLVAATAAVLAELLPRLPEHIALKQQQNEILYATGQ
FT                   ELGLKPVPEVKSPATTCFYLPEGVSYAQVKEAFAARGATIIGGQGQLKGRVFRLSLMGY
FT                   SDLYDAYAVAHMMREALRFD"
FT   gene            155485..156288
FT                   /locus_tag="Mrub_0175"
FT   CDS_pept        155485..156288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0175"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; SPTR: A3VBL8 Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family protein; InterPro
FT                   IPR002347:IPR002424:IPR002198:IPR013968; COGs: COG0300
FT                   Short-chain dehydrogenase of various substrate
FT                   specificities; KEGG: pla:Plav_0391 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26955"
FT                   /protein_id="ADD26955.1"
FT                   /translation="MKVQGKVVVVTGGGSGMGRALVLRLLSKGARVAAVDLNAASLQET
FT                   AQLAQAAERLSTHVLNITQREAVEALPAEVMARHGAVDGLINNAGIIQPFVRVNDLDYG
FT                   AIERVMNVNFYGTLYMTKAFLPHLLQRPEAHIVNISSMGGFLPVPGQSVYGASKAAVKL
FT                   LSEGLFAELLDTPVRVTVVFPGAVSTNITVNSGVAIRAAEGRQPAARPLEPERAAQIIV
FT                   EGMEQNRFRVLVGSDARLMDFLYRLSPERAARFIYRQMRSLLGAS"
FT   gene            complement(156438..157298)
FT                   /locus_tag="Mrub_0176"
FT   CDS_pept        complement(156438..157298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0176"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase;
FT                   PFAM: UbiA prenyltransferase; SPTR: A1HNK5
FT                   4-hydroxybenzoate polyprenyltransferase, putative; KEGG:
FT                   bha:BH1650 4-hydroxybenzoate octaprenyltransferase; COGs:
FT                   COG0382 4-hydroxybenzoate polyprenyltransferase and related
FT                   prenyltransferase; InterPro IPR000537:IPR006371; PFAM: UbiA
FT                   prenyltransferase family; TIGRFAM: putative
FT                   4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26956"
FT                   /protein_id="ADD26956.1"
FT                   /translation="MQVISHRFKTYLELVRFEHTLFALPFAYGGMLLAARGWPGWEVFA
FT                   WVTVAMVGARTGAMALNRLIDRAIDAANPRTAGRHLPRGLVKPAEVLALAVVGLLLLAL
FT                   AAFNLNPLTAQLLPVAVFFLVGYSYTKRFTWLCHFWLGLTIGAAAAGGWIAVTGAFEPA
FT                   LFALWAGTAFWLAGFDILYATQDYQFDRENGIHSVPARFGLPAALRIAQACHALTFGFF
FT                   LLTGLLCGAGWPYFVGVLAVGGVLWYEHQLVRPNDLSKVDQAFFQANVVVSLGMLAVIL
FT                   LDTWF"
FT   gene            complement(157332..158168)
FT                   /locus_tag="Mrub_0177"
FT   CDS_pept        complement(157332..158168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0177"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; InterPro IPR001763:IPR001307; KEGG:
FT                   hch:HCH_04507 rhodanese-related sulfurtransferase; COGs:
FT                   COG2897 Rhodanese-related sulfurtransferase; SPTR: A0ZHS4
FT                   Rhodanese-like protein; PFAM: Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26957"
FT                   /protein_id="ADD26957.1"
FT                   /translation="MPSPLVSAQWLHEHLGDERLRIVDCRFSLQDPSAGRQAYTAGHLP
FT                   GALFLDLEQDLSAPVRPDRRGGRHPLPTPEALAQTLGRAGIGNEHFVVAYDDPPVGGMY
FT                   APRLWWLLRWLGHGQVAVLDGGIGAWRAAGYEVSTAAVEYAPTTFKPHPQPEMVVDANF
FT                   VAHRPAGTVLIDSRAPERYRGEVEPIDPVAGHIPGAINRNWLDSLEASGRFKPAEEQRK
FT                   RFEGLEGEIIVYCGSGVSATANVLALELAGKQARLYAGSWSDWVSDPSRPVARGPE"
FT   gene            158238..159218
FT                   /locus_tag="Mrub_0178"
FT   CDS_pept        158238..159218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0178"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase GroES domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; InterPro
FT                   IPR013154:IPR013149:IPR014188; KEGG: azo:azo3317
FT                   zinc-binding alcohol dehydrogenase; COGs: COG0604
FT                   NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductase; SPTR: A4U4H3 Alcohol dehydrogenase,
FT                   zinc-containing; PFAM: Zinc-binding dehydrogenase; Alcohol
FT                   dehydrogenase GroES-like domain; TIGRFAM: putative quinone
FT                   oxidoreductase, YhdH/YhfP family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26958"
FT                   /protein_id="ADD26958.1"
FT                   /translation="MQTFKALVVESGDPYTAQIRQARLDELPPGEVLVRVAYSSLNYKD
FT                   GLAITGAGKVIRNFPMVPGIDLAGTVLESASPEYKPGDPVILTGWGVGERHWGGLSELA
FT                   RVRGEWLVPLPEGLTLKQAMGIGTAGFTAMLAVMALEAHSIDPAREVLVTGAAGGVGSL
FT                   AVALLAQRGYRVVASTGRLSEETYLKSLGASEILDRAVLSAPGKPLESERFGGAVDTVG
FT                   GAVLAGVLPRMAYGGSVAACGNAGGAKLETTVFPFILRGVNLLGIDSVMCPKEKRLLAW
FT                   QRLARELPKPLLEATLQTVSLEEVPVLAQAILQGRVRGRVVVKLD"
FT   gene            159281..159922
FT                   /locus_tag="Mrub_0179"
FT   CDS_pept        159281..159922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0179"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase; InterPro IPR002123:IPR004552; KEGG:
FT                   bha:BH1635 hypothetical protein; COGs: COG0204
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; SPTR:
FT                   A1HTW7 1-acyl-sn-glycerol-3-phosphate acyltransferases;
FT                   PFAM: Acyltransferase; TIGRFAM:
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26959"
FT                   /protein_id="ADD26959.1"
FT                   /translation="MYEYGLGVYKVCKVIARFLLQVLFGLKVEGAEKIPKEGPVILASN
FT                   HMSFLDPVVMGVACPRVVSYMSRDDVFNYPILRWLLPRLYVIPVSRGSGDLGAIKAAIR
FT                   VLKNGMAFGIFPEGRRSRTGFIEPFKTGAAAIALRTGAVIVPAAIIGSDKAWPVGKGPR
FT                   LRRGVRVVFGDPLVLPPGKPDHQTLEEVTHRLEAAVTALLPPEYHRKPTV"
FT   gene            160030..160332
FT                   /locus_tag="Mrub_0180"
FT   CDS_pept        160030..160332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0180"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; InterPro
FT                   IPR000119; KEGG: bcb:BCB4264_A1566 DNA-binding protein HU;
FT                   COGs: COG0776 Bacterial nucleoid DNA-binding protein; SPTR:
FT                   P19436 DNA-binding protein HU; PFAM: Bacterial DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26960"
FT                   /protein_id="ADD26960.1"
FT                   /translation="MARAAAKKTKTKADLIDQVAATAGLKKKDAKAAVDAFLSKVEEAL
FT                   KAGNKVQLTGFGTFEVRSRKARTGVKPGTTQKIKIPASKYPAFKPGKALKETVKK"
FT   gene            complement(160572..161015)
FT                   /locus_tag="Mrub_0181"
FT   CDS_pept        complement(160572..161015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce0333 hypothetical protein; SPTR: A1ZGI2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26961"
FT                   /protein_id="ADD26961.1"
FT                   /translation="MYEFLLSFHNIARWLVLLAAVYLIYRSIMGLKNHTYTAADRRAGQ
FT                   VYTGLMDLQLLLGILLMLLSPFVQSALNNPGAAMQNSQTRFFIAEHWVLMLAAVILAHL
FT                   GNVRVKKAADALLKHRQALIWYGLSVALVLLAVPWWRPLLRLG"
FT   gene            complement(161110..161730)
FT                   /locus_tag="Mrub_0182"
FT   CDS_pept        complement(161110..161730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0182"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="PRIAM: NADH dehydrogenase; PFAM: nitroreductase;
FT                   InterPro IPR000415; KEGG: pnu:Pnuc_1646 nitroreductase;
FT                   COGs: COG0778 Nitroreductase; SPTR: Q60049 NADH
FT                   dehydrogenase; PFAM: Nitroreductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26962"
FT                   /protein_id="ADD26962.1"
FT                   /translation="MEAVGQRILSVKDAVLTRRSIRKFKPQPIPQEVLEEILSLALKAP
FT                   SSNNLQPWRVVVVQNPELKERLREAANNQAQVSSAPAVLVVYSDMKDTLEHVEEIFHPG
FT                   FSEEQKQLRAANLRKAWESKSDEERENWGKAQGFILLAFLMLIARSYGYDTVPMGGFNA
FT                   SKVKEILNLPPHVAITALLPIGIADEAGFEHHRHNLQRVVRWQ"
FT   gene            complement(161899..162672)
FT                   /locus_tag="Mrub_0183"
FT   CDS_pept        complement(161899..162672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0183"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; InterPro
FT                   IPR002942:IPR006145:IPR000748; KEGG: bcy:Bcer98_3369
FT                   pseudouridine synthase; COGs: COG1187 16S rRNA uridine-516
FT                   pseudouridylate synthase and related pseudouridylate
FT                   synthase; SPTR: A1HLV7 Pseudouridine synthase; PFAM: S4
FT                   domain; RNA pseudouridylate synthase; TIGRFAM:
FT                   pseudouridine synthase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26963"
FT                   /protein_id="ADD26963.1"
FT                   /translation="MLILSAPVIGGFLFNMAYERLDKVLGHLGVGSRKEIHRLARAGLI
FT                   TINGKIVADAGFKFDPSQAHIEVAGEPLVYQKFFYLLLNKPAGYITSTKDPSGTPITAL
FT                   LPEEFWRNDWMPVGRLDKDTEGLLLLTTDGELLHRLTHPRWKVTKRYYVELASPATPED
FT                   VAVFAAGTLELEGEPLQPAELYLGPDPRKVELVLREGRFHQVKRMFAARGNQVTYLKRL
FT                   AFGPLQLPPNLPPGASRQLTPDEIKALYEVVGLPG"
FT   gene            162886..163053
FT                   /locus_tag="Mrub_0184"
FT   CDS_pept        162886..163053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26964"
FT                   /protein_id="ADD26964.1"
FT                   /translation="MDEALLTNDMAMLEARLAMFAQARRELVAARAALFTETARWVRAM
FT                   FRPWKGVRYG"
FT   gene            163046..163189
FT                   /locus_tag="Mrub_0185"
FT   CDS_pept        163046..163189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26965"
FT                   /protein_id="ADD26965.1"
FT                   /translation="MDRAQLAYQIWLAQLALYRSRLQVHELFFVTEYLEFTREKSREVY
FT                   RA"
FT   gene            163574..164668
FT                   /locus_tag="Mrub_0186"
FT   CDS_pept        163574..164668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0186"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A6MNA4 Putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26966"
FT                   /protein_id="ADD26966.1"
FT                   /translation="MTAPRPSIESPAFSNLKADLAANPPKVRKTIDYYRQQIALEARER
FT                   HKLNQQSFELYSHLLNAALLWLGHKRLSTLPKQVTLHAPLEQVALDFGVHRHTIKHWLR
FT                   PLVQAGLVVYRPQKVTAWGRTCHTGTVWFVSLDPTRKARLIWSDMKETYRNLEQDKANG
FT                   KLSYTVIRHTKESGQLGLDAGLLNWAIPSRSIQPENNLYVENSSSTVEVLFEVEFASRK
FT                   EVGEVVERAARAILAALGDDPRRFGGWCWLLWQARRLADVGQSIFTRLYEQIRRGMDAR
FT                   ERGRLNNPAAYTRHLLDETGLLDMLRNAPVRRWPTWEGGHEHLPAKSRLADAIRHSYRS
FT                   AAVHRPRAPHQHPPPHPQRLPTGS"
FT   gene            164720..164953
FT                   /locus_tag="Mrub_0187"
FT   CDS_pept        164720..164953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26967"
FT                   /protein_id="ADD26967.1"
FT                   /translation="MAKPGRKLGYRTPNSLLTYPILENLYLMGYSSDKAAQIVRELGYT
FT                   CSNHTAWRRWKEFERKHPEALLRYGQPKREVV"
FT   gene            164950..165102
FT                   /locus_tag="Mrub_0188"
FT   CDS_pept        164950..165102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26968"
FT                   /protein_id="ADD26968.1"
FT                   /translation="MIAFGLLFVLVVAVVWLGPENTFWQAVFLAALAVAIGLWISTALN
FT                   TLRRK"
FT   gene            165202..165546
FT                   /locus_tag="Mrub_0189"
FT   CDS_pept        165202..165546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26969"
FT                   /protein_id="ADD26969.1"
FT                   /translation="MERAGTVLEMGGYWSLLPSADKNWEPNVIITAEIEGKIRRKHNVR
FT                   PQEVHQALADPKRRSRPVMSEGENPVALVVGSTDAGRKLTMIVILLPDSLYLVSARTAR
FT                   AREIAEVHYE"
FT   gene            165539..165739
FT                   /locus_tag="Mrub_0190"
FT   CDS_pept        165539..165739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26970"
FT                   /protein_id="ADD26970.1"
FT                   /translation="MSRAMARTTSKTPRKVKVPRRLTQGPEQLGPLADWVDRHSTRLEL
FT                   GPIDPELDRQITHRLTKPRYE"
FT   gene            165732..166106
FT                   /locus_tag="Mrub_0191"
FT   CDS_pept        165732..166106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26971"
FT                   /protein_id="ADD26971.1"
FT                   /translation="MNDAPPFTTRRRATYERSLAYRLGLRACAKRNSLSPAEIEHRHIL
FT                   EVITGSAEAAEYLAHEFPTLYALAQFGSRYGFKRLEFCPGISYAAIGKLEVWLESQGRV
FT                   GMQLTVAHGSDWPKRKHRRG"
FT   gene            complement(166180..166821)
FT                   /locus_tag="Mrub_0192"
FT   CDS_pept        complement(166180..166821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0192"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bcb:BCB4264_A3245 transcriptional regulator,
FT                   ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26972"
FT                   /protein_id="ADD26972.1"
FT                   /translation="MSQSMPRAHLVDNALAARILADPKSAVFLKPFMRSPTTIKAAAEA
FT                   FGLPIQTLHYRVEQMHKAGLLKVVAVSKRQGRPIKHYQAISTSFRVPLELIPQRLLENL
FT                   TGHAFWKARLERSLQKALREHPGSEIVVYRNADGLLVWGSYLEEEAHPPEHLNPQHPAI
FT                   LNLWNGGLMLDRDDAKALQRELWELYERYAHRNGSEKYVLHLGLAPTLET"
FT   gene            166918..168264
FT                   /locus_tag="Mrub_0193"
FT   CDS_pept        166918..168264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0193"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; InterPro
FT                   IPR011701; KEGG: mxa:MXAN_4533 major facilitator family
FT                   transporter; SPTR: A0Z9Q5 Putative uncharacterized protein;
FT                   PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26973"
FT                   /protein_id="ADD26973.1"
FT                   /translation="MQPYLTGLRGFTLVALGQLVSLVGSGMSQFALTIWAFEKTGLATS
FT                   LALMGFFYMVPLILISPLAGAWVDRGNRKLMMMLSDLGAAGGTLVVFLLYLSGNLEIWH
FT                   LYVVGTLNGLTSAFQWPAYSAAISTMVHKRDYARANGLLSLAESASGIGAPILAGILLG
FT                   LVGLRGILLLDLLTFTAAFTTLMLVHVPQPKPSAAGRESRGSLLGEALYGFRFIFARPS
FT                   LLGLQTVFLLGNLVANLGSAIMAAMILARTASSETALATVQSAAGVGGVLGGVLLSTWG
FT                   GPRRKVHGVLMGWVLSSFFGSVLLGLGQSVWVWATCAFIFALIVPILNGSNQAIWQAKV
FT                   PPDVQGKVFAARRMIAWVAGPLAMLVAGPLADRVLTPAMMPDGALAGVFGGLVGVGPGA
FT                   GMAFLLVISGLLGMVVGLGGYLFRVVREAEDLIPDHDHTPEVRPEPVAS"
FT   gene            168324..168962
FT                   /locus_tag="Mrub_0194"
FT   CDS_pept        168324..168962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0194"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PRIAM: ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; InterPro
FT                   IPR013820; KEGG: pca:Pcar_2689 ATP
FT                   phosphoribosyltransferase catalytic subunit; COGs: COG0040
FT                   ATP phosphoribosyltransferase; SPTR: Q5SM15 ATP
FT                   phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26974"
FT                   /protein_id="ADD26974.1"
FT                   /translation="MIRGRFTLVVALPKGRNFADGYRALAQAGLELPPLEGERALLHGQ
FT                   EGGVAVLELRNHDVPTYVDLGIADVGVVGNDVLLESGRDVYEPVDLGTGACRLSLIRHP
FT                   AATDPIRRIATKYPRFTAQVLRERGMVADIIELAGNVELAALTGLADAVVDVVQTGATL
FT                   KAAGLLEVEVLAHSTARFIVNRQSLKLKRDLLRPLIERLRANAHNLPAS"
FT   gene            169036..170052
FT                   /locus_tag="Mrub_0195"
FT   CDS_pept        169036..170052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0195"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; SPTR: A6EJN1 Putative
FT                   oxidoreductase; InterPro IPR001395; COGs: COG0667
FT                   oxidoreductase (related to aryl-alcohol dehydrogenase);
FT                   KEGG: sfu:Sfum_0298 aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26975"
FT                   /protein_id="ADD26975.1"
FT                   /translation="MRYRKLGKSGLFVHPIALGTMQFGWTADEPTAFAIMDAFVEAGGN
FT                   LIDTADIYSTWAPGNPGGVSEEIIGRWLKSRGLRDRVIVATKVRGPMGPGGSEGRNHPL
FT                   QREGLSRVWIMRAVEDSLRRLQIDHIDLYQVHWVDNQVPIEETLSALTDLVRKGYVRYI
FT                   GCSNFSAWRLMQALWASDKHGFESFISIQPEYSLTMPTRMNFERELARVCETYGLGVIP
FT                   YSPLAGGFLTGKYRRDQPLPESVRAQGIASGRFSEQNWKILDKVLEIAQQRGAHPAQVA
FT                   LAWQLSRPFITAPIVGANSVQQLQDLLPAAQLQLSAEEVAALNEVSSWPLSRTEREV"
FT   gene            complement(170049..171017)
FT                   /locus_tag="Mrub_0196"
FT   CDS_pept        complement(170049..171017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0196"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; SPTR:
FT                   A6CQ11 Quinone oxidoreductase; InterPro
FT                   IPR013154:IPR013149:IPR002364; COGs: COG0604 NADPH:quinone
FT                   reductase and related Zn-dependent oxidoreductase; KEGG:
FT                   bcz:BCZK1920 quinone oxidoreductase; PFAM: Zinc-binding
FT                   dehydrogenase; Alcohol dehydrogenase GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26976"
FT                   /protein_id="ADD26976.1"
FT                   /translation="MKAIVVEQNGPPEHLRYREVPEPSPGPDEVLVRTSLTSLNYADVQ
FT                   ARRGGYEAGSPPPFIPGLDAVGVVEALGAEVRGLALGQRVAVFASGGSYAEKVLAKGVL
FT                   TYPVPDDLPDEAVAGLTALVTAYNTLTWAGRLQPNETVLVHAAAGGVGSLAVQMAKALG
FT                   AGLVIGTVGHPAKAGFVRSLGADAVVGYEGFAEQVLERTQQKGADLILDSVAGEVFSQG
FT                   MRCLAPFGRLVVYGHASGQAGSFETRPLHRQTKAVIGYSSGHYRRNRPELLRPTVEAVF
FT                   ALLRSGRIRLHIGARYSLEQAAQAHALMESRQSTGKILLYP"
FT   gene            171050..171682
FT                   /locus_tag="Mrub_0197"
FT   CDS_pept        171050..171682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0197"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="PRIAM: tRNA guanosine-2'-O-methyltransferase; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); InterPro IPR001537;
FT                   KEGG: aeh:Mlg_0536 tRNA guanosine-2'-O-methyltransferase;
FT                   COGs: COG0566 rRNA methylase; SPTR: A3IM41 RRNA methylase
FT                   SpoU; PFAM: SpoU rRNA Methylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26977"
FT                   /protein_id="ADD26977.1"
FT                   /translation="MTPERLARIRAVLNKRQPDLTVLMERVHKPHNFSAILRSCDAVGV
FT                   LEAHAIPAKHGIPNLEEAEDLSLKGKTFNETSGSAAKWVGLQLHADTASAFAHLKARGF
FT                   QVLAAHFSERAVDYRQADYTRPTCILLGTEKWGVSPEAAELADAHILIPMVGMVQSLNV
FT                   SVAAAVILFEAQRQRLQAGFYEQVRLAPEQYEAVLQSWMARHAQGQG"
FT   gene            171724..172905
FT                   /locus_tag="Mrub_0198"
FT   CDS_pept        171724..172905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0198"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; SPTR: A1HTH4 VanW family
FT                   protein; InterPro IPR007391; COGs: COG2720 Uncharacterized
FT                   vancomycin resistance protein; KEGG: bce:BC0606 vancomycin
FT                   B-type resistance protein VanW; PFAM: VanW like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26978"
FT                   /protein_id="ADD26978.1"
FT                   /translation="MRTTTLAIFCWISLALAGPDGLYYALENRIEKGQIVTVGVSQRIK
FT                   IGGVGQLPLLLKQAARPALEARWRYDAALKDWVLQDQMGHTFDLAEAKKRYLEALQSGQ
FT                   TEFLLPVRHTLHPRGTPYFYNLGIRELLAEATTSFAGSSYERRYNIQLGASRLDGALIP
FT                   PGEIFSFARAMGEVSERTGFKKAFVISGEQTVEGVGGGMCQVSTTLFRSAYFAGLPIVQ
FT                   RQPHSYQVRYYQPTGLDAAVFLPSLDLRFKNDTPGHLLIQSSVRGSQITFRIFGTRDRR
FT                   VTWSNPIVLNRTPALPTRYIATLELPAQRFVQVDWAAEGATVQVHRTIRFSNGRVQKDT
FT                   LTSTYRPWGAVYLVGEGTQLKSGRVITAATDDAPDNHGYRLPTQNILRPTRSP"
FT   gene            complement(172960..173775)
FT                   /locus_tag="Mrub_0199"
FT   CDS_pept        complement(172960..173775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0199"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; SMART: transglutaminase
FT                   domain protein; InterPro IPR013589:IPR002931; KEGG:
FT                   cak:Caul_2196 transglutaminase domain-containing protein;
FT                   COGs: COG1305 Transglutaminase-like protein; SPTR: A7CSA8
FT                   Transglutaminase domain protein; PFAM: Bacterial
FT                   transglutaminase-like N-terminal region;
FT                   Transglutaminase-like superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26979"
FT                   /protein_id="ADD26979.1"
FT                   /translation="MLLAVYHLTEYFYPDAARDSFNELWLYPVDDHRQGLLEFRLQITP
FT                   HAPARSRQDYFHNRVYSFHLHHPHTTLRVETQAKVLTFAIPEPRPVPVQALRSLQPRFF
FT                   EFLAPTARIPLHHNWLELLGVRRPLPHENLHSYLLEVTEHLHRSFRYDATATELNTPLL
FT                   QFVEGRAGVCQDYAQAMLAVLRSVGIPARYVSGYLATGVGSQGSHAWVEAFVPGSGWYG
FT                   YDPTNNSTITEQYIKKAHGRDYDDCPPLKGLRRGGGQERLNVLVQVKVL"
FT   gene            complement(173788..174729)
FT                   /locus_tag="Mrub_0200"
FT   CDS_pept        complement(173788..174729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0200"
FT                   /product="ribokinase"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139:IPR011611:IPR011877; KEGG:
FT                   bur:Bcep18194_C7623 ribokinase; PFAM: PfkB domain protein;
FT                   SPTR: A7CMJ7 Ribokinase; TIGRFAM: ribokinase; PFAM: pfkB
FT                   family carbohydrate kinase; TIGRFAM: ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26980"
FT                   /protein_id="ADD26980.1"
FT                   /translation="MSIVVVGSINMDLVVRVKRHPVPGETLLGSDYETHHGGKGANQAV
FT                   AAARMLARPMPTKSASPGPAPGVRMIGRVGQDEFGQQLRNALKREGINVSATLPIAAPT
FT                   GVAFIAIDEEGQNTIIVSPGANHRLRPEHLSPAEFEEARVVVLQLEIPLETVRRAAELG
FT                   RQAGAQVILNAAPAQKLPDKLLHHIDILVVNEIEALGLSGVKPDSPEMALEVAQLLAKK
FT                   VPTVIITLGEQGAVWASPEGQGHQPVPEVEVVDATGAGDAFIGALAAALCEGRPLAQAV
FT                   AHGCVAGALATTKTGAQSSLPWREEVCARLEL"
FT   gene            complement(174771..175700)
FT                   /locus_tag="Mrub_0201"
FT   CDS_pept        complement(174771..175700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0201"
FT                   /product="Ribosylpyrimidine nucleosidase"
FT                   /EC_number="3.2.2.8"
FT                   /note="PRIAM: Ribosylpyrimidine nucleosidase; PFAM:
FT                   Inosine/uridine-preferring nucleoside hydrolase; InterPro
FT                   IPR001910:IPR015910; KEGG: rsq:Rsph17025_1107
FT                   inosine/uridine-preferring nucleoside hydrolase; COGs:
FT                   COG1957 Inosine-uridine nucleoside N-ribohydrolase; SPTR:
FT                   A3V6K9 Inosine-uridine preferring nucleoside hydrolase;
FT                   PFAM: Inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26981"
FT                   /protein_id="ADD26981.1"
FT                   /translation="MPRKIILDCDPGHDDAIAIMLALASEELEVLGITTVYGNVSLERT
FT                   TRNALVVREVLGKSVPIYAGADRPLVCERISAEAVHGVSGLEGPHLPTPSGQAEPEHAV
FT                   HFIIEQVLQHPGEVTLVPVGPLTNIALAMRLEPRIIPQIREIVLMGGSIDIGNWTPSAE
FT                   FNILCDPHAAKIVFGAGVPLVMMGLNLTHQTIAHPTRVARFRALETRVGNFVAELLEFF
FT                   REHHVQRYKWDGAPIHDACAVAYLLRPELFKTAMFNVEIEANEGLTFGRTVCDYWRVTG
FT                   RQPNCEVGLEVDVDGFYELLLERIARYA"
FT   gene            175754..176017
FT                   /locus_tag="Mrub_0202"
FT   CDS_pept        175754..176017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26982"
FT                   /protein_id="ADD26982.1"
FT                   /translation="MLEVKEAVRIATEYIQTLFNEKQIPELRLEEVELTPDNRFWEVTL
FT                   SFVVREPTAYLSLGDAARTREYKIFRINAETGQVQSMKIRKV"
FT   gene            176028..177125
FT                   /locus_tag="Mrub_0203"
FT   CDS_pept        176028..177125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0203"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; PRIAM: Alanine racemase;
FT                   PFAM: alanine racemase domain protein; InterPro
FT                   IPR000821:IPR011079:IPR001608; KEGG: bcy:Bcer98_1563
FT                   alanine racemase; COGs: COG0787 Alanine racemase; SPTR:
FT                   Q8ELK1 Alanine racemase 2; PFAM: Alanine racemase,
FT                   N-terminal domain; Alanine racemase, C-terminal domain;
FT                   TIGRFAM: alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26983"
FT                   /protein_id="ADD26983.1"
FT                   /translation="MRPAWLEINLDALAHNYNLLRSRAGNTQVIGVVKANAYGHGAVEV
FT                   GKELLRLGAWGLAVATTDEARELRKAGIVARILLMGSLHPQQAREVVELDLIPSISTLE
FT                   SAEALNALGKPVTVHLEFDTGMGRVGFQPEEAPQVKEHLVRYENLLVQGIYSHFADAEE
FT                   DVLWTKEQIAHFKQVQQVFGPGYFYHLCNTAGTFNFGEYGLSAVRPGIGLYGLLPHLGL
FT                   KPIARLLAKPTQVKELPPGRRIGYSGLYTTQGREWIATLPVGYADGIPRLVFNRATVRY
FT                   YPDDQPCTCPVVGRVSMDQITVKLPGPVGLEQVFEVVTPDFDPTSSLWGWAELTGTVSY
FT                   EPAVRLAARLPRVYLRDGTEVARVG"
FT   gene            177184..177504
FT                   /locus_tag="Mrub_0204"
FT   CDS_pept        177184..177504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26984"
FT                   /protein_id="ADD26984.1"
FT                   /translation="MKAIKLFQGYLWHPKELSFDPREAIPRQLGEVHVLIDKVRAPMTF
FT                   FEDGTPTETQQFYQVTLLVRTEQEPQDLKPLALWVSQALKPYLEATPKEVGWQLLEDLR
FT                   QV"
FT   gene            complement(177510..178103)
FT                   /locus_tag="Mrub_0205"
FT   CDS_pept        complement(177510..178103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0205"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="SPTR: A0YAV8 Acetyltransferase, GNAT family protein;
FT                   COGs: COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: mxa:MXAN_1062 acetyltransferase,
FT                   GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26985"
FT                   /protein_id="ADD26985.1"
FT                   /translation="MVVLGYMWHDCPILEGLYIRLEPLRLEHAPALLEHYDAEMVQYLS
FT                   NAPREATLEAMQNYIRSLLSAKDRVNWVIVDRASGQMAGRTGYVRINPEYRGLETTTWI
FT                   FTPFQGGYANPESKYLLLCRAFEDLKAIRVQFRADARNTRSCKAIEKLGATFEGILRKD
FT                   QIYPNGTIRNTAVYSIIDDEWPQVKKGLEARLYR"
FT   gene            178128..178634
FT                   /locus_tag="Mrub_0206"
FT   CDS_pept        178128..178634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0206"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; InterPro
FT                   IPR001453; KEGG: molybdenum cofactor synthesis domain
FT                   protein; COGs: COG0521 Molybdopterin biosynthesis protein;
FT                   SPTR: B2YI79 Molybdopterin biosynthesis enzyme; PFAM:
FT                   Probable molybdopterin binding domain; TIGRFAM: molybdenum
FT                   cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26986"
FT                   /protein_id="ADD26986.1"
FT                   /translation="MIRVGILTISDREARGESEDHAYAALRESLALGPYEIANYEIIPD
FT                   EPAQIKRVLRLWADRDGLDVILTLGSIRLSNRDHAPEATREMLEKEAPGIAELIRMETY
FT                   KKNPLAALSRGVAGVRGKTLIINLPGGPQGSKDSLEVILPLIPEAVQRITGRPVAHLAN
FT                   GFSFD"
FT   gene            complement(178857..179114)
FT                   /locus_tag="Mrub_0207"
FT   CDS_pept        complement(178857..179114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26987"
FT                   /protein_id="ADD26987.1"
FT                   /translation="MDYLVAALSVGLVLYFLLRVLQGVLPAGWKARTRSRGLRLLSRSH
FT                   QRCEVCKELLNPAEVAALRQGRRKCPEMARCPYQRSRWLN"
FT   gene            179226..181430
FT                   /locus_tag="Mrub_0208"
FT   CDS_pept        179226..181430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0208"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; SPTR: A3I6K8 Transporter;
FT                   InterPro IPR004869:IPR000731; COGs: COG2409 drug exporter
FT                   of the RND superfamily; KEGG: bcy:Bcer98_1012 transporter;
FT                   PFAM: MMPL family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26988"
FT                   /protein_id="ADD26988.1"
FT                   /translation="MLAPLARLVARYPVQIVLVWLLLVLLAIPAARLAPQNLAANASAV
FT                   KNSEAQKVLQILTEAFGLPPVDRTVLVSESSLPEHDPRFRQTYNQLMARMQTLEGVLRI
FT                   HRYDAPSPLQQQSQDGKITATLLDTRLENGEAVIEALRREARAAQTPEIRFYVTGATAV
FT                   TKDFLHLLEADVKRSELMALPLTGLVLLLAFGALVATGLPLLVGVVAITTGLACLFFLT
FT                   LWGEVSSFALSVITMLSLGAGIDYALLMVNRFREELAAGRPAQAAAAITTQTAGRTVAF
FT                   SGLVVAIAMGAMLVPDLTFIRSMGVGGVMAITLTVLVSITLLPALLALLGERVNAPRRW
FT                   AFKPTSSGKASPFWGRWASVVMQRPWMWSFGVMGLLLALAWPATQMKLGYTGAFGLGPH
FT                   VESRKGLELIRQLELGGALDAFEVLLDLGEEGFTPQNRARWRALEQRLSAWPEVRLVVS
FT                   PFLAGRLEGQGGFAELVGLTNQYISQDRRYLRLTVIPRDAVHAPSIPDWYARLKQEAQQ
FT                   AGFQRVLLGGAPVGSMEFTQALVGAMPAAIGTVFVATFLLLAVAFRSLVIPLKSILMNT
FT                   LTVGAAYGLITLVFQEGFAARLVGAPTDVGGIDSSLPILMFAVIFGLSMDYEIFLLSRV
FT                   QEAHLAGLDTPQAVRYALERTAGVIGSAALIMVIVFSAFVVGQVVANKTIGLGLALAVL
FT                   LDATLVRLVLVPAVLVLAGRWNWWLPEPLQRVMPRVRLEP"
FT   gene            complement(181443..182615)
FT                   /locus_tag="Mrub_0209"
FT   CDS_pept        complement(181443..182615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0209"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD; SPTR:
FT                   A6BHW2 Putative uncharacterized protein; InterPro
FT                   IPR012947:IPR002318; COGs: COG2872 metal-dependent
FT                   hydrolase related to alanyl-tRNA synthetase HxxxH domain;
FT                   KEGG: sus:Acid_1476 alanyl-tRNA synthetase; PFAM: Threonyl
FT                   and Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetases class II (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26989"
FT                   /protein_id="ADD26989.1"
FT                   /translation="MRAYWDHPYESQFEAQVVRAWSEGGKHFAVLDQTLFYPTSGGQAC
FT                   DTGHLGGVAVLEVLEDAKATGPVIHRLESPLLEGQRVVGQLDWARRYRHMQRHTAEHML
FT                   GQAFLRAAGWNVVAVNMSNPVCTMDFDGPPDEAVIRQAEALANWAVYANTAVRTYFIND
FT                   AEAPAHGLRRAPKVAGLIRVVEIEGWDRVACGGLHVARTGEAGPIKITRFERYKGGTRV
FT                   YFMAGWEALELFEQEHRLLARLGEWFSSSPLEVEKPIGNLREEWRRARAENAALKDELA
FT                   ERIMRDLLTEFPTQTMAAQVPHSVLDMVGKRLAEWPGVLALLVAQAEDKARYVLLKHPS
FT                   RSEDLQAIWEEVLKPLGARGGGALVKLGVMPLKSLHPALLAFQRYLAQER"
FT   gene            complement(182638..184518)
FT                   /locus_tag="Mrub_0210"
FT   CDS_pept        complement(182638..184518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0210"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="TIGRFAM: ATP-dependent metalloprotease FtsH; PRIAM:
FT                   Microtubule-severing ATPase; PFAM: peptidase M41; peptidase
FT                   M41 FtsH extracellular; AAA ATPase central domain protein;
FT                   InterProIPR011546:IPR000642:IPR003959:IPR003593:IPR
FT                   003960:IPR005936; SPTR: A1HRR8 ATP-dependent
FT                   metalloprotease FtsH; KEGG: eba:ebA4823 cell division
FT                   protein; COGs: COG0465 ATP-dependent Zn protease; SMART:
FT                   AAA ATPase; PFAM: Peptidase family M41; FtsH Extracellular;
FT                   ATPase family associated with various cellular activities
FT                   (AAA); TIGRFAM: ATP-dependent metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26990"
FT                   /protein_id="ADD26990.1"
FT                   /translation="MNRLPFNLWFILLAAILIAWAFSLTSHQQPANQVAYTTFLNEIDQ
FT                   GRVAKITVDGRQLNVTRREDGDQYVTFAPGPIDTSTIREWGDKKIQVDIAAPRRENPLL
FT                   GFLIPLLLIGLLIGVFFFFSRNRGPSGDNAFSFTKSRAKVLTEAPKTSFKDVAGCEEAK
FT                   EELKEIVEFLKAPARFHEMGARIPKGVLLVGPPGSGKTHIARAVAGEAKVPFIAASGSD
FT                   FVEMFVGVGAARVRDLFETAKRHAPCIIFIDEIDAVGRRRGGGVGGGNDEREQTLNQLL
FT                   VELDGFEKETSIIIMAATNRPDVLDPALLRPGRFDRQVAIDAPDVKGREQILKIHAKGK
FT                   PLAEDVDLSLLARRTPGFVGADLENLLNEAALLAARDGRKKITMKDLEEAADRVMMGPA
FT                   KKSMVITPKDREVTAYHEAGHALAAHFLEHADKVHKVTIVPRGRAMGFMMPSRQDTLHW
FT                   SKKRLTDQIAVALAGRVAEELIFDDVTTGAENDFRQATDLARRMITEWGMHPDFGMVAY
FT                   QVREDTYLGGYDTRQYSEDTARRIDEAVQKLLQEQHDRVLGLLTEKREVLERVAQTLLE
FT                   RETLNAEEFVRVVEGEKLERLEPTSETPKDKEEKEPPRVVPKVKPNLGGA"
FT   gene            184801..186666
FT                   /locus_tag="Mrub_0211"
FT   CDS_pept        184801..186666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0211"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; InterPro IPR001023:IPR013126:IPR012725; KEGG:
FT                   Hsp70-type chaperone; COGs: COG0443 Molecular chaperone;
FT                   SPTR: Q72IK5 Chaperone protein dnaK; PFAM: Hsp70 protein;
FT                   TIGRFAM: chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26991"
FT                   /protein_id="ADD26991.1"
FT                   /translation="MAKAVGIDLGTTNSVIAIMEGGSPVVLENAEGERTTPSVVAYKGS
FT                   DQLVGRVARRQAVLNPEGTVFEIKRFIGRRWEEVQDEVKRVPYKVVKGPDGGVRVDIAG
FT                   KLYTPEEISAMILRKLVDDASKKLGEKITKAVITVPAYFNNAQREATANAGRIAGLEVL
FT                   RIVNEPTAAALAYGLDKKGHETVLVFDLGGGTFDVTVLEIGDGVFEVKATAGDTHLGGS
FT                   DFDHAIVNWLAEEFKKESGGVDLKADRQALQRLIEAAEKAKIELSAVTETTISLPFIGL
FT                   DPISKTPLHLERKLTRAKFEELIQPLLKKIRGPVEQALRDAGLSASQIDEVLLVGGSTR
FT                   VPAVQQIVKEMLGKEPNRSVNPDEVVALGAAVQAGVLTGQVEDVVLLDVTPLSLGVETK
FT                   GGVFTVLIPRNTTVPTRKSEIFTTAEHNQPSVEIHVLQGERPMAADNKSLGRFRLDGIP
FT                   PMPAGVPQIEVTFDIDANGILHATAKEKSTGKEASITIQNTTTLSEQEIERMIKEAEAN
FT                   AEADRKRKEHADLKNNLDAARIQAERVMGEKESTAEAKSRLEAAISRAKTLVDTDGSDA
FT                   DLRQATEELLAALQAYEQGAAAGSQAQSSTPKSDDVIDADYKPAD"
FT   gene            186745..187299
FT                   /locus_tag="Mrub_0212"
FT   CDS_pept        186745..187299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0212"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; SPTR: Q8L2F3 Protein grpE;
FT                   InterPro IPR000740; COGs: COG0576 Molecular chaperone GrpE
FT                   (heat shock protein); KEGG: Os02g0612000; hypothetical
FT                   protein ; K03687 molecular chaperone GrpE; PFAM: GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26992"
FT                   /protein_id="ADD26992.1"
FT                   /translation="MENNEPVVETPEAQNDLPEVERLKGEVEFLKAELEASKNKFLRLY
FT                   ADFENYKKRMVQELEAAQRNGKFDAVRALLGTLDDLERALGFASVKPEDLIPGVRSVLE
FT                   NFTRSLKSLGVEAVPGVGAEFDPRYHEAIGAVEGEEGKVMHVYQQGFKYGDLLVRPARV
FT                   VVGSGAKPEEAEGPKPSAESN"
FT   gene            187355..188230
FT                   /locus_tag="Mrub_0213"
FT   CDS_pept        187355..188230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0213"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: chaperone DnaJ domain protein; heat shock
FT                   protein DnaJ domain protein; SMART: heat shock protein DnaJ
FT                   domain protein; InterPro IPR003095:IPR002939:IPR001623;
FT                   KEGG: afr:AFE_3102 curved DNA-binding protein; COGs:
FT                   COG0484 DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain; SPTR: Q56237 Chaperone protein dnaJ 2; PFAM:
FT                   DnaJ C terminal region; DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26993"
FT                   /protein_id="ADD26993.1"
FT                   /translation="MAYKDYYKILGVPKNASEDEIKKAFKKLARKYHPDVNKEPGAEEK
FT                   FKEINEAYTVLSDPEKRRYYDTYGAAAGSAGWQGPPPGPGGFGGFTGNVGDFSDFFQQL
FT                   FGGRGGFGGLGDLFEQTPGRGARRVAGDLEAELPLSLEEAYRGGEKTISVGAERLTVRI
FT                   PPGVREGQKIRLAGKGRAGGDLYLHVKLQSRPEMRLEGDDIYTVVEVPAPIAVVGGKVR
FT                   VQTLDGPVEITIPRRTQAGRKLRLAGKGWPRKDKSRGDQYAEVRVTIPTNPSPEEERLY
FT                   AQLAELIKVQ"
FT   gene            188254..188799
FT                   /locus_tag="Mrub_0214"
FT   CDS_pept        188254..188799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acb:A1S_3013 hypothetical protein; SPTR:
FT                   A6EIW0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26994"
FT                   /protein_id="ADD26994.1"
FT                   /translation="MTPQQRDDLLRLLKNRFEQHPHRHPGLRWADLEARLLAQPDKLAS
FT                   LLEMENTGGEPDVVGRDPQTGTFIFFDCAPESPKGRRSLCYDQAARLARKQNRPASSAL
FT                   EMAAAMGIELLTEEQYQALQQLGRFDTKTSSWLKTPEAIRKLGGAIFGDRRYDRVFIYH
FT                   NGADSYYAARGFRGCLRV"
FT   gene            complement(188861..188947)
FT                   /locus_tag="Mrub_R0002"
FT   tRNA            complement(188861..188947)
FT                   /locus_tag="Mrub_R0002"
FT                   /product="tRNA-Leu"
FT   gene            189113..191533
FT                   /locus_tag="Mrub_0215"
FT   CDS_pept        189113..191533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0215"
FT                   /product="CRISPR-associated protein, Csm1 family"
FT                   /note="KEGG: sfu:Sfum_1349 CRISPR-associated protein, Csm1
FT                   family; COGs: COG1353 hydrolase of the HD superfamily
FT                   (permuted catalytic motifs); SPTR: A4KK95 Putative
FT                   uncharacterized protein; TIGRFAM: CRISPR-associated
FT                   protein, Csm1 family; InterPro IPR000160:IPR013408; PFAM:
FT                   HD domain; TIGRFAM: CRISPR-associated protein, Csm1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26995"
FT                   /protein_id="ADD26995.1"
FT                   /translation="MSDPANIALAALLHDLGKLYQRAYWGHAPEGVSDWSHPAYTEWAI
FT                   RQHRRLFEQAGLEPDWLAQTAARHHEGWSNKPQYQPQTPEGWCVALADTYASRERLEVD
FT                   EKGSRAPDTPLKSVFANLRVQETYGQRDHGYSMVEAGREVGLKLGGAYPQARPNVSRDT
FT                   YWRLAERLDGRLTELAKHSLGPEALLMNLLGIFQELLWNVPSDTQGEPDVSLFDHLRLT
FT                   GAIAAALWAYHDGKATVEALRDETPEKFLLVLGDLGGIQGHIYRIQGAQTGVGGLAKRL
FT                   RARSLEVSLAAEALGLELLQRTGFTPLQRIMSAGGKFYLLLPNTEAVHRALDAVRQGWE
FT                   AWALQQGATLLPFLAAHPFAPGGFRAFSEVLKAAHQKLVEAKLKPLSSQLSTPYLTSGS
FT                   TSLRPCRACGVRPAQSATDELCHGCERDGHMGRLIPKRTEIGFFPQDAPRPHYRFPAWQ
FT                   VALEASPAHTLRTRPDFTPAAHPWEVRLLAGHIPTLADALRQGRWRDLAEYQAWAKEQG
FT                   LWEEEEEGRKADDPLTLAELAEFSTGAKYLGALMLDADRMGEAFATGFKDEEGQDSSSP
FT                   SRIASLSRMLELFFAGEVLELIKNPQTYAKRLGWDELKAREKAARYPLIYSVYAGGDDL
FT                   FLLGPWDVLLEFALDLQALYREFTQHPALTLSGGFVLVSPSLPIPLLAEAVQEAEQAAK
FT                   NAGRNRLHLFGQGVPWDELRNLLPWVRDFRRHLEAEGKAGLSSALAYRLLRLWRGHQDE
FT                   DEARRMRYKPLLAYALRERNEEIRKHYLQLTDHTQAAWQYLPVWVQWGLYLER"
FT   gene            191543..192025
FT                   /locus_tag="Mrub_0216"
FT   CDS_pept        191543..192025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0216"
FT                   /product="CRISPR-associated protein, Csm2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csm2 family;
FT                   InterPro IPR005504:IPR010149; PFAM: protein of unknown
FT                   function DUF310; PFAM: Protein of unknown function
FT                   (DUF310); TIGRFAM: CRISPR-associated protein, Csm2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26996"
FT                   /protein_id="ADD26996.1"
FT                   /translation="MEFFENQEKGIYKKGLFDEDAKRWAQDLRNEGQGQDKLKSSQFRN
FT                   YFHEFRRLEDVFDRYKRETGGDEALAWNRLTSQIELLRAKLAYGGRSNGGPLQKLPLFR
FT                   SKMDELLSDAKRSPKHFAAVMLFLEAVLAYFYGLEGERGGEAAPRSPERPAQGRRY"
FT   gene            192026..192700
FT                   /locus_tag="Mrub_0217"
FT   CDS_pept        192026..192700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0217"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm3
FT                   family; PFAM: protein of unknown function DUF324; InterPro
FT                   IPR005537:IPR013412; KEGG: dol:Dole_0742 CRISPR-associated
FT                   RAMP Csm3 family protein; COGs: COG1337 Uncharacterized
FT                   protein predicted to be involved in DNA repair (RAMP
FT                   superfamily); SPTR: Q8TPH9 Putative uncharacterized
FT                   protein; PFAM: RAMP superfamily; TIGRFAM: CRISPR-associated
FT                   RAMP protein, Csm3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26997"
FT                   /protein_id="ADD26997.1"
FT                   /translation="MKLLGYKRIHGIIHLRSGLRIGMSKDQMAIGDVDNPVIRNPLTDE
FT                   PYIPGSSLKGKMRYLLEWHLGGKYITESDQYHVYKDEDGPIGRIFGVAPGNDRRSKELA
FT                   QQRGPTRLLVRDAYLTRESKERLEAMTARGGYLTEVKQEVFIPRIGGNANPRTAERVPA
FT                   GAKFAFEMVYRVMDTGDGGQTDQSNFEYVKKALELLQLDGLGGYISRGYGQVELRYEVE
FT                   EK"
FT   gene            192697..193584
FT                   /locus_tag="Mrub_0218"
FT   CDS_pept        192697..193584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0218"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm4
FT                   family; SPTR: A6DE73 Putative uncharacterized protein;
FT                   InterPro IPR005510; COGs: COG1567 Uncharacterized protein
FT                   predicted to be involved in DNA repair (RAMP superfamily);
FT                   KEGG: neu:NE0120 hypothetical protein; PFAM: RAMP
FT                   superfamily; TIGRFAM: CRISPR-associated RAMP protein, Csm4
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26998"
FT                   /protein_id="ADD26998.1"
FT                   /translation="MRVRAFHLKLSSITAPPRAPTLWGHLAWWVRYTQGEEKLKEWLEA
FT                   FQHDPPFLFSSAFPTGYLPRPYLPQLQVEDTQARKALKKIRYLSLKTFARVIQEGEQAL
FT                   RDAPELKEGKAPKVTLASQTRVGINRTTGTAQEGILFTDRVYWLNDKAQQQTWTVYAQV
FT                   RQQADYLEQALREVGTFGYGGKASVGLGRFEVVDTQELELPEAENPTHYVILSPTLPQG
FT                   EGFYALETYWGRLGGHFALAETPFKRPYLRAVEGSVFKEKPKSGLLDVTPAPAPEAGVR
FT                   VWEYLYPFCLGVRI"
FT   gene            193581..194711
FT                   /locus_tag="Mrub_0219"
FT   CDS_pept        193581..194711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0219"
FT                   /product="CRISPR-associated RAMP protein, Csm5 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm5
FT                   family; SPTR: A1HM60 CRISPR-associated RAMP protein, Csm5
FT                   family; InterPro IPR010173; COGs: COG1332 Uncharacterized
FT                   protein predicted to be involved in DNA repair (RAMP
FT                   superfamily); KEGG: net:Neut_2220 CRISPR-associated RAMP
FT                   Csm5 family protein; TIGRFAM: CRISPR-associated RAMP
FT                   protein, Csm5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26999"
FT                   /protein_id="ADD26999.1"
FT                   /translation="MSFMEAYRLELELLGPVHVGTGEAFPAYSYLVDEARKEVLILDSG
FT                   RLLELLSEKQRDNYLQAVAQGPKQAQNTLRSLWGSGLLDLTPAVLRRVAASPAFINTVK
FT                   SATDAAGLEFRTLPRSPLGAYLPGSSVKGALRTAWMFQRILKRGQDIGYHDRWTWGKKP
FT                   PKDEWPLVQPPKSINTRVAQEFEALVLGYATDRGPNLHRDPFRQVRVGDGEPCKNLLLN
FT                   RIGVFHPEGKMDGTVLLAETFRSKTRLAALVRLHTGLARQTHNDTVSHAISAQALIKAC
FT                   QEYYQEVAAREKEFAEKHALAQGLKIYQELESRLNSDPQAFPLRIGFGSGRMSIRLALL
FT                   LDGEEGQEPKTRKTAGHSNPKDGFPMGWAIARLEPY"
FT   gene            194743..195009
FT                   /locus_tag="Mrub_0220"
FT   CDS_pept        194743..195009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0220"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor;
FT                   InterPro IPR011660; KEGG: rpc:RPC_1343 Rv0623-like
FT                   transcription factor; SPTR: A2VJ91 Putative uncharacterized
FT                   protein; PFAM: Rv0623-like transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27000"
FT                   /protein_id="ADD27000.1"
FT                   /translation="MALTVKNPEVERLAEEVARLTGETKTEAIRKALLERKARLLYPQR
FT                   PSKESVLEFLEREVWAKLPPESLGKAPTKAEQEEILGFGPEGY"
FT   gene            195009..195389
FT                   /locus_tag="Mrub_0221"
FT   CDS_pept        195009..195389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0221"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A3Z442
FT                   Putative uncharacterized protein; InterPro IPR002716; COGs:
FT                   COG3742 conserved hypothetical protein; KEGG: nha:Nham_4577
FT                   PilT protein-like; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27001"
FT                   /protein_id="ADD27001.1"
FT                   /translation="MVLDSSVLVQLIFAEPGHRETLEHILEAEVRVVGAPTLVEVGMVL
FT                   TSRLGPDNLYLLDELLMRLEARVVPFEASHAHQALSAFRRCGKGRHPAALNFGDCLSYA
FT                   VAKVAGMPLAYVGDDFAQTDLA"
FT   gene            195386..196174
FT                   /locus_tag="Mrub_0222"
FT   CDS_pept        195386..196174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0222"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; InterPro
FT                   IPR010156; COGs: COG5551 conserved hypothetical protein;
FT                   SPTR: A0YIK9 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2276); TIGRFAM:
FT                   CRISPR-associated protein Cas6"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27002"
FT                   /protein_id="ADD27002.1"
FT                   /translation="MILAALILPLEGPTRPDPDGWRGLVYGLLKEIDPELHAAQHNPFS
FT                   LGLGGALGQWWVRIAFLEEGLYARLSPHLFGLAGQTVRLKEAFQVRAVLQEAHPWAGVS
FT                   TYPKLFQGQATASLGLQFASPTFFRRKGHSYPLPEPRLVFESLTQRWNAFAPVKVPQEV
FT                   QEAWERLLVGQFQGRTHHIAPNQDERGVGFVGRVVYYLPKASPTEAQWLQALGRFAFYA
FT                   GVGAKTSLGFGRVRMFDPLQQERRPDESEQGALTGTVGGV"
FT   gene            196128..197594
FT                   /locus_tag="Mrub_0223"
FT   CDS_pept        196128..197594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0223"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TIGR02710
FT                   family; InterPro IPR014082; KEGG: bpt:Bpet4246 hypothetical
FT                   protein; PFAM: CRISPR-associated protein (Cas_Cas02710);
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27003"
FT                   /protein_id="ADD27003.1"
FT                   /translation="MNQNKERLRELWAEYKTLIRQESANRAGSSPQSQKAKELYDTQIW
FT                   PLTKEGFTDRGQQQYVASFHTVGTTAEPIILSVRALDAEKVYLLHTKDTEKLCGRIERE
FT                   LGWGVERIKTLLVGRSDPEDIYKQVRQKVDELPPDAAIAFDPTGGTKAMVAGLAMFAFS
FT                   LAEEGRTAHVYYVDNEEYDDELRRPVAGTEFLKRLENPREVIPDWIYHRAKDAYKRGDF
FT                   SLAKQLFDQAKDREGRAHSLEAVLSEAYESLDAAQFKQAKDRLNDLLELLQKPAHRQSF
FT                   LTRNIATIERQKEALEVVVQLTEALSAKDKSIAPLADPQQVACVLAALGFMTEKRLKTG
FT                   RIAEAVLLRYRALELFLQHRLALRGFDTEKPDFPGLCAANHTSIEDLQEKYQAERKAAK
FT                   AGSDDKLIEKNAVDFITAFFLLRALGDGPALAVNVNKVLGLTKTRNASVFAHGFTLPTE
FT                   DNAKNLSEVLVALVQSGGLPEVRFEPIPLS"
FT   gene            197591..198562
FT                   /locus_tag="Mrub_0224"
FT   CDS_pept        197591..198562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0224"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; InterPro IPR002729;
FT                   KEGG: msu:MS0981 hypothetical protein; COGs: COG1518
FT                   Uncharacterized protein predicted to be involved in DNA
FT                   repair; SPTR: A1HM55 CRISPR-associated protein Cas1; PFAM:
FT                   Protein of unknown function DUF48; TIGRFAM:
FT                   CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27004"
FT                   /protein_id="ADD27004.1"
FT                   /translation="MTLHLTEQSSTLRLSQGRLRVELDEQTLAELPARKVRGVVVWGNV
FT                   RLTTPALAFLLRQGVPVLYATLEGQLYGQAQAPQSLAPEVLRAQLLAQQNPLPLAQGFL
FT                   LGKLRSGQMLLERLARQAPITPQQAEIEAALEALPQARSLEALRGIEGNAARAYFAGLQ
FT                   AVLAPYGFSGRNRRPPTDAVNAALSYGYMVLLGRVLLALGIAGLHPELGLLHTEGRRVP
FT                   ALAFDLMEEFRVSVVDAVVIAAFLRSELTPQQHSEARNGGVYLNEAGRKALLRRLEERF
FT                   SQEAQHPKGFRKPYQELIETQAARLKAAILGREPYTPFYLWR"
FT   gene            198677..198841
FT                   /locus_tag="Mrub_0225"
FT   CDS_pept        198677..198841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0225"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; InterPro IPR003799;
FT                   KEGG: sfu:Sfum_1356 CRISPR-associated protein Cas2; SPTR:
FT                   A0YRL5 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ACR, COG1343; TIGRFAM: CRISPR-associated
FT                   protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27005"
FT                   /protein_id="ADD27005.1"
FT                   /translation="MPDERFYTIAYDIPDDGRRVKVANVLKSFGERVQLSVFECWLAPG
FT                   QLQQLKQLL"
FT   gene            199384..199626
FT                   /locus_tag="Mrub_0226"
FT   CDS_pept        199384..199626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27006"
FT                   /protein_id="ADD27006.1"
FT                   /translation="MAGLTGVSYHEIMVLPTTLEKELERFKEAYGPGWYKRLREILREE
FT                   AKRKKAALEAAELARRISATSGLTEEEVFRTLEKS"
FT   gene            199623..200042
FT                   /pseudo
FT                   /locus_tag="Mrub_0227"
FT   gene            200221..201432
FT                   /locus_tag="Mrub_0228"
FT   CDS_pept        200221..201432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0228"
FT                   /product="CRISPR-associated protein, TIGR02710 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TIGR02710
FT                   family; InterPro IPR014082; KEGG: sat:SYN_02245 putative
FT                   cytoplasmic protein; SPTR: A1HM57 Putative uncharacterized
FT                   protein; PFAM: CRISPR-associated protein (Cas_Cas02710);
FT                   TIGRFAM: CRISPR-associated protein, TIGR02710 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27007"
FT                   /protein_id="ADD27007.1"
FT                   /translation="MQEQLNTVLILGVGQTLEPLEFALTEHTPQGVIFIASQDSQVVSA
FT                   ELIQRYGEALRFHTLLLDDPEDLGEVFRKGRLALQKALEWEARAIVADITGGTKTMSAG
FT                   LVLALTGQGVTFSYVGGQARDGQGRVKSGSERLRLLEDPTYRYGLREWEGFRRAWNQCD
FT                   YQAAQAFLDALLARPLTPSEKRFYEHLKGITEGMLEWDLFYHKAAWQKLERHLEPTLTI
FT                   AEAWGHGGKVRVLQELQQAQARLRAILDREGKPTFALLADLLANAQRRASRGRHDDALA
FT                   RLYRAVELAAEADLYERHQIVLSDPKSYPQAAQHLAQQIQRATGLKDRLSLAATIDGVL
FT                   GQSQTLPQRLYAAYLGELGNLLQARHNSILAHGFTPVKQESWEKLYKSLQGLGLEAAPA
FT                   WPTW"
FT   gene            201749..202630
FT                   /locus_tag="Mrub_0229"
FT   CDS_pept        201749..202630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0229"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; SPTR: A6C0M4
FT                   Periplasmic binding protein; InterPro IPR002491; COGs:
FT                   COG0614 ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component; KEGG: rfr:Rfer_2621 periplasmic
FT                   binding protein; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27008"
FT                   /protein_id="ADD27008.1"
FT                   /translation="MKRSFWLLLLALSFALLAPGLAQPFPRTLTDDLGRSITLKAAPQR
FT                   IVALLPSVTETVCALNACGRLVGVDDYSDFPEQVKRLPKVGGLYNPNLEAILALKPDLV
FT                   IVSVYGKLHEGLERAGVASFAVKPETYDDIFRTTRLLGRVLGLEAQAERLVAQIQREVY
FT                   AVESRAAKAAQRPTVYYEIDPTPYTVGPESFIGVLITKARGQNIVPRELGLFPQISPEL
FT                   VVQKNPAVIVLTHPGAADLPKRPGWAGVAAIRNQRICTFTGQQDNLLSRPGPRVAQGLQ
FT                   LLVGCFHPELRR"
FT   gene            202639..203697
FT                   /locus_tag="Mrub_0230"
FT   CDS_pept        202639..203697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0230"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; SPTR: A8CQL2 Transport system permease protein;
FT                   InterPro IPR000522:IPR001626; COGs: COG0609 ABC-type
FT                   Fe3+-siderophore transport system permease component; KEGG:
FT                   dac:Daci_2793 transport system permease protein; PFAM:
FT                   FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27009"
FT                   /protein_id="ADD27009.1"
FT                   /translation="MHTPALTTPKRRVAAGLLPRLSAFAALLVLLGLGGLLGLWYGAVQ
FT                   IPAQEVLRALLGWQDNPIITELRLPRVLGAILVGAALGLSGAAFQGLFRNPLADPYLMG
FT                   SAAGAAFGVTLAVSLAGGLSGAFAQHAIFGFLPSSATWFGFLGAVGAVLLVLLLSGGAS
FT                   RTHDLILAGVVVGSILVGLTSYLMLQDADRVRAVFAYTLGNLAFISWQGVGSLAGYLLL
FT                   TLPVFLLLGRTLNALTLGEETARSLGLPLEGLKLLLIGVCTLLTAAAVAQAGIIGFVGL
FT                   VAPHVLRRLLGGDYRYLLPASALGGAVLLLWADLGARVLVAPAELPVGIVTTLLGGPFF
FT                   LYLLWRERRRYG"
FT   gene            203690..204490
FT                   /locus_tag="Mrub_0231"
FT   CDS_pept        203690..204490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: eca:ECA1073
FT                   iron-dicitrate transporter ATP-binding subunit; COGs:
FT                   COG1120 ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems ATPase components; SPTR: A3SLD9 Iron ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27010"
FT                   /protein_id="ADD27010.1"
FT                   /translation="MARLPHSDGVAIPRGLAAHNLGFSYRHKRVLEGLSLHLEPGEWLA
FT                   LLGPNGSGKSTLLRLLAGLVKPTEGAVYLEGRPLGSYSSWARGQAIAFLPQNGGYPEDL
FT                   TVEEVVALGRTPHLGLLGRLGKADLEALEWALTQTQVAAFRHRRLPTLSGGERQRVLLA
FT                   RALAAQPRFLLLDEPTNHLDLHHQAEFLGLLAGLRSLGLGILTVLHDPNLAARADRVAF
FT                   LLEGSLLALGHPAEVLNQPLLRRVYGPGVQVHRVKDRPVVLLEE"
FT   gene            204491..204829
FT                   /locus_tag="Mrub_0232"
FT   CDS_pept        204491..204829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27011"
FT                   /protein_id="ADD27011.1"
FT                   /translation="MQASLKVTEKLLLLDLGEVRRLMTQDGPCLARYIAVAQEARIRCV
FT                   RPARARLMRLGVAPGETLLYTLPGDPLDFEQEGANLLLPGLRLYLEGPPEFVETPLYAW
FT                   VEGGSGCG"
FT   gene            204820..205671
FT                   /locus_tag="Mrub_0233"
FT   CDS_pept        204820..205671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0233"
FT                   /product="putative periplasmic substrate-binding protein"
FT                   /note="SPTR: A4U8S8 Putative ABC transporter substrate
FT                   binding protein; COGs: COG0614 ABC-type Fe3+-hydroxamate
FT                   transport system periplasmic component; KEGG: scl:sce7441
FT                   putative periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27012"
FT                   /protein_id="ADD27012.1"
FT                   /translation="MRVASLVPAATEILRFLGVEPVGVSHCCAVADKPVLTESILPKGL
FT                   SQAEIDQRVRQAAQAGQSLYRVRTEVLQSLKPDLILTQGVCEVCAVGPSELRQAVDCLS
FT                   FGVPTLSLQGTRLAHLWDDLRAVAAATGVSAEAGIEELQGRLERVRRAVAGRKRPRVAF
FT                   VEWLEPPFLGGHWVPDLVEAAGGAPLGASPEAPSFRTTWEEIAALQPEVVLFSFCGYGL
FT                   EAALRDLAGWANPLSGVECWALDSAYFCALTPQVVQGVEILAGILHPGAWPAPAPAEAV
FT                   RR"
FT   gene            205675..206220
FT                   /locus_tag="Mrub_0234"
FT   CDS_pept        205675..206220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0234"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; SPTR: A7CF70
FT                   Phosphoglycerate mutase; InterPro IPR013078:IPR001345;
FT                   COGs: COG0406 Fructose-2 6-bisphosphatase; KEGG:
FT                   rpi:Rpic_0374 phosphoglycerate mutase; PFAM:
FT                   Phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27013"
FT                   /protein_id="ADD27013.1"
FT                   /translation="MGELWLVRHGETTWNREGRLTGWSDVPLTALGEQQARALSSWLAA
FT                   ERFERVVASDLQRAIQTARLAYGEPQEVSAALRELEFGQLEGLRWAELPEAYKAALLAF
FT                   DGFQAPGGESTAQLRRRVYGFFDRLPAGRHLVFTHGGVLRMVLRELDQDRFLPPCAVVG
FT                   LDWAHKRVLFVRAPENGG"
FT   gene            206227..206736
FT                   /locus_tag="Mrub_0235"
FT   CDS_pept        206227..206736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0235"
FT                   /product="Adenosylcobinamide-phosphateguanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PRIAM: Adenosylcobinamide-phosphate
FT                   guanylyltransferase; PFAM: cobalbumin biosynthesis protein;
FT                   InterPro IPR003203; KEGG: nar:Saro_0322 adenosylcobinamide
FT                   kinase; COGs: COG2087 Adenosyl cobinamide kinase/adenosyl
FT                   cobinamide phosphate guanylyltransferase; SPTR: A1HPW6
FT                   Adenosylcobinamide-phosphate guanylyltransferase; PFAM:
FT                   Cobinamide kinase / cobinamide phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27014"
FT                   /protein_id="ADD27014.1"
FT                   /translation="MQKHLVLITGGARAGKSRFAQAQAQALGQAQVSFIATAEPLDGEM
FT                   RQRIAKHRAERPPAWETLEAPLEVPQALQQARHGVVLLDCLTLWVSNLMLAGLEVLPAL
FT                   ERLLAVWAQSDKTLLVVTNEVGLGIVPENPLARRYRDLLGAANARVAQEAHRVYLLVAG
FT                   IPLQIK"
FT   gene            206742..207788
FT                   /locus_tag="Mrub_0236"
FT   CDS_pept        206742..207788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0236"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PRIAM:
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; InterPro IPR003200:IPR017846;
FT                   KEGG: gbm:Gbem_3813
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; COGs: COG2038 NaMN:DMB
FT                   phosphoribosyltransferase; SPTR: Q7SIC7
FT                   Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyltransferase;
FT                   TIGRFAM: nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27015"
FT                   /protein_id="ADD27015.1"
FT                   /translation="MLHFKIQPIAQEWLAQARAHQDQLTKPPGSLGYLEELGVRLAAIQ
FT                   QTLRPTLGKGAVIVCAADHGVTAEGVSAYPSEVTAQMLLNFRAGGAAINQIARAADAQV
FT                   YVLDVGINSPTPSPERVRSGTGNIAREAAMTRAEAEQAIQVGAEAARRAIAEGATILAA
FT                   GDMGIGNTTAAAALTAALLGLEARAVTGRGTGVDAARYQNKVQVVATALRRAQARLGEL
FT                   TKAGPLEVLAELGGLEIAAVAGVFLAGAEAGLPLVTDGFPVTAGALLACRINPNVRDYL
FT                   FAGHRSLEPGHSRQLEALGLRPVLELDMRLGEGTGAVLSFPILRAAASVMAGMATFAQA
FT                   GVSQTGGL"
FT   gene            207898..208131
FT                   /locus_tag="Mrub_0237"
FT   CDS_pept        207898..208131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to mitochondrial protein of bilaterial
FT                   origin like (2H598C); SPTR: A1ZF07 Putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27016"
FT                   /protein_id="ADD27016.1"
FT                   /translation="MARAELKENVDYYIENGLYVFTADYHRRRGYCCGSRCRHCPYPKE
FT                   IQAQTVQLRLEGRPIKTKEEFEARFGAVLVQP"
FT   gene            208106..208843
FT                   /locus_tag="Mrub_0238"
FT   CDS_pept        208106..208843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0238"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="PFAM: cobalamin-5-phosphate synthase CobS; SPTR:
FT                   Q9RYR9 Cobalamin synthase; InterPro IPR003805; COGs:
FT                   COG0368 Cobalamin-5-phosphate synthase; KEGG: hha:Hhal_1856
FT                   cobalamin synthase; PFAM: Cobalamin-5-phosphate synthase;
FT                   TIGRFAM: cobalamin 5'-phosphate synthase/cobalamin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27017"
FT                   /protein_id="ADD27017.1"
FT                   /translation="MGRFWYNLKVRPFWLAVGFLTTFPVPNLGEVKDGEMKAASAFYPL
FT                   AGYLIGGVLALVAWLTAALPDGLQGALLLAAWLACTGMLHLDGLLDSADALLSMKPPAE
FT                   RLRILGDVHMGSFAFGVGFVVLLLKWQLLASSPSPWLLLCLPALVRFALLLPMNLFPAA
FT                   RKEGLGVRSREGRIFPALLFALPAIYFFPWVALAVVAAMLLLASWAARRLGGGLSGDVY
FT                   GALVEIGEVAGLLVGVWWIKYEM"
FT   gene            208904..209650
FT                   /locus_tag="Mrub_0239"
FT   CDS_pept        208904..209650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27018"
FT                   /protein_id="ADD27018.1"
FT                   /translation="MLHNRKALAWLMVALLVLAGCSSTPRVVETKPNPTVVTPEIRAQI
FT                   EADPEVQTLILLAKNEGKGLDWTKATQSADSNDSLVVQVPIYISEETLELVVVTFEQNR
FT                   VTSVLLSRLSREREKELIALAFSDLKTHLVVNGTVDPSQGRPVFQKVIWGINRVGSTQT
FT                   LGDLLELQSLERDSLHYSQANCSEIIANYVAATAALVAATYALYATCNPFTFWTPACLI
FT                   AVVSYSLALSSYNYWANQMIRHGCVY"
FT   gene            209670..210002
FT                   /locus_tag="Mrub_0240"
FT   CDS_pept        209670..210002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27019"
FT                   /protein_id="ADD27019.1"
FT                   /translation="MNAVRQHTLEFFGRVAFFAGASMMAVKASVGVTSGSLSLGAWVSS
FT                   PEFLWFLFALAMGLQAIFGVNRKLIARRPELTGFVHWNYLALGVLYFLLSLFYSFFVKP
FT                   SYQILP"
FT   gene            complement(210341..211648)
FT                   /pseudo
FT                   /locus_tag="Mrub_0241"
FT   gene            complement(212118..212630)
FT                   /locus_tag="Mrub_0242"
FT   CDS_pept        complement(212118..212630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27020"
FT                   /protein_id="ADD27020.1"
FT                   /translation="MPRPYILLWGVPGAAHRELENLRAVSCGDYWWLYPPLEPDLEHLC
FT                   QQQAGFAERAAQLSEKLHCTALAVMNLEDSALLLWAYHRGRLVFQYDSNPMYLGCPVCS
FT                   YSSETVGAFVHGLDGLCRLRGLPHRQQALRAWLVRRRGLGFMSERERLEKILALLELPT
FT                   SSAYTSQ"
FT   gene            complement(212696..213985)
FT                   /locus_tag="Mrub_0243"
FT   CDS_pept        complement(212696..213985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0243"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; SPTR: Q703H8
FT                   Cytochrome b; InterPro IPR005797:IPR005798; COGs: COG1290
FT                   Cytochrome b subunit of the bc complex; KEGG: gme:Gmet_1923
FT                   cytochrome b/b6-like; PFAM: Cytochrome
FT                   b(N-terminal)/b6/petB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27021"
FT                   /protein_id="ADD27021.1"
FT                   /translation="MYQWLDDRLSIGKLYAKAFRKAFPVHHSFFLGEITLFSFVTLVLT
FT                   GIFLTLNYEPSIRPVSGSLSGGQEVPAAYYSILYIDSLPFGAVIRSLHHWAAHIMIAAA
FT                   FLHMLRIHLTGAYKNPRELNWIVGVFLLVLAIITAFTGYALPFDNYALTATKIGYEIGA
FT                   AAPWVGKLLSDILFAGELSPTNTQTIPRLFPIHVLWLPLALIALIGAHLTIMIKQKHTQ
FT                   PKYAEKVAPGKIVGVPLFPQQAAMMGILFLVYIAVTTFIAGAFLAHPVQAFGPPTANTP
FT                   AVKPDWYFMWIYGILQIIPANWRFEFLGATFGPQFWGGILVPTVIILGALAIPFLDYSK
FT                   EKQRYLELPSQHPFRTSFVVGMLMFYIMSTLAGYKVDLGLSNGLLWVLVFIVPIVTGVV
FT                   CYIIMKAIYGKDWNREPEIKLTGKGSAADD"
FT   gene            complement(213995..214639)
FT                   /locus_tag="Mrub_0244"
FT   CDS_pept        complement(213995..214639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0244"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; SPTR: A4AKN6
FT                   Rieske iron-sulphur component of ubiQ-cytB reductase;
FT                   InterPro IPR005805:IPR005806; COGs: COG0723 Rieske Fe-S
FT                   protein; KEGG: bra:BRADO3898 hypothetical protein; PFAM:
FT                   Rieske [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27022"
FT                   /protein_id="ADD27022.1"
FT                   /translation="MADHEATAHHHEHHTEDPQAHATRRAILQAAIGVSAGAAVLSTLW
FT                   VGAGLMPREEKIPSKEPVAVGDVLVFATGPKAEQEITLDDLRAAQRERIPFIIAFPKSP
FT                   ENVVKKDLITNTIMVILADPAKMSPETRQHASPEGVLAYSAVCKHLGCTVSLWQNDTWL
FT                   CPCHGGRYDIYNQAKVVGGPVPAPVPQLPVKVEGGKVVVAGEFLGKPGADV"
FT   gene            complement(214664..215155)
FT                   /locus_tag="Mrub_0245"
FT   CDS_pept        complement(214664..215155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27023"
FT                   /protein_id="ADD27023.1"
FT                   /translation="MYRNDTVVPYFALVFSAALFLMAYLNDRMRVVHEAGVVPHLTVGN
FT                   IGLMAFAMVLFIYGFIGLLSNWLEGSELRPGKHEPEPSSLPMVAGVVLSLLLVMLSGFF
FT                   VRTLVFANNPEIGYYNATTLQAGVFASMMLILALLIAIYKKYFVPEEVLAEDEKSDFPW
FT                   "
FT   gene            complement(215170..215925)
FT                   /locus_tag="Mrub_0246"
FT   CDS_pept        complement(215170..215925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0246"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; SPTR: A6GLS3 Cytochrome
FT                   c oxidase subunit 2; InterPro IPR003088:IPR009056; COGs:
FT                   COG2010 Cytochrome c mono- and diheme variants; KEGG:
FT                   cti:RALTA_A0287 cytochrome c oxidase polypeptide II
FT                   precursor (cytochrome AA3 subunit 2) transmembrane protein;
FT                   PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27024"
FT                   /protein_id="ADD27024.1"
FT                   /translation="MPIERIEVYLDGGAEPVQVLTQPPFKVTYDTRSLSDGEHLLRVVT
FT                   YYTNGAQEVKEVPFKVANTPGVLLQGLEEGKEVSGTLDVTLRVADPDVKPGRERFPGLG
FT                   AAIATAVILGGIWLFFAATGVTNKTLEEVAKPPAAAEAGAHGGDHGGAVAAVDEALKAK
FT                   GEQVYSANCAGCHQPTGKGLPGVFPALDGSKNVADKAYTINILLKGKGGMPSFARLSDE
FT                   ELAAVATYIKNSWSNKFGGVTPDEFKAAR"
FT   gene            complement(216107..216868)
FT                   /locus_tag="Mrub_0247"
FT   CDS_pept        complement(216107..216868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0247"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SPTR: B6YWM5 Putative uncharacterized protein; InterPro
FT                   IPR012307; COGs: COG1082 Sugar phosphate
FT                   isomerase/epimerase; KEGG: gbm:Gbem_3793 xylose isomerase
FT                   domain protein TIM barrel; PFAM: Xylose isomerase-like TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27025"
FT                   /protein_id="ADD27025.1"
FT                   /translation="MKLGFSPLTAGLNYRQSFELAAELGLFLEIAFDQHEMDPRLPKAR
FT                   ELAEMGRAAGVGFTVHLPFVDWNLVSLVPEVRRLSLERTQRAIEFGAQIGAACGVLHTG
FT                   LVPLRLPEAVNHAHQLAHQALEQLELAIPVALENLGLETTDLLETPSELRNLLEAHPQY
FT                   GFCLDVGHALIQRGPTGPQEYHHLLGHRLLHLHLHDNRGIQDEHLPCGEGAVDWAWVRK
FT                   LLENFGGTAALEVSGGEGGVRRSVALLRANS"
FT   gene            complement(216964..218781)
FT                   /locus_tag="Mrub_0248"
FT   CDS_pept        complement(216964..218781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27026"
FT                   /protein_id="ADD27026.1"
FT                   /translation="MKRWFAIIALFSLAWAAPALTLYDQLAPILDQVRTLQNSNPARAL
FT                   ELLAQAEDNFRKGAGELPPVLREGIQQSLADARQALARRSSADLEARIQIIKAILGKAL
FT                   YDGYFNALDKGNTEDAGRLLPKVLAASGLPNSLQAQVQTLAAANNLEGVRRLFERTYAQ
FT                   GIANALQRAQAQTSAVRAYLEATRAYALYLIVQDSPRARGLSAKAFVDALGKLSSGNLG
FT                   GFKTDVQGLLTQAQNFLRAASSPQSQRRSNPTTTTQTPPAAGGVRLEAPRTPPAPRETA
FT                   PAIAVQTRPAVQAASTPDAYQQLLGDLRFLIKDSRQLERVADSLTGAGVYSIDDWKRAL
FT                   LEVRGRLLEAQAQVENGQTDLARRTLAQVSARYRTAIAPLIEALRPELAQRTNRVLDLA
FT                   ENAVGLRTSDFTVLSGELLENALVLEGRSLGAFHSLQIWLLQTILGIPRAFLFILAGLL
FT                   AFFPLYLLKLTFGGRNVYWRLLGLAFFFLLLPAMMEGLSYIGSILSDPRYGRLPFLGVL
FT                   TNLSIQQNLVAQLFWGLTVFLVIIFATIGLRGIATQFGLLQNQRTPVQRSRSSTLAQTA
FT                   AGSAAGAAASTKPHPGLTSETIVEWDEEF"
FT   gene            complement(218794..219423)
FT                   /locus_tag="Mrub_0249"
FT   CDS_pept        complement(218794..219423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27027"
FT                   /protein_id="ADD27027.1"
FT                   /translation="MDKTAQKIIEALSQVVSPLAASSLLKRALGGQSPEALEPQRWAEL
FT                   IEGPLQREIREILPMNGLLPELKQLAQQLKTQARSPQPVAAPTLEVTDLAEYIDLQSES
FT                   ERQRLVLELARKEGVLAVVLESSYGRELRLGAYSEGLADLLSTMHRLLDRKGSYRVFYT
FT                   VFREAQLVLRPLGQGYLAVLTRNEANLGQLLYRMGKIEALQVGAEQ"
FT   gene            219557..219630
FT                   /locus_tag="Mrub_R0003"
FT   tRNA            219557..219630
FT                   /locus_tag="Mrub_R0003"
FT                   /product="tRNA-Gln"
FT   gene            219707..219781
FT                   /locus_tag="Mrub_R0004"
FT   tRNA            219707..219781
FT                   /locus_tag="Mrub_R0004"
FT                   /product="tRNA-Glu"
FT   gene            219839..220942
FT                   /locus_tag="Mrub_0250"
FT   CDS_pept        219839..220942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0250"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; InterPro
FT                   IPR011701; KEGG: scl:sce6677 major facilitator superfamily
FT                   sugar transporter; SPTR: A6ZIK5 Putative transporter; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27028"
FT                   /protein_id="ADD27028.1"
FT                   /translation="MNPVDNAQRSRLTWGSALGLFMTGAIGAAVGAAIPQWQAQFAVGP
FT                   ELAWYFNLFFVGALLGIFLGSRLRRRHPWLPLALLAEGLGLLCMALTPWMGGVFAAALL
FT                   LGLGVAVVNFHCNALPLELYPRGQLTVLYRVNTAFGVGAVLAPLLMVGLGWRVGYAVLA
FT                   LVALGAAGLLWKAPAAHPRPQAEGARNPSGLLPLALLAAVSYVGVELVVSSFSGLYLRH
FT                   LGYDPRWVGVLLSLYWVSLTLGRWLLADFVAANPLARLVGLHLGALLVVGCYFVPPLAW
FT                   VFPLVGFWVAPTFPTLYAFTEKHIGYGGLAFLFYAAAVGSNLIPAGFALLPRETLATGM
FT                   LLVVAWMAGMTYLLWRKSEAEGPALRP"
FT   gene            220911..221561
FT                   /locus_tag="Mrub_0251"
FT   CDS_pept        220911..221561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0251"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="COGs: COG0637 phosphatase/phosphohexomutase;
FT                   InterPro IPR005833:IPR005834:IPR006402:IPR006439; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   pen:PSEEN3015 hydrolase, haloacid dehalogenase-like family;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   SPTR: A0ZA01 HAD-superfamily hydrolase subfamily IA,
FT                   variant 3; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 1 with third motif having Dx(3-4)D or Dx(3-4)E;
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27029"
FT                   /protein_id="ADD27029.1"
FT                   /translation="MKLRALLFDLDGTLADTDRLHEQAWLEGLSRYGIQGDHHFYQTQI
FT                   SGGLNPEIVQRLLPQLSEAEGQRFIEQKEARFRELATTVQPLPGLRVLWNWAGERGLGR
FT                   ALVSNAPRGNALYLLERLGLVFDHIVLSEDLPAGKPDPLPYRMALQHLNLAPQEALAFE
FT                   DSPSGVRSAVGAGLPTVALTTGHPPEALAQAGAFLCIPDYTDPRLWDWLRALG"
FT   gene            complement(221637..222092)
FT                   /locus_tag="Mrub_0252"
FT   CDS_pept        complement(221637..222092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A8J328 S-isoprenylcysteine
FT                   O-methyltransferase; COGs: COG2020 Putative
FT                   protein-S-isoprenylcysteine methyltransferase; KEGG:
FT                   eba:ebD26 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27030"
FT                   /protein_id="ADD27030.1"
FT                   /translation="MRLGERGEGYVVGQFALLGLLVLALWVTPSFSPPWLGGLGRGLAW
FT                   VGLGVLLLAAWQLGRNLTALPKPRPGGYLVQQGLYRVVRHPIYCGVLLWALGSSLAHLN
FT                   LWTLLLCGLLFVWLDRKASLEETWLQERFPGYSAYRQRVKKLIPWVY"
FT   gene            complement(222149..222802)
FT                   /locus_tag="Mrub_0253"
FT   CDS_pept        complement(222149..222802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27031"
FT                   /protein_id="ADD27031.1"
FT                   /translation="MKKLLAIAFLSLGLAMAQSIAEITRQVQANMERSPWEATVTGKVQ
FT                   LPDGSTQEADFRLQVIPGKEQLARVEFKKPAALEGNFVVISDKEVWNYLFLTNQLIIQP
FT                   RAKARIEGLGFNLTDLGDFEELTQRVTLRLLGEQNTPAGPAWRIGGAPKDASLGFASME
FT                   ILVLKSDPRPLSITLRDSSNKVLADLNLTNFRRANLTPQTLRKRPADAEVLRRN"
FT   gene            complement(222799..223650)
FT                   /locus_tag="Mrub_0254"
FT   CDS_pept        complement(222799..223650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27032"
FT                   /protein_id="ADD27032.1"
FT                   /translation="MKGFHPYRRLLQLALAAVGLQLSTLGLGQSLTFGLFGRLSPDHLT
FT                   PTLEATLPLGELELRARLQRDALGLGLNGALELSALGRLSYGAGFSLGFAGWGLQAGAS
FT                   AVLGPVAASLEALYSTTPRSSLWVGDEAEGGLKLGLGGRYRLEPRQTLGLQLGFKNSLA
FT                   GIASGSGELSYALRQEQTYTFGLGVDDSRLYGLLGWRGELDEAGTLLEATLRAGQLNRL
FT                   EAALTTPLDEEQLNNLKLRLTVAYPWAATLGVEAYGFRADASYDGGFSLWLRYILEFGG
FT                   NE"
FT   gene            complement(223708..224829)
FT                   /locus_tag="Mrub_0255"
FT   CDS_pept        complement(223708..224829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0255"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; SPTR: A7M0U3 Putative
FT                   uncharacterized protein; InterPro
FT                   IPR013526:IPR013525:IPR000412; COGs: COG0842 ABC-type
FT                   multidrug transport system permease component; KEGG:
FT                   smt:Smal_1356 ABC-2 type transporter; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27033"
FT                   /protein_id="ADD27033.1"
FT                   /translation="MSRILALAQKEFTQIRRDHVLSRLIVGLPIVMTLLFGYAINFTLS
FT                   GIRLAVYDGSQDRISQYLLQELQKENRFTLTHIAQNPAEVPQAIQKNQARVGLVIPSGA
FT                   LQAVRQDKAVQLEVFVDGADPNFAFQAQAALRKVLGDVNSRLLAGKVLAGTATTPPLTP
FT                   SLHTLYNPDNKTAWFTIPGIIGLIMTIFTVLLTALSIVRENEGRTMEALMASPIKPYEV
FT                   VLGKVLPYFVIATLVSLVVLSIGHWVFGVPVRGSLLLLFGLIVLFVLGSLGVGVLISTL
FT                   ARTQIQAVFGTFAYILPTIFLSGFVFPVDGMPLLFRWLAAVIPARYLIDGTRGVMLRGA
FT                   GLETLWVDLVALVIFSVAVLGLASLRFGKRLAA"
FT   gene            complement(224826..225701)
FT                   /locus_tag="Mrub_0256"
FT   CDS_pept        complement(224826..225701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0256"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR005895; KEGG:
FT                   gur:Gura_1149 ABC transporter related; COGs: COG1131
FT                   ABC-type multidrug transport system ATPase component; SPTR:
FT                   A6CED0 ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter; TIGRFAM: heme ABC exporter, ATP-binding
FT                   protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27034"
FT                   /protein_id="ADD27034.1"
FT                   /translation="MISVTQISRRFGPLVALNNVSLEVRPGEVFGLLGPNGAGKTTLIR
FT                   ILSGVLLPSAGQAQVAGLDVTRFPEQVKAAIGYATQEASVYRDLTVRENLEFRARLYLK
FT                   AQAVPQAVETTLQRFGLQDFAHRLAGALSGGWRQRLALAQAVVHGPRVVFLDEPTTGLD
FT                   PVSRRIIWDLIHQEAARGAVVLVTTHYMDEAERCHRLALLFGGQVVAQGTPHELEQLAL
FT                   QQARVAYCETDLPLQRIRALPGVLDAWPSGRGVRLILEQQASLSLPLQTVYPNLEDVFI
FT                   ILTRRQGGAA"
FT   gene            complement(225694..226299)
FT                   /locus_tag="Mrub_0257"
FT   CDS_pept        complement(225694..226299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0257"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; InterPro IPR001647;
FT                   KEGG: bcy:Bcer98_0194 TetR family transcriptional
FT                   regulator; SPTR: A0NV45 Transcription regulator (TetR/AcrR
FT                   family) BH1965 (Imported); PFAM: Bacterial regulatory
FT                   proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27035"
FT                   /protein_id="ADD27035.1"
FT                   /translation="MYLLSSFDEADSTRTALMRAGLELLAEKGYKGTTTREIAARAGVS
FT                   EVTLFRQFGSKKALLQAAVQKLRPPVELILPRPSHGQMSASSLEDSLLHLAQGYAQMLE
FT                   ANQGLLVRLLPELARHPELRGETGPLGLQKAMSAVFEYFAELQKQGLLRADEAPSQVAV
FT                   ALLGPLFARGVLLGALALRPAFDLQAHVRGFLKGRQGD"
FT   gene            226403..226942
FT                   /locus_tag="Mrub_0258"
FT   CDS_pept        226403..226942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0258"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PRIAM: Inorganic diphosphatase; PFAM: Inorganic
FT                   pyrophosphatase; InterPro IPR008162; KEGG: hap:HAPS_1322
FT                   inorganic pyrophosphatase; COGs: COG0221 Inorganic
FT                   pyrophosphatase; SPTR: P38576 Inorganic pyrophosphatase;
FT                   PFAM: Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27036"
FT                   /protein_id="ADD27036.1"
FT                   /translation="MANLKNLPVGKKAPEIVHMVIEVPRGSSNKYEYDPDLEAVKLDRV
FT                   LPTAQFYPGDYGFIPSTLAEDGDPLDGIILSTHPLLPGVVVDVRIVGMVDMQDEKGGDA
FT                   KIIGVVAEDPRWDHIQDLSDVPTAYKQEIQNFFETYKALEAHKGKWVKVAGWKDKAGAV
FT                   AEVKACIERFQQTKGH"
FT   gene            227049..227480
FT                   /locus_tag="Mrub_0259"
FT   CDS_pept        227049..227480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0259"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A0ZMK0 Putative uncharacterized protein
FT                   (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27037"
FT                   /protein_id="ADD27037.1"
FT                   /translation="MALQQRIESLLRALGVPDLNVEVPSVADEEGFLEALEAAITSFVE
FT                   DGEDDQSPLGLIEADPSAYDLSDEPDHEELQNAVRDFMNAGDSQLTLITPESPIQPDGG
FT                   ENPSKFWVFLLQMPSLSEHRWWAIVDKNGRHDTYNYGVI"
FT   gene            complement(227516..228511)
FT                   /locus_tag="Mrub_0260"
FT   CDS_pept        complement(227516..228511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0260"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM domain protein; molybdenum cofactor
FT                   synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; InterPro
FT                   IPR010505:IPR007197:IPR006638:IPR013483; KEGG:
FT                   dal:Dalk_2755 molybdenum cofactor biosynthesis protein A;
FT                   COGs: COG2896 Molybdenum cofactor biosynthesis protein;
FT                   SPTR: A5CYZ0 Molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM superfamily; Molybdenum Cofactor
FT                   Synthesis C; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27038"
FT                   /protein_id="ADD27038.1"
FT                   /translation="MQHGVASVKLTDQYGRIIKDLRLSVTPRCNLHCLYCHPLGWEQSE
FT                   PPGTISVEDTRHFLRAMQLLGLESVRFTGGEPLVRKELPQMIAAASELGIPDIAITTNG
FT                   LLFKRKARELLSAGLKRINLSMDAVTPEVFRSMTRGGQVEKVWEAIETAWELGMHPVKI
FT                   NAVMIRGMNEQEVIPLAALSLDKPLEVRFLEYMHLDNSNPELYHARFISGAETRARIEA
FT                   HFGPLERVDHDPTAPARVYHIPGAVGTVGFINPVTEPFCSKCSRLRLTADKKIRPCLLT
FT                   DLEMDIAWAFEAENPVEALVDAILLATDRKPAFGNTLPTLRERVMVGIGG"
FT   gene            228602..229009
FT                   /locus_tag="Mrub_0261"
FT   CDS_pept        228602..229009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0261"
FT                   /product="putative thiol-disulfide oxidoreductase DCC"
FT                   /note="PFAM: putative thiol-disulphide oxidoreductase DCC;
FT                   SPTR: A1ZR04 Conserved protein YuxK; InterPro IPR007263;
FT                   COGs: COG3011 conserved hypothetical protein; KEGG:
FT                   pfl:PFL_2261 hypothetical protein; PFAM: Protein of unknown
FT                   function, DUF393"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27039"
FT                   /protein_id="ADD27039.1"
FT                   /translation="MKTVVLFDGVCNLCHRSVQFILRHDRAQRFVFASQQSEVGQQLLR
FT                   QYGVPTEAALADSLVVIEGARVWLESDAALHILYRLGGVWRIAAVLRWAPKGLRDWVYR
FT                   LIAKNRYRLFGRLERCMVPTPELKRRFLDAL"
FT   gene            229061..229891
FT                   /locus_tag="Mrub_0262"
FT   CDS_pept        229061..229891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0262"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; SPTR: A3WVN1 Patatin; InterPro
FT                   IPR002641; COGs: COG1752 esterase of the alpha-beta
FT                   hydrolase superfamily; KEGG: nmu:Nmul_A0164 patatin; PFAM:
FT                   Patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27040"
FT                   /protein_id="ADD27040.1"
FT                   /translation="MAESKRFGMALGGGGARGYAHIGVLRVLEREGFRPSVVVGTSMGS
FT                   IMAAFFAAGHSANRVQEILSQMSFWRFLDLNPLSDMLNFSELVRFLEPHLPRQIEDFPI
FT                   PLGITATDLVTGTEVYFRQGDVFQAIRASIAYPGVISPIWVGEQLLADGGILNQIPVDL
FT                   ARFLGAERVIAVDVTPLEVLREHPQKKTWWQQIFRRGTDTNPIQNVYRSVEIMQIRLAE
FT                   VKLAVSRPDLILRPSLEGIGLFSFQQLEQAIQDGEAAAEGKLEEIRQLLVMESN"
FT   gene            complement(229875..230942)
FT                   /locus_tag="Mrub_0263"
FT   CDS_pept        complement(229875..230942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0263"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase; PRIAM:
FT                   Dihydroorotate oxidase; PFAM: dihydroorotate dehydrogenase;
FT                   InterPro IPR001295:IPR005719; KEGG: acp:A2cp1_2662
FT                   dihydroorotate oxidase; COGs: COG0167 Dihydroorotate
FT                   dehydrogenase; SPTR: Q8DLB7 Dihydroorotate dehydrogenase;
FT                   PFAM: Dihydroorotate dehydrogenase; TIGRFAM: dihydroorotate
FT                   dehydrogenase, subfamily 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27041"
FT                   /protein_id="ADD27041.1"
FT                   /translation="MYELLKPWLFRQDPETIHERVMHGLAWLGQRGPSLELIRQFFSLR
FT                   DPRLEVAAFGLRFPNPIGLAAGFDKNAVAVRSWAALGFGHVEIGSVTALPQPGNPRPRL
FT                   FRLPQDQALINRMGFNNEGAEAIAQRLERLQQTFGRPPVPLGINLGKSRVTPLKEAPQD
FT                   YLQSLSRLWPYGDYFVINVSSPNTPGLRALQDKARLEELLAALTGFVQGRKPLLLKIAP
FT                   DLTWEQIDEILSLVEDYRLAGLIATNTTTARTGLQTPIDEDGGLSGRPLRGRSLEVLKY
FT                   LHAQLQGRLPIVSVGGIFSPEDVWQRLENGATLVQVYTGLVYEGPLMVKKLCKGLLQRM
FT                   EQEGVGSLAELSSTP"
FT   gene            complement(230984..232168)
FT                   /locus_tag="Mrub_0264"
FT   CDS_pept        complement(230984..232168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0264"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; SPTR: A3HXQ9
FT                   Butyryl-CoA dehydrogenase;
FT                   InterProIPR006090:IPR006092:IPR006091:IPR013107:IPR 006089;
FT                   COGs: COG1960 Acyl-CoA dehydrogenase; KEGG: acp:A2cp1_2299
FT                   acyl-CoA dehydrogenase domain protein; PFAM: Acyl-CoA
FT                   dehydrogenase, N-terminal domain; Acyl-CoA dehydrogenase,
FT                   middle domain; Acyl-CoA dehydrogenase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27042"
FT                   /protein_id="ADD27042.1"
FT                   /translation="MIADRPRDLWFELDSEERQIIGTLRDFLQAEVAPTAAERDETGAF
FT                   PFEIVKKLGEMGVMGAQVPEQYGGAGLSTRVFARIIEEIAAVDGSLALTVASHNSLCTG
FT                   HILIAGNEQQKRQFLPRLASAEVLGAWGLTEPGSGSDAAAMRTKAEDTGSSWVLNGTKQ
FT                   FITQGSVAGVYVVNARTDAAPSEEKKHLGLSALVFEAPIPGLRIGRKERKLGLNASDTA
FT                   QIIFEDITLPKEALLGERGRGFYDVMRVLEGGRIGIAAMAVGLGRAALEFATKYALERE
FT                   QFGRPIAEFQAVSHKLADMATQLEAARLLYLKAAELRDAGKPFGPAAAQAKLFASEVAV
FT                   QACDEAIQILGGYGYIKEYPVERYWRDARLTRIGEGTSEVLKVIIAKHLLAQYR"
FT   gene            232371..232748
FT                   /locus_tag="Mrub_0265"
FT   CDS_pept        232371..232748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0265"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; InterPro IPR003029; KEGG:
FT                   bsu:BSU00630 hypothetical protein; COGs: COG1098 RNA
FT                   binding protein (contains ribosomal protein S1 domain);
FT                   SPTR: A6NQP1 Putative uncharacterized protein; PFAM: S1 RNA
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27043"
FT                   /protein_id="ADD27043.1"
FT                   /translation="MELEAGAIVEGRVTRIMEFGAFVEFPNGESGLVHISQVAHEFVKN
FT                   IRDHLNEGDVVSVLVLGRDEKGRLDLSIKELTPAPVEPPRPKRLPRQAPDFENKLKSFL
FT                   RGSGGFGGGKKPGGKGGRKRR"
FT   gene            complement(232918..233712)
FT                   /locus_tag="Mrub_0266"
FT   CDS_pept        complement(232918..233712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0266"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.3.1.9"
FT                   /note="SPTR: A3JSD8 Enoyl-(Acyl carrier protein) reductase;
FT                   KEGG: rpe:RPE_4591 enoyl-(acyl carrier protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; InterPro
FT                   IPR002347:IPR002198; COGs: COG0623
FT                   Enoyl-(acyl-carrier-protein); PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27044"
FT                   /protein_id="ADD27044.1"
FT                   /translation="MVPIDLSGKKALVMGVTNEHSLGWAIAEKLYAAGAEVAFSYQGER
FT                   LREKLEKLTAGRPNQRLYQVDVTDEAALKAMFADLGQAWGGLDYLVHSIAFAPRAAMEG
FT                   RFIDTTAADWNTALQVSAYSLVAVAREAEPLLREGGSLVTLTYYASEKVVPRYNVMGIA
FT                   KAALEASVRYLAYELGKKNIRVNAISAGAIRTVAAMSIPGFRKMVAKYNATAPLGRMIT
FT                   HEEVGNLGLYLLSPLSSGTTGQTVYVDAGYSIMGMSWDDVQE"
FT   gene            233940..234167
FT                   /locus_tag="Mrub_0267"
FT   CDS_pept        233940..234167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27045"
FT                   /protein_id="ADD27045.1"
FT                   /translation="MQALQQGLVARGGIQCEWVPGTMNQVRVYLPDHQVQISLERLQQI
FT                   AGIDAVHELYLKGLVCLPCTSSLCEAFDKA"
FT   gene            234250..234771
FT                   /locus_tag="Mrub_0268"
FT   CDS_pept        234250..234771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4718 hypothetical protein; SPTR:
FT                   A3IAA1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27046"
FT                   /protein_id="ADD27046.1"
FT                   /translation="MLSRFGDADRCLRHLERSRQELLQLVEGLTDGVLLGRPGPEVWSP
FT                   AEVLEHLALVEESAGKIIRRLRKVALGEAEPFPPPPPGRTRPDGRFLAPPPMEPKGGLT
FT                   RAQLLERLEAVRQRLLLEVAESGERLPRPPTYAHPFFGELTALGWLQTLAYHERHHLQQ
FT                   LRQRLSRLAP"
FT   gene            234860..235063
FT                   /locus_tag="Mrub_0269"
FT   CDS_pept        234860..235063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0269"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pde:Pden_4705 putative transmembrane protein;
FT                   SPTR: A3JYR6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27047"
FT                   /protein_id="ADD27047.1"
FT                   /translation="MIPNVGSTDRLVRYILAAVFFLIAFFGSGGVWAWVFGLLGVVMVV
FT                   TATLNFCPIWAAFKINTRGKAS"
FT   gene            235167..237092
FT                   /locus_tag="Mrub_0270"
FT   CDS_pept        235167..237092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0270"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; SPTR:
FT                   A0YKZ5 Endonuclease/exonuclease/phosphatase; InterPro
FT                   IPR005135; COGs: COG2374 extracellular nuclease; KEGG:
FT                   azo:azo1484 putative extracellular nuclease; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27048"
FT                   /protein_id="ADD27048.1"
FT                   /translation="MEPFLRIGVSSLVLAGLFSYTHGLLSFSTSSECDLPYTPIYKIQG
FT                   SGMSAAITGDVATKGVVVGDYEGPTPALRGFYIHDPSGDGDVNTSDGIFVFNANNDSVR
FT                   LGEVVRVVGTAGEFQDQTQISAASITRCGTGTVTPTDVTLPFASATEAERYEGMLVRLP
FT                   QTLYVTEHFQLGRFGQVVLSSGGRLKQPTHATTPGAAANALQARNNLNRIILDDALQNQ
FT                   NPDPILFGRNGQPLSASNTLRGGDTATGIVGVMTYTWAGNAASGNAYRVRPMGALNGYV
FT                   NFVAANPRPATPPAVGGTLRVVGFNLLNFFNTFDGLPDTVDNCTYGLGGAPADCRGADT
FT                   PAEFDRQWPKTVAAILAMNPDVLGLNELENDGYGPDSAIAFLVNKLNEATAPGTYAFID
FT                   ADAATGQVNALGTDAIKVGLIYKPARVTPVGQTAVLNTPAFVNGGDSAPRNRASLAQAF
FT                   RQNDNGAIFIVNVNHLKSKGSPCDLPDQGDGQGNCNAVRTRAVQQLVAWLATHPTGIAD
FT                   PDILLIGDYNSYAQEDPIATLKKAGFINLLEARLGPDAYSYVFDGQWGYLDYALASASL
FT                   NAQVSGVAEYHINADEPNVLDYNTNFKTPNLQVLLYAPDQYRTSDHDPVVVGLNLRGEP
FT                   QPPARP"
FT   gene            complement(237283..237918)
FT                   /locus_tag="Mrub_0271"
FT   CDS_pept        complement(237283..237918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3344 hypothetical protein; SPTR:
FT                   A6CL78 YtxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27049"
FT                   /protein_id="ADD27049.1"
FT                   /translation="MFAITTPEEADAFIDSKPITAIFKAGTCHKTMQGWGNVEKMLRER
FT                   PEIPVGIIKVVEHRPASNRVAERTGIVHHSPQIILFRNGQPLFELNNWEITLENLEALF
FT                   QQHLPDVKVEPAQEGGRSNLEPYKRLLDAYLSGAISEQQFAWAYLNMFREDASLRSQEE
FT                   FELLNSLFGNPDEHHIHPMTILQFEQANPQATPLFERAQHLRARLDTL"
FT   gene            complement(237985..238719)
FT                   /locus_tag="Mrub_0272"
FT   CDS_pept        complement(237985..238719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0272"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; SPTR: A6CR03 Putative
FT                   uncharacterized protein; InterPro IPR003737; COGs: COG2120
FT                   conserved hypothetical protein LmbE homologs; KEGG:
FT                   aba:Acid345_2880 LmbE-like protein; PFAM: GlcNAc-PI
FT                   de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27050"
FT                   /protein_id="ADD27050.1"
FT                   /translation="MIEPMDLLVVVPHPDDEVFGAGGTLIQYADWGLETGLITLTKGEA
FT                   GRTLGLCRPEELGELRAQELQRAAQILKLGHLELYDFPNGLPNNPVDGEARGHGFSTPQ
FT                   GVADHPEIVDLLLWRLEVLRPRAIITFGPNGSNRHPDHVATHRFVVKAVEKSGQKIKLF
FT                   FYASPQPLPEYLEGWLPPNHVRHLPMEVLLQKLRAMAQHRTQALSVLNFMDRFSSRLAS
FT                   ETFHLAGYEGPIQHELLWYARP"
FT   gene            complement(238753..239889)
FT                   /locus_tag="Mrub_0273"
FT   CDS_pept        complement(238753..239889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpn:KPN_03266 translocation protein TolB
FT                   precursor; SPTR: A4BHR6 Oligogalacturonate lyase; PFAM:
FT                   WD40-like Beta Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27051"
FT                   /protein_id="ADD27051.1"
FT                   /translation="MRQFRDPRTGRLITQLTDRGNNVHLYFTENAFDLTRPEIIFRSDR
FT                   AAKQERAPHENPHYNLFRLNYLTGEITQLTDEDQPVGSVTKTPDSELIAYLTAGKVKLL
FT                   NTRTGKTTVLYEDKGDYNLYSPSISPNRRYVGFARNERVKAVNTNVNYGGFKESFYQIK
FT                   DGRITLARTDGSSWFDVHCDTHWLGHFQFAPDDPTLAMFCHEGPWNLVTQRIWLLDLAA
FT                   RQVKPIFRQDEQDSVGHEFWTQDGLIFFDNRGPGHDGTITSAKTQAVVQSPSPDNFRPY
FT                   VGLMDREGRLVRRIEMPFYCNHYHANPSNTLLVGDDADNLVLIDISGEQARLEVLCEHG
FT                   TSWHTQASHCHPTWSWDGKRILYASDRGGRVNLYLLEL"
FT   gene            complement(239945..240280)
FT                   /locus_tag="Mrub_0274"
FT   CDS_pept        complement(239945..240280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0274"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; SPTR:
FT                   A7JXZ4 Possible pectin degradation protein; KEGG:
FT                   kpn:KPN_03255 hypothetical protein; COGs: COG1917 conserved
FT                   hypothetical protein contains double-stranded beta-helix
FT                   domain; InterPro IPR013096; PFAM: Cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27052"
FT                   /protein_id="ADD27052.1"
FT                   /translation="MQLNGDWEAVEPGIERRLVALGQRMMAVRVRFAKGAAGTAHTHPH
FT                   EQLTQVLSGRFRFWLGQEAREVVAGESLLIPGGLEHGAEALEAGELLDVFSPLREDLLD
FT                   GPTAHPE"
FT   gene            complement(240290..241228)
FT                   /locus_tag="Mrub_0275"
FT   CDS_pept        complement(240290..241228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0275"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; SPTR: A8KP27 Kinase, PfkB
FT                   family; InterPro IPR011611:IPR002173; COGs: COG0524 Sugar
FT                   kinase ribokinase family; KEGG: sit:TM1040_2753 PfkB; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27053"
FT                   /protein_id="ADD27053.1"
FT                   /translation="MKTLDLVGLGECMVEFFTDEPLGQARTFTRSFGGDVLNALVAAAR
FT                   LGSATGFITLVGNDPFGPGLLQAWQAEGVDTALAPLVEGENGVYFISLLENGEREFTYR
FT                   RQGSAASRLSPEHIQPAYLAGARMLLLSGITQAISPSAQAATLRAAEQARSAGLWVAFD
FT                   PNYRPRLWALRGGLETARQALGEILPYVDLLLPSQPADLALWGLEHLEAPTALRVLLQY
FT                   VPRVGLKAGAEGAWLGWEGQIQHVPPASPHQVRDTTGAGDAWNGAFLHGLLQGWNPLEA
FT                   ALQANRLAAAKLAYRGAIPPRPWPLELSDLA"
FT   gene            complement(241225..241866)
FT                   /locus_tag="Mrub_0276"
FT   CDS_pept        complement(241225..241866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0276"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; InterPro IPR000887; KEGG: scl:sce1239
FT                   hypothetical protein; COGs: COG0800
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase; SPTR: A6CCL1
FT                   Putative uncharacterized protein; PFAM: KDPG and KHG
FT                   aldolase; TIGRFAM: Entner-Doudoroff aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27054"
FT                   /protein_id="ADD27054.1"
FT                   /translation="MSQPNFMQTLAAARVVGILRSSTSTAAVEAALAAVRAGLQVLEVT
FT                   FTTPGALEVLRTLRQQLPEHVRLGAGTVMTAEEGRAALEAGAEFLVSPHLGEDLLALAS
FT                   ETGVPYLPGVLTPSEIVRALGLGAQMVKVFPAGSSGGLAYIKDLLGPLPHLKILATGGI
FT                   RPGEVPAYLQAGVWAVGLGSNLFPKAALERGDWAAVEAAARQALAEAGVA"
FT   gene            complement(241877..242632)
FT                   /locus_tag="Mrub_0277"
FT   CDS_pept        complement(241877..242632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0277"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /EC_number="1.1.1.125"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   NAD-dependent epimerase/dehydratase;
FT                   InterProIPR002347:IPR002424:IPR002198:IPR013968:IPR
FT                   001509:IPR011286; KEGG: mmr:Mmar10_0232 2-deoxy-D-gluconate
FT                   3-dehydrogenase; COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); SPTR: P50842 2-deoxy-D-gluconate
FT                   3-dehydrogenase; PFAM: short chain dehydrogenase; TIGRFAM:
FT                   2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27055"
FT                   /protein_id="ADD27055.1"
FT                   /translation="MQMFSLEGRVALVTGGAVGIGQAIAIGLAQAGADVAIVTHTADAA
FT                   QTRQAVQAAGRRFHLVQANLMQPESAARAIAETEAALGPLDILVNNAGIIRREWAEHFS
FT                   DTDWQEVIELNLNAVWRLSQTAGQGMLKRGRGKIINIASLLSFQGGIRVPSYTAAKHAV
FT                   AGLTKALANEWAARGLNVNAIAPGYIATDNTAALRADPERSRQILERIPAGRWGQPSDL
FT                   VGAAIFLASSASDYVHGHVLVVDGGWMAR"
FT   gene            complement(242644..243441)
FT                   /locus_tag="Mrub_0278"
FT   CDS_pept        complement(242644..243441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0278"
FT                   /product="Myo-inositol catabolism IolB domain protein"
FT                   /note="PFAM: Myo-inositol catabolism IolB domain protein;
FT                   SPTR: A1HM17 Myo-inositol catabolism IolB domain protein;
FT                   InterPro IPR010669; COGs: COG3718 Uncharacterized protein
FT                   involved in inositol metabolism; KEGG: sus:Acid_1480
FT                   myo-inositol catabolism IolB domain-containing protein;
FT                   PFAM: Myo-inositol catabolism protein IolB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27056"
FT                   /protein_id="ADD27056.1"
FT                   /translation="MKYFHTIPQGSGLLPLADEACQLLAFAKLNLEAGQSYEGETGERE
FT                   ILLVALSGKAELEVGGRKFAPIGGRPSVFAGSPHSVYLPRGQRFRVRALTRFEAALPSA
FT                   PSDLETEPYEIRPEQVNTGRWGTLNFTRQFREILVEPDGRPASRLIVGETITPSGNWST
FT                   YPPHKHETAQGSEVFHEEMYYFRISSPEGWGLTRHYSPERGYDQTYVVKDETLLSIPHG
FT                   YHTYVSAPGYTGYYLWFLAGDGRRQGVRFDPDLAWVQKTVGMV"
FT   gene            complement(243494..245026)
FT                   /locus_tag="Mrub_0279"
FT   CDS_pept        complement(243494..245026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0279"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A6BY34 Putative sugar binding protein; InterPro
FT                   IPR006059; COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; KEGG: ypb:YPTS_0531 extracellular
FT                   solute-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27057"
FT                   /protein_id="ADD27057.1"
FT                   /translation="MKIGARVLCSLLLAAPGALAQANLTDLSVALYAANPEAPAPPANW
FT                   EVYRLVREKLGINLRFTMLPTGADGDNRLGALAAANDLPDLFEVRSLALFDRLVQQGQL
FT                   APVNSLLPQMPKRTAERYSDARRNLLVTTNGQIYGLQEPVTLSRQYAIWVRKDWLDKLG
FT                   LKAPTTLEEFFEVARAFTERDPDGNGRNDTFGFGGVIDFDTAGILPGLGLGNHFQWVYG
FT                   AYGVAGTWNYNPKAFAANLRDPNFRRATEYIRRLVEAKVIDPDWATMRRADLRTRWQQG
FT                   RYGMFFESVGGLQAGLQNFHANNPGAELLMLPPPKGPEGKSAMGTYSSAGWLYAVSKRA
FT                   MDAGKGPAIARFLEWAHSGEGYFLLGWGRYKTDYTLPNNVPTINTQIPISVRGSYTQMR
FT                   WLAFNGNPLEMRGRYPEINVGGRKYVMHQLMAQAQRQGNWIDRTGDLVVKAAANQADIE
FT                   RYVSENLVQFALGQRPISDASWGQFLSGLRNVRFEQYEEAAAKTLRESGYLK"
FT   gene            complement(245036..245905)
FT                   /locus_tag="Mrub_0280"
FT   CDS_pept        complement(245036..245905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0280"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A3I510 Polysaccharide ABC
FT                   transporter permease; InterPro IPR000515; COGs: COG0395
FT                   ABC-type sugar transport system permease component; KEGG:
FT                   bsu:BSU07120 transmembrane lipoprotein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27058"
FT                   /protein_id="ADD27058.1"
FT                   /translation="MKKRSLSPGDRLFEWSIDLFLVGVLVVTLVPLWYVVMISLLPFGK
FT                   SPSLFLAPWDWSFEAYAQLVFQPTIWRAALNSLVLTLGGVAISLTLTVLAAYPLSRREL
FT                   PGRNLFVGLILFTFLFNAGLIPTFLVVKDLGLLNTYWSVLLNGAVSVYNLLVMKTFFQS
FT                   LPESLEEAARIDGANDWQVLWHVVLPLSRPILLTIGLFYGVANWNNFFEPILFLSDRSL
FT                   MPLPVVLRDILTGLNVAEYVEGTAAQAAPAEALKMAAVVLITLPMLLVYPWIQRYFTKG
FT                   VLIGSVKE"
FT   gene            complement(245916..246863)
FT                   /locus_tag="Mrub_0281"
FT   CDS_pept        complement(245916..246863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0281"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: P39128 Protein lplB;
FT                   InterPro IPR000515; COGs: COG4209 ABC-type polysaccharide
FT                   transport system permease component; KEGG: bha:BH1065
FT                   hypothetical protein; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27059"
FT                   /protein_id="ADD27059.1"
FT                   /translation="MNPATAKSLAGHNGPATLVRRIWRYRLLYLMLLPGLLYFLVFRYW
FT                   PLWNAQIAFKDFQPTLGVWSSPWVGLQHFQDFFSSYYFGQLLANTLVISLAKIALGIPP
FT                   AILLAIALHETSRRFLARVVQTMSYLPHFLSWVIVYGILLAMLSPSEGLLNHGLRALGL
FT                   EPIPFLTSTATFQPVVVLSEVWKETGWSAILFLAALLSINPALYEAAAIDGASRWQQVR
FT                   HISLPGLMDVLVLVVLLKIGSILDAGFHQIFVLYSLPVYSVGDIIDTWVYRQGIQNFQF
FT                   SLATAVGLFKGLIGLVLIVVANRLARRFTGSSLY"
FT   gene            complement(246860..247888)
FT                   /locus_tag="Mrub_0282"
FT   CDS_pept        complement(246860..247888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0282"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; InterPro IPR000843:IPR001761;
FT                   KEGG: vei:Veis_0948 periplasmic binding protein/LacI
FT                   transcriptional regulator; COGs: COG1609 Transcriptional
FT                   regulators; SPTR: A7CQD4 Periplasmic binding protein/LacI
FT                   transcriptional regulator; PFAM: Bacterial regulatory
FT                   proteins, lacI family; Periplasmic binding proteins and
FT                   sugar binding domain of the LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27060"
FT                   /protein_id="ADD27060.1"
FT                   /translation="MSSEKVTLAHVARLAGVSIITVSRVLNNKGRFSEATRARVLQAAN
FT                   QLGYVANTAARSLRGHPTQILGMVIPELVSPYFAELARAAADAASQMGYDLAVFTTSRD
FT                   PERERERVGALLGGLADGLIIVVPIGSAGFLASLERSRAPVVLVNHFGAPTHLPVVRAD
FT                   SFEGSLAAVRHLLALGHRRIGFITGAAHSSQATERLRAYRECMLAAGLWDERLVRPGDF
FT                   TQQRGVEAGHELLSLEEPPTAIFAASDLTAFGVIAAAQARGLQVPQDLSVVGFDDIPTA
FT                   AHSHPSLTTVAHPIQAMGQAMVDLIIKAKAGEQVRDVLVEFPSELIVRESSAPPRIPGE
FT                   KV"
FT   gene            248066..249094
FT                   /locus_tag="Mrub_0283"
FT   CDS_pept        248066..249094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0283"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; InterPro IPR000843:IPR001761;
FT                   KEGG: hch:HCH_06913 transcriptional regulator; COGs:
FT                   COG1609 Transcriptional regulators; SPTR: A3UQH9
FT                   Transcriptional regulator; PFAM: Periplasmic binding
FT                   proteins and sugar binding domain of the LacI family;
FT                   Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27061"
FT                   /protein_id="ADD27061.1"
FT                   /translation="MREAVTLSDVAREAGVSPSTVSRVINGTARVAASKREAVLRAIER
FT                   LHYRPNIMAKGLAQGRSLTIGVITQEISSPYYAEMLKGVEQALEGTAYHPIFASGHWRV
FT                   DQEEAALKVLVGRQVDGLIVMDGSVPEERLKELAHTMPVVVVGRRIPGLQCLGIDNRRA
FT                   AYEGVQHLIELGHRRIAHIAGPTSHPDSIERLEGYRAALEDAHIPFDPALVVVGDYMEQ
FT                   SGVLAVEALLARGALFTAIFAANDQMAYGANVALYRRGIRVPHDVSLVGFDDLPSSSYF
FT                   TPPLTTVRQPGPAMGWEAARLMLALLEGRDYTPKPLSTHLVVRESTALIRSTGALAAHL
FT                   LT"
FT   gene            249189..250421
FT                   /locus_tag="Mrub_0284"
FT   CDS_pept        249189..250421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0284"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A6AMP9 ABC-type sugar transport system, periplasmic
FT                   component; InterPro IPR006059; COGs: COG1653 ABC-type sugar
FT                   transport system periplasmic component; KEGG: rfr:Rfer_1099
FT                   extracellular solute-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27062"
FT                   /protein_id="ADD27062.1"
FT                   /translation="MKQIPSLLALLVLFGLGLAQKTTLTVGVFPNLDDALKAQIQLFNK
FT                   KYPDVEVKLVIQQYADHHNALTTALATGQGLPDVAAIEIGFVGRFAEGQGFEDLNKAPY
FT                   NAGQYKRFFTPYTIAQATASDGRFIAMPVDIGPGTFFYRVDILQKAGVDPKNMMTWPGY
FT                   IAAGRKIKATTGAFLIADASDVAWINIFATTPANTSPYFDAQGKVIVDSPRFVRAFELA
FT                   KNIRAAGLDARVGAWTNEWYDAFKKGTVATQFSGAWLQGHLQNWMAPETKGLWRVQQLP
FT                   EGMYASWGGSFYAIPTTSKNKALAWELIKFVTTTKEAQVAAFRAIGAFPSLLSAQEDPS
FT                   FNEPIEFLGGQQARLLWRDAARRVKPLKANKYDRIANEILTQALSQVLDEGKDIQAALT
FT                   EAKRLIERRMR"
FT   gene            250473..251456
FT                   /locus_tag="Mrub_0285"
FT   CDS_pept        250473..251456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6CVW5 ABC-type sugar
FT                   transport system, permease component; InterPro IPR000515;
FT                   COGs: COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: hch:HCH_06909 ABC-type sugar transport
FT                   system, permease components; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27063"
FT                   /protein_id="ADD27063.1"
FT                   /translation="MRKSVRIPTSGHAGPSLAMRWSSFQRRYAPYIFVSPFFILFLIFG
FT                   LYPTLFSLYMSFQAWTPSDGWGRWKYVGLENYTFTLTDPMFWRSMWNTVWLGVFSGIPQ
FT                   HLIAIPLAFVIHMVLSRFKTFVTAVYFLPYITSSVAIALIFNTLFATNNGVINLVIAHL
FT                   NTWPLLGALLPDQNINWFTSANIKYALALVVIWQFTGWNTLLYLSAIQAIPKDLYEAAA
FT                   VDGATRVQQFRYITLPLLRPMMFFAVSLTIIGNMQLFEQPFVLLNGGASAATPGGQTAT
FT                   MYMYRTAFEWLEMGTAASIAWILFVFIGILTYLNNLIFGRAARGGD"
FT   gene            251458..252297
FT                   /locus_tag="Mrub_0286"
FT   CDS_pept        251458..252297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6CVW4 ABC-type sugar
FT                   transport system, permease component; InterPro IPR000515;
FT                   COGs: COG0395 ABC-type sugar transport system permease
FT                   component; KEGG: rfr:Rfer_1101 binding-protein-dependent
FT                   transport systems inner membrane component; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27064"
FT                   /protein_id="ADD27064.1"
FT                   /translation="MARVSPGGWLLRLGGYALLVLGGVLTIAPFYFMFVFATHQRSEIF
FT                   GFPPPIWFGEHFLTNYQILIEKIPFWRAYWNNFYLALMTTITSLFFCSLAGFGFAMYQF
FT                   RWREQLFAVVMATLLIPAILNLIPFYLLIYQIGWINTPKALWVPAMAGALGIFLMRQYI
FT                   ISAIPKELVDAARIDGCSEFQIYWRIVLPLIRPALGTLGLITFIGSWNRFADVNVIMRT
FT                   QETKTLPVVLRTLQGATDVEWGAIMAGTALLVAPLLLVFALAARQLMEGLTSGAVKS"
FT   gene            252387..253388
FT                   /locus_tag="Mrub_0287"
FT   CDS_pept        252387..253388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0287"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PRIAM: Endo-1,4-beta-xylanase; PFAM: glycoside
FT                   hydrolase family 10; SMART: glycoside hydrolase family 10;
FT                   InterPro IPR001000; KEGG: hypothetical protein; COGs:
FT                   COG3693 Beta-1 4-xylanase; SPTR: Q60041
FT                   Endo-1,4-beta-xylanase B; PFAM: Glycosyl hydrolase family
FT                   10"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27065"
FT                   /protein_id="ADD27065.1"
FT                   /translation="MYLTRWTFVGVCLGLMVWAQPGPPLRSLAEARKIQIGAAVEPSLL
FT                   LQEPQYAQVLAREFNLVVAENVMKWGALQTARGEYNFAAADLLLNFAQRNRQAVRGHTL
FT                   VWHQQLPRWMYGSFTSAEMEAILSDHIRTVVGRYRGQIAYWDVVNEAIGDDARLRSTPF
FT                   DVLPGYLEKAFRLARAADPSAKLFYNDYGAEGLGAKSDAIYALLKELRARGVPVDGVGF
FT                   QVHVDSSFSPRQVRMAENLERFAQLGLEIHITEMDVLLSSTGSRAERLERQAQVYREVL
FT                   QVCLRQPRCKVFTLWGFTDAHSWRGASEPLIFDVDYQPKPAYFALQRTLQQP"
FT   gene            253397..254731
FT                   /locus_tag="Mrub_0288"
FT   CDS_pept        253397..254731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0288"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; PRIAM:
FT                   Beta-glucosidase; PFAM: glycoside hydrolase family 1;
FT                   InterPro IPR001360:IPR017736; KEGG: mxa:MXAN_6555
FT                   beta-glucosidase; COGs: COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase; SPTR: A0AC59 Putative beta-glucosidase;
FT                   PFAM: Glycosyl hydrolase family 1; TIGRFAM:
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27066"
FT                   /protein_id="ADD27066.1"
FT                   /translation="MKRSDFPANFIWGTATSAYQIEGAVSEDGRGPSIWDTFSHTPGKT
FT                   KGGDHGDVACDHYHRYPEDIALMKELGVNAYRFSVAWPRILPEGRGRVNPRGLDFYNRL
FT                   VDALLEQGITPWATLYHWDLPQSLEDQGGWPSRETAYAFAEYADLVTRHLGDRVKHWIT
FT                   LNEPWCSAYLGYHAGIHAPGQQNFKHSIWASHHLLLAHGLAVPVIRRNVTGARVGITLN
FT                   LSPGYPASPDPADVAAARRFDGFQNRWYLDPLYGLGYPADMLALYGEAPSVQGDDLITI
FT                   AAPTDFLGINYYSRAVVRNSDLEPYRFQYVRVGEEHTDMDWEVYPEGLYDLLIRLGREY
FT                   RPKAIYITENGAAYPDAVADDGGIHDLERVRYFQRHLALCLEALQHGAPLKGYFAWSLL
FT                   DNFEWAEGYAKRFGLVYVDFPSQRRRIKASGYWFRDFLREAVASS"
FT   gene            254728..256326
FT                   /locus_tag="Mrub_0289"
FT   CDS_pept        254728..256326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0289"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="PRIAM: Xylan 1,4-beta-xylosidase; PFAM: glycoside
FT                   hydrolase family 43; InterPro IPR006710; KEGG: bha:BH3683
FT                   xylan beta-1,4-xylosidase; COGs: COG3507 Beta-xylosidase;
FT                   SPTR: P07129 Beta-xylosidase; PFAM: Glycosyl hydrolases
FT                   family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27067"
FT                   /protein_id="ADD27067.1"
FT                   /translation="MTRILNPILRGFHPDPSILRVGDDYFIATSTFEWWPGVRLHHSRD
FT                   LVHWRPIGYALTRTSQLEMLGNPDSGGIWAPCLSHDGAQFYLIYTDVKTWGNGEVFKDA
FT                   HNYLVTAPSIEGPWSEPVYLNSSGFDPSLFHDEDGRKWLLNMRWDHRKGRNAFAGILLQ
FT                   EYDPQQKRLVGPVHNIFRGTPLGVTEGPHLYKKDGWYYLVVAEGGTTYAHAVTVARSQR
FT                   IEGPYEVDPCYPTLTARGHPELPLQKAGHASLVQTQQGEWYMAHLVGRPLEPPQALRRH
FT                   CPLGRETALQKIRWSPDGWPRLWHGSNTPALEVEAPALPAHPWPKEPERDDFEAPTLSL
FT                   HFQTLRHPPDPSWLSLTERPSYLRLFGRESLSSRHRQSLVARRLQHFYAEAETVLEFEP
FT                   QHFQQMAGLVCYYDTGNWVYLRVSRDEALGKTLSILTCDNGHYDEPLDGELGIEGWSRV
FT                   YLKVRYQRDTFGFAYSANGLDWSEIPLRFPAYKLSDDHCRGLGFTGTFIGLCAQDLSGA
FT                   RLHADFDYFVYRGLE"
FT   gene            256488..257964
FT                   /locus_tag="Mrub_R0005"
FT   rRNA            256488..257964
FT                   /locus_tag="Mrub_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            258143..259438
FT                   /locus_tag="Mrub_0290"
FT   CDS_pept        258143..259438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0290"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; SPTR: Q5V5P9 Cytochrome P450;
FT                   InterPro IPR001128:IPR002401:IPR002403; COGs: COG2124
FT                   Cytochrome P450; KEGG: bha:BH0579 cytochrome P450
FT                   hydroxylase; PFAM: Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27068"
FT                   /protein_id="ADD27068.1"
FT                   /translation="MILDPTELELRQDPLAFFVHLSRTSPDITTFRFASGKEIVFLNHP
FT                   DLIREVLIERAEQFHKSDLTRSFAGGMGNGILLSEGEFWKQQIRLMRPAFHYKRLQGYA
FT                   EVMSRFTLEMLSHWQNSEIRHIDEDMNALTLRVVAKCMFDVEAGEDREIMHQAIMLGQK
FT                   VVGQMVYGWLNLPDWHPGLNRDGIRVVRALNDMVSRHIAYRRERGDLGDDLLSMLLEAQ
FT                   NQPGVELSDRQLRDEVLTVITAGLETTANALIWTWYLLDQHPDVKARLKAEVDSLGKLP
FT                   GFEDVQRLPYLDQVFKESLRLYPPVWIIGRENVEELELGGMRLAPRTQIVMSQWAAHRD
FT                   PRFFEHPDEFRPERWTPEFERSLPRGAYFPFSLGPRVCTGQGFATLEYKLIVATVLQQF
FT                   DLELVRPAPVRPEPNFTLCAHGGMPMRVRRWK"
FT   gene            complement(259641..260627)
FT                   /locus_tag="Mrub_0291"
FT   CDS_pept        complement(259641..260627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0291"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002126; KEGG: hypothetical protein
FT                   LOC752473"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27069"
FT                   /protein_id="ADD27069.1"
FT                   /translation="MHKHLRALAGLALLGLLAACSNPSSSSDQLSQSDAQALSEAVQGD
FT                   LQLTGAMLGDASTAALGAQGQVDGLEAAAQAWGLPRRGSLILRAVGVLYLPPTSSANCS
FT                   ISTNPATPVDADNDGVPASATTTYDCTYTGPGNTSYSLKGSVTLQDTNDNQPYSGYSVA
FT                   FDRFTTRLTSGNTSIERTLNGSYSIDKQDATLFKITKNYTHAVTKTVFNNTYTGSLVFD
FT                   VSKTYAPDQDGNSNPWDAGSITVEQNNPGSATWTRNNNTRSLIWYTDPSLHWNRAACQN
FT                   PLGRLMNFDSGAKVFVYTNPAGERSTLRIEFSGCGQFTVTLNGQPVE"
FT   gene            260776..261384
FT                   /locus_tag="Mrub_0292"
FT   CDS_pept        260776..261384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce2901 hypothetical protein; SPTR: Q5UZL3
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27070"
FT                   /protein_id="ADD27070.1"
FT                   /translation="MATQSKKKRKAAAKYRSQPKPSPMPWVLGGVVVLAVLVGGYFWWQ
FT                   SRQTAQAFERLVAAGKASLAAREITYPDAGRGHSNIGVSIVYATDPPTSGVHWPNWTEP
FT                   GFYTRPEPKEKLVHALEHGNIVIYYDQPSAEALSQIRAWQRRFTGAWDGLVVVPKQGLG
FT                   QTIELTAWTKLLRLETWDAALAAAFIDAYRGRGPENPVR"
FT   gene            261403..262368
FT                   /locus_tag="Mrub_0293"
FT   CDS_pept        261403..262368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0293"
FT                   /product="Dipeptidylaminopeptidase/acylaminoacyl-peptidase"
FT                   /note="SPTR: A5P745 Prolyl oligopeptidase family protein;
FT                   InterPro IPR002471; COGs: COG1506 Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase; KEGG: mxa:MXAN_5299
FT                   peptidase, S9C (acylaminoacyl-peptidase) subfamily; PFAM:
FT                   Dienelactone hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27071"
FT                   /protein_id="ADD27071.1"
FT                   /translation="MSHTLRFGTTLLAVLLGTALAQGGLEAHPMSIEALRQGSYPGSAI
FT                   TLEQTLAPGANYRRYIASYRSEGLKIYGLLTVPNGARPRAGWPAIVFVHGYIPPAQYRT
FT                   TERYGAYVDALARAGYIVFKIDLRGHGNSEGTASGAYWSPDYTIDTLNAFASLRRFPQA
FT                   NPERIGIWGHSMGGYLALRAMVVEPRIRVGVIWAGVVGTYEDLLYRWRRSPPAQLPPGA
FT                   LRRRELFLARYGSPESNPGFWASITAHNYLERVGPIQLHHGLADTVVPVSFSQRLAQYL
FT                   RAAGRPYELFTYPGNDHNLSQSFSLAMRRSVAYFDRYLKR"
FT   gene            262701..262898
FT                   /locus_tag="Mrub_0294"
FT   CDS_pept        262701..262898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0294"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   InterPro IPR006121; KEGG: xcv:XCV2336 copper-translocating
FT                   P-type ATPase; SPTR: A3EPE8 Putative cation transport
FT                   ATPase; PFAM: Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27072"
FT                   /protein_id="ADD27072.1"
FT                   /translation="MTQLKIEGMSCNNCVRHVTEALKKVPGVEHVEVSLQEGRATVTGT
FT                   APVDKLIEAVQEEGYTARVA"
FT   gene            262900..263184
FT                   /locus_tag="Mrub_0295"
FT   CDS_pept        262900..263184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0295"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; SPTR:
FT                   A4KFR7 Putative uncharacterized protein; InterPro
FT                   IPR003735; COGs: COG1937 conserved hypothetical protein;
FT                   KEGG: aeh:Mlg_0324 hypothetical protein; PFAM:
FT                   Uncharacterised BCR, COG1937"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27073"
FT                   /protein_id="ADD27073.1"
FT                   /translation="MTHEHTLHLDPRVRQEARNRLLSAKGHLEGILKMLEGEPYCVDVL
FT                   KQIKAVQGALDKVGEMVLRSHLEHHVASAAVRGDTQRMVEELMEVLKYR"
FT   gene            263214..265694
FT                   /locus_tag="Mrub_0296"
FT   CDS_pept        263214..265694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0296"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase;
FT                   InterProIPR000579:IPR001757:IPR006121:IPR008250:IPR
FT                   005834:IPR006403:IPR006416; KEGG: pca:Pcar_1596
FT                   copper-translocating P-type ATPase; COGs: COG2217 Cation
FT                   transport ATPase; SPTR: P58341 Copper-transporting ATPase
FT                   1; PFAM: Heavy-metal-associated domain; E1-E2 ATPase;
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM: ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC; heavy
FT                   metal translocating P-type ATPase; copper-(or
FT                   silver)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27074"
FT                   /protein_id="ADD27074.1"
FT                   /translation="MTCAACVNRVERGLGKLEGVALASVNLATERARVVYDPEKTTPQA
FT                   LLEKVREAGYTPEVAEVELGITGMTCAACVNRVEQALQQLDGVLEARVNLATERALVRY
FT                   LPASTGVAQFKRAIRAAGYGVLELGRGQERADLEREARARELASLRRALLVAAVFALPL
FT                   FLIAMLPMLFPPVEAWLMGTFGHGVMSALNWVMLALATPIQFGPGLRFYRHGWRSLRSG
FT                   SPDMNGLVMIGTSAAYFYSLGVVLFPGLFPPQARHAYFEAAGVVITLILLGKYLEAIAK
FT                   GRTSEAMRRLLSLQAKTARIVQDGLEREIPVDEVLVGDLVQVRPGEKIPVDGVVVAGQS
FT                   YVDESMITGEPLPVYKTEGAPVVGGTLNQNGTLTFRATAVGEGTVLAQIIRLVENAQAS
FT                   KPAIQNLADRVVAVFVPIVLAIAALTAGVWLVLGGENALTYALVNTVAVLIIACPCAMG
FT                   LATPVSIMVGTGKAAELGVLFRRGEALQTLQEARVIALDKTGTLTQGRPELTDLEVLEG
FT                   FDEAEVLRLVASVEQKSEHPLARAIVRAARSRGLELAEPEDFEAFPGFGVRGRVGLYRV
FT                   EVGADRYMAQLGLEVHTLAALAQKLAEAGKSPLYAAINGKLAAILAVADPLKPGSAEAV
FT                   AALHRLGLRVAMITGDHTRTAQAIARQLGLDEVLAEVLPHGKAEAVRTLQAKGHKVAFV
FT                   GDGINDAPALAQADVGIAIGTGTDVAIETADVILISGDLRGVPNALALSRATLRNIQLN
FT                   LFWAFAYNVLLIPVAAGALYPLTGWLLSPVLAGAAMGLSSLFVLSNALRLRAFRPPFGP
FT                   GEQTTMGKLVREMG"
FT   gene            265780..266013
FT                   /locus_tag="Mrub_0297"
FT   CDS_pept        265780..266013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_0211 hypothetical protein; SPTR:
FT                   A2UAL1 Putative uncharacterized protein; PFAM: Predicted
FT                   membrane protein (DUF2078)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27075"
FT                   /protein_id="ADD27075.1"
FT                   /translation="MMHWWPYGYGMMGGWGWLGMLIQLAILVLLIYLLVRAFSRPASSE
FT                   GRDRALEILRERYARGEIDKETFERMKHDLNG"
FT   gene            266025..266654
FT                   /locus_tag="Mrub_0298"
FT   CDS_pept        266025..266654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_0396 carboxynorspermidine
FT                   decarboxylase; SPTR: Q46BC2 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27076"
FT                   /protein_id="ADD27076.1"
FT                   /translation="MRREMLWVGITGLVLVGVVLTQGLWGYGGPMHGYGYGPGMMGGGM
FT                   GMMSVYPAQAQPIPPAEARARLESFAKRFGSEARLKDFMSFSENYYAQVVDAKGNGLVE
FT                   ILADRYTGSVYLEPGPNMMWNTRWGMGMMQVQPSVAVRYDKAAAQKLAEQFLKGYLPGA
FT                   RVMEGQAFSGYYTFDFGRKEIEGMMSVSAYTGEVWIHTWHGVFLGE"
FT   gene            266698..266943
FT                   /locus_tag="Mrub_0299"
FT   CDS_pept        266698..266943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27077"
FT                   /protein_id="ADD27077.1"
FT                   /translation="MAITEASLGQYVASLKASKGLVRDCEAFLERCRKYQTPSLAGFPM
FT                   VGLGGSCGKPAFLLPFVVRFDLPKVLALEAWFRRTK"
FT   gene            266953..267144
FT                   /locus_tag="Mrub_0300"
FT   CDS_pept        266953..267144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27078"
FT                   /protein_id="ADD27078.1"
FT                   /translation="MAERFGMYVEYGAYPHLKLPVDTEIAAVQDWTNATLVFLRPSYES
FT                   KEELIAAIPVLVICKPQG"
FT   gene            267211..269631
FT                   /locus_tag="Mrub_0301"
FT   CDS_pept        267211..269631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0301"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase;
FT                   InterProIPR000579:IPR001757:IPR001756:IPR008250:IPR
FT                   005834:IPR001412:IPR006121:IPR006403:IPR006416; KEGG:
FT                   xau:Xaut_4847 copper-translocating P-type ATPase; COGs:
FT                   COG2217 Cation transport ATPase; SPTR: A3TK31 Putative
FT                   cation-transporting ATPase; PFAM: E1-E2 ATPase; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; ATPase,
FT                   P-type (transporting), HAD superfamily, subfamily IC;
FT                   copper-(or silver)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27079"
FT                   /protein_id="ADD27079.1"
FT                   /translation="MSKADHDPHLPEALLELSLKNCHDASEQADLERHLARLPGVSSVH
FT                   LDRTRALAHISFDPGQISAQDLRERLERGGYSCACQECEASVCQPGHPRVGSDDQPHTH
FT                   PHHHPAHEVVTEPHAHRTAPTKAHDHAAMPPVHDAHAGHGAAMVADMLRRFVVSLLLTL
FT                   PIVIFSPIGGSLGFPEMPPFGISMGLWGFLLSTPVVWWGGWPFIRAAWRALRRGEANMM
FT                   TLIATGILVSWTFSVAATFLFEGEVFYEAAAMLTTFSLAGHWMEMRSRFATGRAVEALL
FT                   KLAPATARVLRGGQEVEIPLEQVVVGDVIVVKPGDRVPVDGVVLSGQSYVDESMISGEP
FT                   IPVAKAPGSKVIGGSVNQTGAFTFEATAVGADTALSRIVQMVQNAQASKAPAQRLADIA
FT                   GKYLVFIALGSGLLTFVFWYFFAAQGLVFALTAGVSAIVIACPDALALATPTAITVGVG
FT                   VAAREGVLFKNATALEATAGVDTVIFDKTGTLTEGKPALTDLITAGGMAEQELLRLAAS
FT                   ADLPSQHPLAEAIVRAAREQGLTLNQPEEFDSVPGHGVVAKVHGQRVLIGNKKLMEREK
FT                   VAVEALEERAAQLSADGKTAMFVAVDGRAAGVVAVADAVRESAKRAVGLLHALGIETVM
FT                   LTGDNRRTAEAVARQIGIDTVIAEVLPEDKAAKVKELQAQGRKVAMVGDGVNDAPALAQ
FT                   ADVGIAIGAGTDVAVESAEVVLVKNDPADVAKAIQLARKVRGKIKQNLFWAAIYNVLAI
FT                   PIAAGVLYNSYGLLLRPEWAALLMSASTVIVTLNALLLGVRSRPRELTKGVGA"
FT   gene            269680..270345
FT                   /locus_tag="Mrub_0302"
FT   CDS_pept        269680..270345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0302"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG: bha:BH3157
FT                   two-component response regulator involved in phosphate
FT                   regulation; COGs: COG0745 Response regulators consisting of
FT                   a CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; SPTR: A2U9W5 Two component transcriptional
FT                   regulator, winged helix family; PFAM: Transcriptional
FT                   regulatory protein, C terminal; Response regulator receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27080"
FT                   /protein_id="ADD27080.1"
FT                   /translation="MARVLLVDDDPAIREVLGVYLRQEGCEVLEATNGLEALQLLPQAD
FT                   VVILDLMLPQLTGWQVAQELRRDYPDLPLLMLTARGEEAERIQGLELGADDYVTKPFSP
FT                   REVVARVRALLRRSGFKQELVFGDLILRPRQREALFKGQALNLSKLEFDLLLTLAQHPG
FT                   LVWSRERLLERVWGSDFPGVDRVVDVHVAGLRKKLGEDAENPLYIETVRGVGYRFRGE"
FT   gene            270342..271424
FT                   /locus_tag="Mrub_0303"
FT   CDS_pept        270342..271424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0303"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PRIAM: Histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein;
FT                   InterProIPR004358:IPR003594:IPR003660:IPR003661:IPR 005467;
FT                   KEGG: gme:Gmet_2694 PAS/PAC sensor signal transduction
FT                   histidine kinase; COGs: COG5002 Signal transduction
FT                   histidine kinase; SPTR: A0YKL7 Sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   HAMP domain; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27081"
FT                   /protein_id="ADD27081.1"
FT                   /translation="MMFVRLFITHWLVALVALVALLAFAEWLAPRFYRSHLEQMMTLMG
FT                   SQSLELRSDLERGLRSTLTTAWLASLPLAGLLAGLMAWLASRRISQSVRQLAQGSRAIA
FT                   LGQYQNRLKVQGDDELASLAQDFNRMTEALEKVEQHRTELLSSVAHELRTPLSALQGYS
FT                   EALADGVLPPEQAAAHIEREVRAMGRLIDDLALVSRIEAQAVELHPQVVAVEAAFQEAL
FT                   ERYATAFEACGVALKLNPLPSSVALWADPLRLQQVLSNLLSNALRYTPAGGEVVLSASL
FT                   QSHHVRICVCDTGVGIPLEHQPRIFERFYRADPARSRHTGGSGVGLTIAKGLVEAMGGQ
FT                   MGFESEVGKGSCFWFTLPRA"
FT   gene            271513..273012
FT                   /locus_tag="Mrub_0304"
FT   CDS_pept        271513..273012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0304"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 1; multicopper oxidase type 2; SPTR: A0YQP5
FT                   Laccase;
FT                   InterProIPR001117:IPR011707:IPR011706:IPR002355:IPR 006311;
FT                   COGs: COG2132 Putative multicopper oxidase; KEGG:
FT                   multicopper oxidase type 2; PFAM: Multicopper oxidase;
FT                   Multicopper oxidase; Multicopper oxidase; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27082"
FT                   /protein_id="ADD27082.1"
FT                   /translation="MKLTRRNTIKLLGAGLGSALVGAHWPGLAQGTLAFPEPKLLPLRR
FT                   LESGLVEASLAARESNLSIGGKPVTLLTYGGMPGPTLRLREGETVRLQFTNHLTQVTNL
FT                   HLHGLHVSPEVDDPLAQIQPGQSRMYEFTVPKGSAGTYWYHPHIHGRVAEQLYAGLLGL
FT                   IVVEGPVDAIPELREAEEHVLVLKDFAFSGSRIAPFTPMDWMNGKEGDLLTVNAVIRPT
FT                   LRAQRGTLRLRILNASNARYYRLALENHPLYLIATDGGFVEKPVELRELLLAPGERAEV
FT                   LIRLTQAGSFRLQALPYDRGAMMMHGGGMGMMNHQGMGGMSHGGEQSTLAMQGMMMGMG
FT                   PSRLETLLTIVAPPNPKPLPLPTSLATVERLDLTKVAATRRFELGERMMQAEFFINGRM
FT                   FDPGRVDVRARRGTLEVWELINKTDMDHPFHLHTYPFQVLSINGRPQPYRAWKDTVNLK
FT                   KNDVVRIAIPFRDFIGTTVYHCHIVEHEDRGMMGVLQVEAE"
FT   gene            273047..273625
FT                   /locus_tag="Mrub_0305"
FT   CDS_pept        273047..273625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0305"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; SPTR:
FT                   A0ZFH3 Putative uncharacterized protein; InterPro
FT                   IPR005183; COGs: COG3544 conserved hypothetical protein;
FT                   KEGG: scl:sce8098 hypothetical protein; PFAM: Domain of
FT                   unknown function (DUF305)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27083"
FT                   /protein_id="ADD27083.1"
FT                   /translation="MMRRLWMVFVLLGLSFAQMDHTGHGGMTMQATAELQKLQGRDFDI
FT                   AYMSMMIDHHKGAVEMAQAILKVSKDARIRKAAQEIIAVQNKEITQLTGWLRSWYGVAP
FT                   SQRYMAMMRADMQAMMDTAMMGMMPGHGSSPDRAFLQGMIPHHQDAVDMSRLCLQKAAR
FT                   AELKRFCQGVITVQSREIEQYRQWLKNLP"
FT   gene            complement(273636..274088)
FT                   /locus_tag="Mrub_0306"
FT   CDS_pept        complement(273636..274088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0306"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; SPTR: A3YUQ9 Protein tyrosine phosphatase; PFAM:
FT                   Protein-tyrosine phosphatase, low molecular weight; COGs:
FT                   COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR000106:IPR017867; KEGG: mes:Meso_3348 protein tyrosine
FT                   phosphatase; PFAM: Low molecular weight phosphotyrosine
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27084"
FT                   /protein_id="ADD27084.1"
FT                   /translation="MTRVLFVCMGNICRSPMAEGIFRRKLRERGLEGQFEVDSCGTGGW
FT                   HAGEPADPRTQAVLSKYDAHFPHVARQVRAEDLLYFDHIFVMDRENLRTLERMFPAHRG
FT                   KARLLLDLNGGGEVPDPYYGGPQDFEAVYQMLDGALEAFFQKHTAT"
FT   gene            complement(274085..275662)
FT                   /locus_tag="Mrub_0307"
FT   CDS_pept        complement(274085..275662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0307"
FT                   /product="alpha amylase catalytic region"
FT                   /EC_number="3.2.1.20"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; InterPro IPR006047:IPR006589;
FT                   KEGG: mrd:Mrad2831_1595 alpha amylase catalytic region;
FT                   COGs: COG0366 Glycosidase; SPTR: A3K7L1 Alpha amylase;
FT                   PFAM: Alpha amylase, C-terminal all-beta domain; Alpha
FT                   amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27085"
FT                   /protein_id="ADD27085.1"
FT                   /translation="MEWWKTASIYQIYPRSFQDSNGDGIGDLPGIRKRLPYIRDLGFDA
FT                   IWLSPFYRSPMKDFGYDVADYCDVDPIFGTLKDFDELLAEAHRLGLKVLIDFVPNHTSD
FT                   QHPWFLESRSSRDNPKRDWYVWRDPAPDGGPPNNWQAHFGGPSWTLDEKTGQYYLHQFL
FT                   PEQPDLNWRNPEVRQAMYDVMRFWLDKGVDGFRVDVIWLLVEDALFRDEPDNPQYKPGD
FT                   IDRFRHIHIYQEDQPETREIVQEMRAVLDEYPGNRVMIGEIYLPYHQLIPYYGTPERPG
FT                   CHLPFNFHLISRGLNNWTAENIRSIVEEYEASLPPFATPNWVLGNHDQHRLATRIGHEQ
FT                   ARIAAMLLFTLRGSPTWYYGDEIGMVNGEIPPEKVQDPAALRQRGAAGEHGRDPERTPM
FT                   QWTPHAYAGFSTREPWLPINPDYPERNVEAQDADPFSMLTLVRTLLVVRKETPALLHGA
FT                   YQSYKAPQGVFAYLRGGEVLVALNFTQKPQALSTPGGEILLSTHLDRYGKVEGVLELRP
FT                   HEGLIVKL"
FT   gene            complement(275674..277584)
FT                   /locus_tag="Mrub_0308"
FT   CDS_pept        complement(275674..277584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0308"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; InterPro IPR006047:IPR006589;
FT                   KEGG: noc:Noc_0218 alpha amylase, catalytic region; COGs:
FT                   COG0366 Glycosidase; SPTR: A6CFW1 Alpha-amylase,
FT                   amylosucrase; PFAM: Alpha amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27086"
FT                   /protein_id="ADD27086.1"
FT                   /translation="MDEALFFAGMAGQMGAPDAYRTADLQARVRRHFPDLMAGLQAVYP
FT                   QAPAVAGRAAQVIGRNLAERPAELLALDLERIHTPDWFQQPHMHGYIAYADRFAGTLKG
FT                   VGQHIGYLKELGIRYLHLMPLLLPREGENDGGYAVADYRQVRPDLGSMEDLEALCTQLR
FT                   HEGISLCLDLVLNHVAREHPWAQAARRGDPRYRAYFYIYPDRTLPDAFERTLPEVFPDF
FT                   APGNFTWDEELQGWVWTTFNRWQWDVNWSNPEVFLEYLDLILWLANKGVEVFRLDAIAF
FT                   TWKRLGTHCQNQPEVHALTQALRAAVRIAAPAVAFKAEAIVAPEDLIAYLGSGKHYGKV
FT                   SELAYHNTLMVQIWSSLASRDTRLFTQALRRFPQKPPSTAWATYLRCHDDIGWAISDTD
FT                   AAAVGLSGPAHRRFLSDFYRGEFPGSFARGLHFQENPATGDRRTSGSAASLAGLEAALE
FT                   SGNPRLINLAIERILLAHAVFIGYGEGIPLIYMGDELGMLNDYDYAQEPAHQDDNRWLH
FT                   RPRMDWAKAQKRHQEGTVEHRIFHGIKGLLQARARIPQMHAAFPTQALWQPNPHLLLLR
FT                   REHPQGRLVQVYNFSEQDQPFPFEALQQEGIVQPFDQITQAPAPAYLGPYARLWLTQRP
FT                   V"
FT   gene            277806..279386
FT                   /locus_tag="Mrub_0309"
FT   CDS_pept        277806..279386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27087"
FT                   /protein_id="ADD27087.1"
FT                   /translation="MRRTKMLLLLGGLGLLLGACGGEYTDNPTPDSSNGPFLAEPLTQH
FT                   PTNLPLTLLNRYLVVSEEDGRLRASYSGLRYWPRQADKNRNPNNPSQPSGPRFTQYAGW
FT                   DILDVPGSSVSRADWLRLSLTRPATVVVAWEHSALWLAGWQKGETTAADGKKFNTYTRT
FT                   FRAGEITLGSPEGKGEYWVLLAEGNGQPSAEPPLPSGITERPVPNTTCPSWLENLWQAK
FT                   GPDGRNYPSWHPQIDPVYWCYYRHDHNADPGLIGYQAPFLYTAQYTNNQPERAEGFKGF
FT                   AIRDGEIGWYFNIHSETSTDQRVCARFHTVVVVATRWRTGEKLAELNYKGDFGASRQNQ
FT                   GDNPFFANTCTDPRTGQQVTQEQIGQQLQSTTRASKRIRIAANNSGYEQWDGGLVKALG
FT                   MEFSGPGMGIDIQNPATACNALHCTDLVTNNSSSTRRTLQIMNLRLRYKPELDPDGDGY
FT                   FETNLYGDGPYIAGDRNSGIGPLKQYIKPGTDLRLDGFFTTEDAWRGLYVRGGSTQDVE
FT                   LEGALGTVN"
FT   gene            complement(279551..279991)
FT                   /locus_tag="Mrub_0310"
FT   CDS_pept        complement(279551..279991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_0591 outer membrane protein,
FT                   OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27088"
FT                   /protein_id="ADD27088.1"
FT                   /translation="MLMRPAYLALLLPPLLAACGGQSVFRPPNTPPPPAPGESFSLAAD
FT                   PFTLSRGGTATLTVRVTFNASNLTRVFLRYQSNTGGLEVTPVEQNAVRGSANTQSATFT
FT                   VTDRGVDPMEKRPFFYIYGIACTSNGCSGQSQRSITIQWSMP"
FT   gene            280108..280581
FT                   /locus_tag="Mrub_0311"
FT   CDS_pept        280108..280581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27089"
FT                   /protein_id="ADD27089.1"
FT                   /translation="MGKQIAVFFLLCLGWTALAQSARPFAGASLVFQWVEGTSLTSLML
FT                   QAGSYNLGGGLGARASVGIGLSPSFLELGADLLFPFGTGRLLPYGGLGGNWVGLGALNF
FT                   FGIRGLAGVSYSTASDTGLFAEAVPTLYLASDATGIYGTAFGIQLRFGVNYLF"
FT   gene            280656..281204
FT                   /locus_tag="Mrub_0312"
FT   CDS_pept        280656..281204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0312"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; InterPro IPR001647;
FT                   KEGG: smt:Smal_0425 transcriptional regulator, TetR family;
FT                   SPTR: A3X7M9 Transcriptional regulator, TetR family
FT                   protein; PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27090"
FT                   /protein_id="ADD27090.1"
FT                   /translation="MDTRQALLQSARKAFAERGYAATSLEDLARTLGLTKAAVYHHFAS
FT                   KRELLEALLQEGFAETQRALAQPGTLHQRLMALALAYRGQVEPLTALMTAYSSRRGGDL
FT                   EAVKLAREAMQRGIEQLAGLLEQVAPGHGRALAVIFASIVHGAYMTAQHMPGYSAEALL
FT                   QEGVALFVRGLPDKAGEST"
FT   gene            281237..281887
FT                   /locus_tag="Mrub_0313"
FT   CDS_pept        281237..281887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0313"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867; KEGG:
FT                   tmz:Tmz1t_2388 heavy metal response regulator; COGs:
FT                   COG0745 Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain;
FT                   SPTR: Q1B3X8 Response regulator mprA; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27091"
FT                   /protein_id="ADD27091.1"
FT                   /translation="MARVLLIEDDAGVREALRLGLELEGYTVLEAANGAEGLRRLAENP
FT                   ELVVLDVLLPGGDGFGVLREIRRQSAVPVLMLTALDEVEWRVKGLREGADDYLVKPYAL
FT                   SELVARLEALLRRSKRPEEVLSYADVVLYPGRMEARRGGRLLELSPKALQLLQCFLEHA
FT                   ERLLPKETLMQRVWGQEVEPNTLEVHLSALRRELGEPMLLHTLRGHGYILKRP"
FT   gene            281884..283161
FT                   /locus_tag="Mrub_0314"
FT   CDS_pept        281884..283161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0314"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   InterProIPR004358:IPR003594:IPR003660:IPR003661:IPR 005467;
FT                   KEGG: mpt:Mpe_A3149 sensor histidine kinase; COGs: COG0642
FT                   Signal transduction histidine kinase; SPTR: B8AD13 Putative
FT                   uncharacterized protein; PFAM: HAMP domain; His Kinase A
FT                   (phosphoacceptor) domain; Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27092"
FT                   /protein_id="ADD27092.1"
FT                   /translation="MTLRLRLLLWLLLALVLLLFPLGALTVQQAQRTVQEALERAVLAR
FT                   LGFLVSQGIVRVQDLAQVVQEFGGVGFILGPEGRITFTDLGDYRLPEGLEQALRAGRGF
FT                   RQVRDNWLWVALPGEEGGLGLGTPLEEVAALPQRLLQLYLGLGGVLALLAFSVGAWGLT
FT                   RSLRPLETLSRELARRNAENLEPLPPPGLPEVRPAVEAMNALMGELEAALHRSRVQEQA
FT                   ARRFAYGASHELRNPLAALKGYLEVLQRRPGEPRATEGALREAARMESLLQGLLTLARL
FT                   EGQGRVRGQPLSLNAFLQQRGLRVEGDGWVEADPDLLALIVENLVQNATKHGGGVEKVE
FT                   LEPDAGGLWLWVCDRGPGFPPELQPRAFEPFVKSDQSDGVGLGLALVAAVARVMGAQVR
FT                   AENRPEGGARVGFWWPEARGRDKPVR"
FT   gene            complement(283181..283597)
FT                   /locus_tag="Mrub_0315"
FT   CDS_pept        complement(283181..283597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0315"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; InterPro
FT                   IPR002716; KEGG: gur:Gura_3493 PilT domain-containing
FT                   protein; SPTR: A7CWY2 PilT protein domain protein; PFAM:
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27093"
FT                   /protein_id="ADD27093.1"
FT                   /translation="MSSEPAPLCVLDANVLLRFITKTPLEQALRARDLLASGQQGAVRL
FT                   VLEALTLADVVYVLKKLYQMEYTEIEAALLRLFASGAVEVVERQRCESALALQVQHNID
FT                   FEDTYLAVMAQELGGRVASFDQDFKKLGVGWLQP"
FT   gene            complement(283594..283848)
FT                   /locus_tag="Mrub_0316"
FT   CDS_pept        complement(283594..283848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0316"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; InterPro
FT                   IPR007159:IPR006339; KEGG: regulators of
FT                   stationary/sporulation gene expression protein; SPTR:
FT                   O28268 Putative uncharacterized protein; PFAM: SpoVT / AbrB
FT                   like domain; TIGRFAM: looped-hinge helix DNA binding
FT                   domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27094"
FT                   /protein_id="ADD27094.1"
FT                   /translation="MIYRTTLAARGQLTLPKEIREKFGIKEGDQINFEVTGDTIRLKVV
FT                   PRMRIEELFEQLPGATVPYPGPAKEREVMRARHARKEQR"
FT   gene            283903..285438
FT                   /locus_tag="Mrub_0317"
FT   CDS_pept        283903..285438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0317"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /EC_number="1.1.99.1"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; SPTR: A1ZS14 Choline dehydrogenase;
FT                   InterPro IPR000172:IPR007867; COGs: COG2303 Choline
FT                   dehydrogenase and related flavoprotein; KEGG: pla:Plav_2644
FT                   choline dehydrogenase; PFAM: GMC oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27095"
FT                   /protein_id="ADD27095.1"
FT                   /translation="MRKEYDYVIVGAGAAGCVLANRLSARPDRTVLVLEAGEPMQGLYC
FT                   KAPAAFPKLFKGPYDWAFFTEPQAELEGRSLYWPRGKGLGGSSGINAMIVIRGNPRDYD
FT                   DWQQPGWSFAEVLPYFKKLETHPLGPSPYHGDRGPLHVEVRKYTNPLTEAFLEAAQQWG
FT                   LKRNDDFNGPEQEGVGLFHVNQKNGARHSAAAAYLTPALPRPNLDAQTGARAHRILFEG
FT                   ATAVGVEYRHQGQRWQVRARRAVIVSSGAVQSPQLLMLSGIGPADHLKALGIEVRQDLP
FT                   VGQNLWDHLALPVIWHSTRPVSLDKAENLANILRYLLAQRGPFVSNIAEAGAFLRTQPQ
FT                   AKAPDLQFHFGPAFFSNHGFDREEGFFFTIGPTLVAPQSRGFIALRSADPEAAPLIQPR
FT                   YLSEPHDLEVLQAGVLIAREIAAQKAFDPYRGQPHARQAAEIQAYIRRYAQTLYHPAGT
FT                   CSMGQVVDADLKVYGTENLYVVDASVMPGVVRGNTHIPTLMLAEKAADGLLSL"
FT   gene            285610..287397
FT                   /locus_tag="Mrub_0318"
FT   CDS_pept        285610..287397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0318"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor G domain protein; GTP-binding protein
FT                   HSR1-related; elongation factor Tu domain 2 protein;
FT                   InterProIPR000795:IPR000640:IPR002917:IPR004161:IPR
FT                   006298:IPR005225; KEGG: psa:PST_0355 GTP-binding protein
FT                   TypA; COGs: COG1217 membrane GTPase involved in stress
FT                   response; SPTR: A1HPG5 GTP-binding protein TypA; PFAM:
FT                   Elongation factor Tu GTP binding domain; Elongation factor
FT                   G C-terminus; Elongation factor Tu domain 2; TIGRFAM:
FT                   GTP-binding protein TypA/BipA; small GTP-binding protein
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27096"
FT                   /protein_id="ADD27096.1"
FT                   /translation="MELRNIAIIAHVDHGKTTLVDAMLKQAKALSRHEAEGERIMDSND
FT                   LERERGITILAKNTAVEWGGVKINIVDTPGHADFGGEVERALSMVDGVLLLVDAAEGPM
FT                   PQTRFVLKKAIEAGLKPIVVINKVDKKDARPDEVLNETFDLMAELGASDEQLDFPYLYA
FT                   IGREGAAWLGDQPKPDLTDLFETILKHIPAPQVAQGPFQLRVANLDYSNFLGKIALGKV
FT                   HRGTVRKNQFVTIVGEHGNRDLKVVAVFTHRGLERLEVDEATPGDIVAIAGMEGVEIGD
FT                   TIAAREAPEALPRLAVDEPTVSITVTPNTSPFAGREGKYVTSRQIRERLLKELETNVAL
FT                   RVIEVTPDTFELHGRGELHLSVLLETMRREGFEFSVGQPSVLFKEIEGQIQEPYEYLVV
FT                   DVPEAKFGPVMEALGSRKAQMVHMEQESGRIRAEFTVPARALFGFRTMFLTLTAGEGVM
FT                   SHSFHAYGPHVGSLETRTTGSAVAMEAGVAYAYSLYRLQERVNFFIEPGTEVYVGMIVG
FT                   EHVRDNDLNVNVNINKKLTNVRAAGSDENIRLIPPRKFTLEEALEFLAPDELLEVTPQS
FT                   LRLRKRVLDPSQRKRAETV"
FT   gene            287571..288392
FT                   /locus_tag="Mrub_0319"
FT   CDS_pept        287571..288392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0319"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SPTR: A0NN65 Putative uncharacterized protein; InterPro
FT                   IPR012307; COGs: COG1082 Sugar phosphate
FT                   isomerase/epimerase; KEGG: hypothetical protein; PFAM:
FT                   Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27097"
FT                   /protein_id="ADD27097.1"
FT                   /translation="MKPPLPVLGLALPIERLLEFRPWLLEHGGRDLELQDAVRPEVLDG
FT                   DWQPLVARARQALDGYTGRLGIHGPYDGLWMASFDPFVRRMIAERYRRALEFAADLGAS
FT                   HMVIHSPFLFFGHPQMAHTPGNGLEREIEWVHDTLQTVLPLARNLGLVLVIENIRDTNP
FT                   QPLRTLVQSFGSEQVRMSLDVGHAHLMQQLGGPAPDQWVKEAGPLLAHLHLQDNDGLLD
FT                   RHWSPGQGGVNWRALFAALQTLPSQPRLILEVRHEQLPVAAQWLVAQGLAC"
FT   gene            288469..289401
FT                   /locus_tag="Mrub_0320"
FT   CDS_pept        288469..289401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0320"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A8RW83 Putative
FT                   uncharacterized protein; InterPro IPR000515; COGs: COG1175
FT                   ABC-type sugar transport systems permease components; KEGG:
FT                   bha:BH1077 glycerol-3-phosphate ABC transporter (permease);
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27098"
FT                   /protein_id="ADD27098.1"
FT                   /translation="MINAKNSEQNLQNSIPMRRIGRLGEGLEVALLLVPGLLLLLVFTV
FT                   WPTLNAFWLSFHRENLLGTERDWVGLANYAEMLRDPAFWRAVGATFLFAAIVVPVQLLL
FT                   GLLAALMVARPFPGVALFRTLFFLTTAVPTAVAAVAWGWYLHPIGGTVNRWLEAVGLPA
FT                   QPWLTSPELALPTLAIVTAWAGVGFTAILLTAGLQQIPEDLYEAARIDGAGAWRQFWHI
FT                   TLPMLSPTLFLVALLTVLTSLTAFGQIHLLTRGGPMESTTVWIYRIYQDAFFNFRFSYA
FT                   AAQSVALFLVLLLLAALQFRGLGRRVHYE"
FT   gene            289394..290218
FT                   /locus_tag="Mrub_0321"
FT   CDS_pept        289394..290218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0321"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A8RW82 Putative
FT                   uncharacterized protein; InterPro IPR000515:IPR001647;
FT                   COGs: COG0395 ABC-type sugar transport system permease
FT                   component; KEGG: mca:MCA1924 sugar ABC transporter,
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27099"
FT                   /protein_id="ADD27099.1"
FT                   /translation="MSSLPRWLARPLFYLLLGVYAWLLVLPLLSLLSASFRTEADLFTP
FT                   GLLPPQPTLEAYREALAKHPILRYLLNSLGVSLAITLGVLLTSATLGYALARVRFAGQS
FT                   LLFGFVVGLLLIPDEVTFLPRYLLVQELGWINSYWALIVPFLASPLGIFLMRQFLKSLP
FT                   QDLFDAARIDGAGHLRTLWYVALPLAAPALGALGALSFLGAWNMYLWPLVVINQNEMKT
FT                   AQIAIAQVQSVEVSSWNVVAAAAVLVLLPTLLAFLLAQRAFIRGIALGGLKG"
FT   gene            290234..291541
FT                   /locus_tag="Mrub_0322"
FT   CDS_pept        290234..291541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0322"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A8RW81 Putative uncharacterized protein; InterPro
FT                   IPR006059; COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; KEGG: bha:BH1079
FT                   glycerol-3-phosphate ABC transporter (glycerol-3-phosphate
FT                   binding protein); PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27100"
FT                   /protein_id="ADD27100.1"
FT                   /translation="MLRRWLILAGIALGGLGLAQQRITIDFWHSMGGVLGEATEALVKD
FT                   FNAAQNRVTVRSQFVGSYDDGLNKLRAALQAGGQGRPNVIQVYDIGARFMADSGAVLPL
FT                   EDLARANNFDLSQFVPQPRNYYTVDGKLYGLAFNSSNPILYFNAQALEQAGIPYRNTWS
FT                   LADLEAAARKLTIKDASGKTTRYGLSIPIDSWFMEQFSYNSGQYFCNNENGRKARATEV
FT                   TFNNPAAVAFLDTWARLVREGVAANTGRNWADSQSLFAQGNAAIAVYSTASLTGVLRQV
FT                   GNRFPVRTAFYPYLRERNGTAIGGAAVYLIRGFNDEQNAASWEFIRFLLRPETQAKWTI
FT                   ATGYFPVVKGVTELPSVRQAYVRQPNYTTAVRQLETSKVNTASAGCLMGGFTEIRQIVQ
FT                   SAIEEALRGKPAQQALDEAKQRADQVLARYNASVRP"
FT   gene            291664..292524
FT                   /locus_tag="Mrub_0323"
FT   CDS_pept        291664..292524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0323"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; InterPro IPR004810:IPR002912:IPR002376;
FT                   KEGG: abo:ABO_1563 formyltetrahydrofolate deformylase;
FT                   COGs: COG0788 Formyltetrahydrofolate hydrolase; SPTR:
FT                   O34990 Formyltetrahydrofolate deformylase; PFAM: ACT
FT                   domain; Formyl transferase; TIGRFAM: formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27101"
FT                   /protein_id="ADD27101.1"
FT                   /translation="MQSDTTARLLITCPDRPGIVAAVSNFLFNHGANITALDQHSTDPE
FT                   GGLFFMRLEFQTPHLDVSREILEKAFAERVAARFEMNWRIAYAADLKKVAILVSKYDHA
FT                   LLELLWRHSNRELPCTITQVISNHPDLRPEVERFGIPYHHVPVEKDRKEEAEAQILHLL
FT                   GDTDLVVLARYMQILTPQFVARYPHRIINIHHSFLPAFVGANPYKQAYMRGVKIIGATA
FT                   HYVTEELDQGPIIEQDVARVSHRHDVADLVRLGRDLERNVLARAVQWHLEDRIIVYGNK
FT                   TVVFS"
FT   gene            292583..293824
FT                   /locus_tag="Mrub_0324"
FT   CDS_pept        292583..293824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0324"
FT                   /product="HtrA2 peptidase"
FT                   /EC_number="3.4.21.108"
FT                   /note="PRIAM: HtrA2 peptidase; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; SPTR: A4BPL1 Periplasmic
FT                   serine protease; KEGG: hha:Hhal_0718 peptidase S1 and S6,
FT                   chymotrypsin/Hap; COGs: COG0265 Trypsin-like serine
FT                   protease typically periplasmic contain C-terminal PDZ
FT                   domain; InterPro IPR001940:IPR001254:IPR001478; PFAM: PDZ
FT                   domain (Also known as DHR or GLGF); Trypsin"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27102"
FT                   /protein_id="ADD27102.1"
FT                   /translation="MSMRNSSILLGLLMMVGGGVLWFNLSKSQTEASPTPPTQVQAQSF
FT                   DQNRAFLENERNTIDVVQRTGDGVVFVAVRATPRVSSDFGFFAPFLQPQPQEGTGSGFV
FT                   LDQDGLILTNYHVIEGADQITVRFHNDPKSYPARVIGRAEPLDIALIRVQAPREKLKPM
FT                   PLADSDQVRVGQKAIAMGNPFGLEFTVTEGIVSAIRRNPNDGSSGGQGAFVPTVIQTDA
FT                   AINPGNSGGPLLNSRGEVIGINTFIYSSAGALGAAQSAGIGFAIPINLVKQYLADLKAG
FT                   KDITAEDIVRSRPRLGVTLSLLSMAEYPENIRRQNRLPDTGLMIQQVERGSPAERAGLR
FT                   AATRTVQLQLRTGQVIELGVNGDILLEADGNPISNINDLRAVLLSKKPGEAVTLKIWRD
FT                   GQTREVRVVPQVIR"
FT   gene            293902..296607
FT                   /locus_tag="Mrub_0325"
FT   CDS_pept        293902..296607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0325"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; SPTR:
FT                   A6G459 WD40-like Beta Propeller protein; InterPro
FT                   IPR011659; COGs: COG0823 Periplasmic component of the Tol
FT                   biopolymer transport system; KEGG: gbm:Gbem_2492 peptidase
FT                   S9B dipeptidylpeptidase IV domain protein; PFAM: Dipeptidyl
FT                   peptidase IV (DPP IV) N-terminal region; WD40-like Beta
FT                   Propeller Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27103"
FT                   /protein_id="ADD27103.1"
FT                   /translation="MLRFLAVALLIGSLALAQFDPTQRWFTVRTEHFDIHYHSGLERVA
FT                   TEAAIYAEKAYALLLEDFEAPPGRISIVLSDVGDTLNGFANPVNNLVGIFTGQFRSSDL
FT                   FNPRLSSWWETVIFHEIAHIFDLSQVRGPLKEPTRIFGQLPAQSAVKPFPFVEGTVLYL
FT                   KHKKLGESRLNDATTRMMLRQMVLSGRFPSLDEIRQAYSRSTWPYLGFLVYNYSAWLVQ
FT                   YLEVRFGEDAYRRFTEANAGMLAFKDFNEPFLKAFGVSLDQIYADFVRWLPSQFEGEIA
FT                   RIRAEGLTPVQKLSSLGFFSEGPADSANGLVYAHASPLRSGLRIIVNENERELLNGPAQ
FT                   HPQWSPDGRYLLFTTSSATSPYFVASDLYQYDRLEGRVQRLTQGERVYYARYAPDGKSI
FT                   FLAKNTPDGSTELARYFIEFNRTQPLRSFPHQDGVIHSFAVAPDGRSLVLALLRRGGFQ
FT                   DLYRYTLETGALAPLTQDRNVDSDPVFSPDGRYVIYSSDVNRVYNLYAYRLEDGAVFQV
FT                   TNLLTGAFQPTFSHSQQQIIFSGYDETGYNLYQLPYNPSAWKRVELPREPLPAFKPAEA
FT                   ASGEPYNPFHYLRPLYWLPIAGVGVEGFGLGVSFAASDPVGLHAYAVGAGFDSSLRGVF
FT                   YDLAYQYTGLGFPLVLQAVGAGRDSAQGVGASFWSPQGSLGLQYVRLDVLEPALDPSQN
FT                   TVTHAFSLRLNGASTSASDLFRSSSSLSAVGTAFVREGSPDWRYRVQGALGFQFRLPLE
FT                   ASHLIGLRVGGGFTTSPLALDGFDLGAWPLVAGGQPLLAVRGYGPGQLRGQQALVGSLE
FT                   YRLPPWSLERGLGNWPLFFDDLSLSVFLDAGAAGSPLDLSQVRFSLGAELRLGLTLFYL
FT                   APGSSVALGGAQGFGEPGPRFYLSLVLPGL"
FT   gene            296653..297855
FT                   /locus_tag="Mrub_0326"
FT   CDS_pept        296653..297855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0326"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="TIGRFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; PFAM: adenylosuccinate
FT                   synthetase; InterPro IPR001114; SPTR: Q5SLS1
FT                   Adenylosuccinate synthetase; KEGG: Os03g0174500;
FT                   hypothetical protein ; K01939 adenylosuccinate synthase;
FT                   COGs: COG0104 Adenylosuccinate synthase; SMART:
FT                   adenylosuccinate synthetase; PFAM: Adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27104"
FT                   /protein_id="ADD27104.1"
FT                   /translation="MPGIAIIGAQWGDEGKGKVTDALAEDADFVVRYQGGANAGHTVVA
FT                   QGKTFKLNLLPTGVIHPQATNVLGDGMVIDAYRFAEEMQNIRAEGLNPRVLVSDKAHLV
FT                   LPHHKTVEARNNFVGTTKRGIGPAYSDRARRVGIRAGDLLNEAVLRERVETLLTEKPNS
FT                   TREAGWDTPEKALADLYRMREILAPHITDTGRLLREAIQQGKKVLFEGAQATLLDLNYG
FT                   DYPYVTSSHPTVGGIIVGAGVNHKAINKVYGVAKAYATRVGNGPFPTELFGEEDEYLRQ
FT                   KGGEFGVTTGRARRTGWLDLVLLKYACEVNGFDGLVLTKLDVLSGFPVVKVGVEHRPDG
FT                   SVKYAEIPGWGDLTGIQSREELPASLKQFIELVEDFTQTPVVMFSTSPRREDTFGAVSW
FT                   V"
FT   gene            complement(297852..298334)
FT                   /locus_tag="Mrub_0327"
FT   CDS_pept        complement(297852..298334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0327"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   SPTR: A2W0X5 Putative uncharacterized protein; InterPro
FT                   IPR007214; COGs: COG2606 conserved hypothetical protein;
FT                   KEGG: gbm:Gbem_1948 YbaK/prolyl-tRNA synthetase associated
FT                   region; PFAM: YbaK / prolyl-tRNA synthetases associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27105"
FT                   /protein_id="ADD27105.1"
FT                   /translation="MKLSPSALKVQAALNQRGFAHLQVQELSASTRTAQEAAAAVGCAV
FT                   GQIVKSLVFRGAESARPYLLLVSGANRVDVARLEALLGEKLEKPDADYVRQVTGFAIGG
FT                   VPPVGHAQALEALVDPDLLQYERIYAAAGTPFALFGLSPEELLALTGGRVVALKSD"
FT   gene            complement(298331..299449)
FT                   /locus_tag="Mrub_0328"
FT   CDS_pept        complement(298331..299449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0328"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; SPTR: A4AV67 Carboxypeptidase G2; InterPro
FT                   IPR011650:IPR002933; COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; KEGG: aba:Acid345_0237 peptidase M20;
FT                   PFAM: Peptidase family M20/M25/M40"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27106"
FT                   /protein_id="ADD27106.1"
FT                   /translation="MKPIEYLQPQLPAILQDLEAIVTLEAPSHDLPGLAKVADWIAAQF
FT                   GPLGSLEREETPNGPLLRVRIPGAGKKVLVLCHFDTVHPVGAFATPWKIEGDRAYGPGI
FT                   YDMKGNIVQLLWALRANRALGLGLPTLELLFTPDEEVGSAASRAAIEAGALRNDLVLVL
FT                   EAPMGNGDLKVARKGVGQYRLTAHGKPAHQGVEPEKGVNAIVELAHQISRIVALQDWEQ
FT                   GTTLGPNVIKGGTTSNVVAATAWVEIDLRVWTMAEAERIEKALKALEPLLPGATLSVEG
FT                   GLNRPPMEPSPASLELFEMARRIGAELGLHLGAGRVGGGSDGNFTAALGVPTLDGLGLF
FT                   GEAAHQLSENVYIPQIPTRIALLSGILHELSQ"
FT   gene            299506..301347
FT                   /locus_tag="Mrub_0329"
FT   CDS_pept        299506..301347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0329"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; PRIAM:
FT                   Arginine--tRNA ligase; PFAM: DALR anticodon binding domain
FT                   protein; arginyl tRNA synthetase domain protein;
FT                   Arginyl-tRNA synthetase, class Ic, core;
FT                   InterProIPR015945:IPR005148:IPR008909:IPR001412:IPR 001278;
FT                   KEGG: sus:Acid_5890 arginyl-tRNA synthetase; COGs: COG0018
FT                   Arginyl-tRNA synthetase; SPTR: Q72GE2 Arginyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (R); DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27107"
FT                   /protein_id="ADD27107.1"
FT                   /translation="MLASRPEIKSQLKAAIAQALEALGLQEWPEIVVQETPPDKEGDYG
FT                   TPVAMSLARTLRKAPPQIAADLLQNIQLPAWVRRTFVLGGYLNFELDPAFLVKSATLPV
FT                   APFPKVAGKVLLEHTSVNPNKELHVGHLRNICLGDSLARILRFVGRDVEVMNYIDDTGR
FT                   QAAESLYALQYFGLKEAPAQTKYDHWVGEAYVRLHQAMEDPEQKARIEQGVQSTLHRLE
FT                   AGELRDAVDKILRAQLQTMYRLGAEYNALVWESDIVREGLLGKAMKILEGSPYVSRPTE
FT                   GKYAGALVMDTSAFIPGLEDPYLVLIRSNGTSTYTAKDIALQFWKMGLLEGLRFVTYDT
FT                   QPSGAPLYSTHPEGVPLPFGGASETINVVDARQSHALRVVQASLEVEGRPDLAEKCFHL
FT                   AYETVLLEGRQMSGRKGIVVSVDEVMDEAVKRVRAVIAEKNPDHPSPAEAAEQIGVGAV
FT                   RFAMLKTEAKKQIDFRYDQALSFEGDTGPYIQYAYARAGSILRKAEEQGVIQEAPDFTQ
FT                   ATPYEVALAKTLLRFPEAVQDAARNKAPHIVAQYLLELAAAWSSFYNAKTPDGRPATPV
FT                   LSAPPELRGVRLELVKALRQTLKQGLGLLGLEAPEVM"
FT   gene            301886..302494
FT                   /locus_tag="Mrub_0330"
FT   CDS_pept        301886..302494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0330"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="KEGG: ank:AnaeK_0326 transcriptional regulator, SARP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27108"
FT                   /protein_id="ADD27108.1"
FT                   /translation="MNKSGGPIQLKLWGPARLEYQGRELKLQRKGLAILYYLALEGATR
FT                   REVLADLLWGHSAASQNLRVELHRLGQALAPLGYTLFKAGEDPLQLPPFVTLDRTPAPG
FT                   APMEGLEEISVEFRAWLEGQRSQLMANSSGTVGRERLVQEVASQIVLPSVLILTGRPGS
FT                   GRTAFAQALAKALGMPFLEGPRGGGKALHYLRPPTPMSR"
FT   gene            302527..303726
FT                   /locus_tag="Mrub_0331"
FT   CDS_pept        302527..303726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1406 transcriptional activator
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27109"
FT                   /protein_id="ADD27109.1"
FT                   /translation="MVERSSYGEDPRLILELRSHYPAERTRYITLPPLSWAEARASMLS
FT                   NLPFAQAARLFLASGGSPGHLRELLAVPHNGTEMPLPQRVRAQVQLESRMLSLEARLAL
FT                   ERLSVHPGPYSQGLLDALEATPYLDELERRGWLIYAGQWQFSDDASRRVLYLGLQPGRR
FT                   QQYHRQAALQCAMEEQRMAEAYHRLMAGDTADWGTFVNTLPGWTRYGLKAWLGMHENLP
FT                   MGPSTGEAARGSELALLEEARFGQGFEVEGRHVRWMRTPSMSSASGIIWAAHDEPSLLH
FT                   LKGNAYVENPLGVGISGRAAPLMLEIQEPREARIIFLPGIQAGALADNALLLPLQEELD
FT                   VWFRVPAGASIRLTSSAESGLIDLEVTSYRVAPPPLAQSAPRVEVFEFFRSAVEAARKS
FT                   "
FT   gene            complement(303780..304040)
FT                   /locus_tag="Mrub_0332"
FT   CDS_pept        complement(303780..304040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0332"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; glutaredoxin 2; SPTR: A4KL94
FT                   Hypothetical glutaredoxin protein; InterPro
FT                   IPR006662:IPR002109:IPR008554; COGs: COG0695 Glutaredoxin
FT                   and related protein; KEGG: aba:Acid345_2784 glutaredoxin;
FT                   PFAM: Glutaredoxin; TIGRFAM: Glutaredoxin-like protein,
FT                   YruB-family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27110"
FT                   /protein_id="ADD27110.1"
FT                   /translation="MITMYTTSWCPDCHAAKQALTSLGLPFQEVNIEHDPTAAELVMKV
FT                   NNGKRSVPTLVYKEHATSLSRFSISKLKAWMEQVGLQAGQP"
FT   gene            304181..304987
FT                   /locus_tag="Mrub_0333"
FT   CDS_pept        304181..304987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0333"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PRIAM:
FT                   DNA-formamidopyrimidine glycosylase; PFAM: DNA
FT                   glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; zinc finger Fpg domain protein;
FT                   InterProIPR012319:IPR010663:IPR015886:IPR000214:IPR 000191;
FT                   KEGG: tcx:Tcr_1921 formamidopyrimidine-DNA glycosylase;
FT                   COGs: COG0266 Formamidopyrimidine-DNA glycosylase; SPTR:
FT                   O50606 Formamidopyrimidine-DNA glycosylase; PFAM: Zinc
FT                   finger found in FPG and IleRS; Formamidopyrimidine-DNA
FT                   glycosylase N-terminal domain; Formamidopyrimidine-DNA
FT                   glycosylase H2TH domain; TIGRFAM: formamidopyrimidine-DNA
FT                   glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27111"
FT                   /protein_id="ADD27111.1"
FT                   /translation="MPELPEVETTRRILEPYLLGQRIQQLLHQDPARYRNTERAEGRRV
FT                   LGTSRRGKYLIIHLDENLELIVHLGMTGGFRFEPHRHTRVTLHLPHQTLYYTDPRRFGK
FT                   WWVVEAGDYREIDLLCRMGPEPLSDDFTLAHFQQALRTPRKIKEVLLAQEAVAGVGNIY
FT                   ADESLWLSQIHPERPAASLSSPEVRRLYKAIRVVMERAVEAGGSTLSDASYRQPDGQPG
FT                   YFQFQHNAYDRTGQPCKRKGCTGRIAKIVVGGRGTHFCPQCQQNSR"
FT   gene            complement(304992..305324)
FT                   /locus_tag="Mrub_0334"
FT   CDS_pept        complement(304992..305324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27112"
FT                   /protein_id="ADD27112.1"
FT                   /translation="MSWLVVFLALFVLIALFGLVNYWGYRRVEQAQQAWFRQMLGEGVD
FT                   LEAFLQSAPYEYRPLKGSKAYGIVDKRTGEEVYRVKTPEEAEAWIVTNTLAEQGKLPQA
FT                   GSEKSG"
FT   gene            complement(305364..306329)
FT                   /locus_tag="Mrub_0335"
FT   CDS_pept        complement(305364..306329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0335"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; SPTR: A0ACG9 Putative
FT                   transcriptional regulator; InterPro IPR001034:IPR013196;
FT                   COGs: COG2378 transcriptional regulator protein; KEGG:
FT                   aba:Acid345_4546 transcriptional regulator, DeoR family;
FT                   PFAM: HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27113"
FT                   /protein_id="ADD27113.1"
FT                   /translation="MRADRLVSILLLLQTRGRATTAELAKRLEVSPRTIHRDMEALTAS
FT                   GVPVYAERGSKGGWRLLEEYRTNLTGLSQPEIMALFALKPTQLLRDLGLGKAGENALIK
FT                   MLAALPAAQRRGAEYARQRILVDIQRYQEKVPLLPVLQEAVWQDRKLRLVYEPMEGQPA
FT                   ERTVDPLGLVVKGSVWYLVASRQGELRSYRVSRILEASVLDEPSQRPADFDLEAYWHKA
FT                   RADFRAKIPSYRIWVRVQEKVLARSNPASHWGQLEHCKPAGDSWLKAQIRFEYPEQALG
FT                   WVLAAGAGVEALEPLEFRKQVLEALSKALALYQTQARPVS"
FT   gene            306403..307317
FT                   /locus_tag="Mrub_0336"
FT   CDS_pept        306403..307317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0336"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; SPTR:
FT                   A6CNM5 Oxidoreductase, short chain dehydrogenase/reductase
FT                   family protein; InterPro IPR002347:IPR002198; COGs: COG1028
FT                   Dehydrogenase with different specificities (related to
FT                   short-chain alcohol dehydrogenase); KEGG: scl:sce3666 short
FT                   chain dehydrogenase; PFAM: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27114"
FT                   /protein_id="ADD27114.1"
FT                   /translation="MSNLKEKIVVVAGATRGCGRGIAVELGAAGATVYCTGRSTRGNPS
FT                   DLNRPETIEETAELVTKAGGTGIAVRVDHTQEAQVKALFEQVKAEQGRLDILVNDVWGG
FT                   DGLIEWGKPFWEMDMALGWRLLERSVYSHLLTSRYAVPLMLEQNSGLIVEVTDGDTLNY
FT                   RGNFFYDLVKTTVIRLAHNMAEEFKGQRINVLGQPNPVRANITALALTPGFLRSEAMLE
FT                   HFGVSEANWRDAIAQDPYYAESETPHYIGRAVVALATDPKVHEKAGQALATWHLSREYG
FT                   FTDIDGRAPHWQEFYEGKKAAEA"
FT   gene            307618..308586
FT                   /locus_tag="Mrub_0337"
FT   CDS_pept        307618..308586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0337"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; PRIAM:
FT                   D-alanine--D-alanine ligase; PFAM: D-alanine--D-alanine
FT                   ligase domain protein; ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; protein of unknown
FT                   function DUF201;
FT                   InterProIPR003135:IPR011095:IPR003806:IPR011127:IPR
FT                   011761:IPR000291:IPR005905; KEGG: pst:PSPTO_4182
FT                   D-alanyl-alanine synthetase A; COGs: COG1181
FT                   D-alanine-D-alanine ligase and related ATP-grasp protein;
FT                   SPTR: Q72IA9 D-alanine--D-alanine ligase; PFAM: ATP-grasp
FT                   domain; D-ala D-ala ligase N-terminus; TIGRFAM:
FT                   D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27115"
FT                   /protein_id="ADD27115.1"
FT                   /translation="MKVLLLAGGPPGEHEVSLSSARGVLAAMPHPTELVVIAKDGRWLL
FT                   GEDAYEALRAGVAEQGTHPFPPPVPWQHYDVVFPLLHGPLGEDGVIQGFLQLLRRPYVG
FT                   AGVASSALCMDKDLCKRVLRQAGIPVVPWVTLYKGEPTPQPPFPPPYFVKPANTGSSVG
FT                   ISKVKADQDATRALAEAFAWDDKVLVEQGIEGVRELEVALLGNIHAEASVVGEITYQSE
FT                   FYDYETKYTEGKAQLHLPAPIPPELSDEIRATALEAYRILGVRGMARVDFFLSPQGELY
FT                   LNEFNTIPGFTPTSMYPKLWQATGLAYPDLLDRLVRLALER"
FT   gene            309148..309357
FT                   /locus_tag="Mrub_0338"
FT   CDS_pept        309148..309357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27116"
FT                   /protein_id="ADD27116.1"
FT                   /translation="MVTGDRGYRSWALKAQVAWRKECFLRGHRLVGVVLLGYGLLRLME
FT                   RDPTWRLLVGQFREIWLFRIGVYF"
FT   gene            309392..311479
FT                   /locus_tag="Mrub_0339"
FT   CDS_pept        309392..311479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0339"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bca:BCE_0167 ABC-type bacteriocin transporter
FT                   family protein; COGs: COG2274 ABC-type
FT                   bacteriocin/lantibiotic exporter contain an N-terminal
FT                   double-glycine peptidase domain; SPTR: A0YQG9 Heterocyst
FT                   differentiation protein; PFAM: ABC transporter related;
FT                   peptidase C39 bacteriocin processing; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase;
FT                   InterProIPR003439:IPR005074:IPR001140:IPR003593:IPR
FT                   017871:IPR017940; PFAM: ABC transporter transmembrane
FT                   region; Peptidase C39 family; ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27117"
FT                   /protein_id="ADD27117.1"
FT                   /translation="MKLVRQVDSTDCGPACLAMVLGYWGRKEPLYRLRTLAGTTQSGTS
FT                   MLGLVRAGRQLGLEVRALEADLEGLRTLRTPLVLHWEHNHYVVLVRLTPRKVQIADPAV
FT                   GLRWIGLGELQKKWTGKLLWLKPEPAFERGNFVSKRGLKGFLAHLAHFRGTGGVLLELT
FT                   LATIALSLLGLGGPVLSQLVFDRVLTFREESLLPYLLVAIFALTFFQTLLASLRAHLAT
FT                   QLSMRLNYRLKLSYLHHLLRLPLRTLEARLPGDLLSRFGDLGQVESILRNLLVGLPSTL
FT                   LTLVLSFVLLFTYNPKLAWVALLVVPIHLVYLLWLAPRLRENSLQSLRKGAEVDSYVLG
FT                   SLEGVTALKALRGEGWALSRGRDQIAGLNDILWQGFLLSNWGGALVALLGGLFSLFLLW
FT                   YGAGLVLRLELTVGQLVAAYGLVQGVTAALGSLSGTVMAIQQGIVASDRLAEVVELEPE
FT                   QEQKNAVLRPLERAIALEHLCFSYLPERPLLKDLCLELPKGSYTAIVGPNGAGKSTLGG
FT                   LLARMLEPQSGRISWDGRDLAELSPDAVRERVAYLRQEVPLFYATLRENLSLGHPLPEE
FT                   RLWRVLELVGLMPAVRRLPEGLDTVVGGESLYRFSSGERQLLGVARALLSPADLLILDE
FT                   PTATLDPDKERQIVALLRAFKGERTLLVITHRPALLEPADQVFALQDGVLKPVEPVLQG
FT                   V"
FT   gene            311483..312466
FT                   /locus_tag="Mrub_0340"
FT   CDS_pept        311483..312466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0340"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; SPTR:
FT                   A3RNT4 Type I secretion adaptor protein (HlyD family);
FT                   InterPro IPR006143; COGs: COG1566 Multidrug resistance
FT                   efflux pump; KEGG: afr:AFE_2692 type I secretion membrane
FT                   fusion protein, HlyD family; PFAM: HlyD family secretion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27118"
FT                   /protein_id="ADD27118.1"
FT                   /translation="MSQGRLEWELPPARKSRWVLWLLLLILGILVVGAWLTPVQVYALA
FT                   SGALEPRGQVLRVLAPSGGRLVYVGVQPGQLVQKGQRLYTLDGLGSSPEEARLQLQTAM
FT                   AQAEEAVRTLAQVREQLAQRRRIAQIQTSLYQVGAIARVEYLEALENLRQAEAAVRVAE
FT                   ARVSTLRAQAQALKSRRNIHLNSPATGRILTLSSHRAGEPVMAGQVLAEVLPQDVPLVF
FT                   RAYLPERERPKLRAKAEAEVAWNAFPRQRFGTSRGTVERISPSTVVYNNQAVYEVEISL
FT                   PSLTLSSAEGTRQVVPGMLGEARIVAARRSALSLLWDWVRGVNPWG"
FT   gene            312463..313026
FT                   /locus_tag="Mrub_0341"
FT   CDS_pept        312463..313026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0341"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; InterPro IPR000792;
FT                   KEGG: afw:Anae109_0915 two component LuxR family
FT                   transcriptional regulator; SMART: regulatory protein LuxR;
FT                   PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27119"
FT                   /protein_id="ADD27119.1"
FT                   /translation="MIRVLSGSRLIQESLTLALGNLLLRRAVVLVADYPLGSALALLPG
FT                   VQGPCVVKTASDSPYYLSDLVALGPAGLVLEGAGLDFLRWTLQQVSEGQRVLPRLGEVG
FT                   LTRKERAVLRLLVGGVCNDAISAHLGISPRRTANLVSTVKRALGAETRADVVLRYFGLA
FT                   PEPIIKATLQKTGNFSLPHEVETA"
FT   gene            313059..313223
FT                   /locus_tag="Mrub_0342"
FT   CDS_pept        313059..313223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27120"
FT                   /protein_id="ADD27120.1"
FT                   /translation="MKLRELEAEEMEQVVGGAIEPSAWLKLITQLPTLPEPWPRRGIVP
FT                   PPRQLAERE"
FT   gene            313622..314560
FT                   /locus_tag="Mrub_0343"
FT   CDS_pept        313622..314560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27121"
FT                   /protein_id="ADD27121.1"
FT                   /translation="MSLRRATKSIILLPHMLAVFGSLASVLSFIVSTDNDLGRSIAIAI
FT                   SSMLAFVGYYLPARDETPALPELILAFGVITVLLHLIMPPTVLSALAQVLCMIFLALMS
FT                   NRVKLFFLIKPKLSVVFLFLPISMFGSSFLMMNHWIAYNILKPHYLEYSGKAKTSHQFE
FT                   IRGSMVVANTWEEMLRLGTYLSGVTNPYLSGLLWASGHSLPEASRAGKTGVDVPNGNED
FT                   IFKIWVGLAFLCETTIYGAILLFILKLTGSFWNVLLIHMMTNLFGFSITVGPELLGILL
FT                   SGTFLALGGAWLVFQLRYLGARFSQTGPRFG"
FT   gene            314684..315115
FT                   /pseudo
FT                   /locus_tag="Mrub_0344"
FT   gene            316317..318830
FT                   /locus_tag="Mrub_0345"
FT   CDS_pept        316317..318830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0345"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; InterPro
FT                   IPR001440:IPR013026; KEGG: glo:Glov_2533 TPR
FT                   repeat-containing protein; COGs: COG3629 DNA-binding
FT                   transcriptional activator of the SARP family; SPTR: B5IGG0
FT                   Archaeal ATPase family; PFAM: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27122"
FT                   /protein_id="ADD27122.1"
FT                   /translation="MSVLSPSALELLATAPAVVVAPVGIGFAQTDLEAWAHKTRRRILR
FT                   DPAEFSGLAPTLILPQRRSDLERLNSSDPRDFLFLRESDLLFSHDEWQQAVSTQQTYAE
FT                   TGGWPEALALLQRIVLQPGESLVRHPLCVARLGSLLPKDIPREILAKAAQSPLLIPELY
FT                   GLLGLDDTSVAELYDRGLLYAQGSGLAMPKLLRLYLRGSIPAEVARFIEITLLASGHVT
FT                   AVLELLAEQGEWERYLRLLTETFSTALGNAYLREWLALVPPKYRDLPVYRYLATYLARF
FT                   AGHTTLMEKELVELLPLADDHLRPFVLNAYGVSLGMQARYEEAIEKFRECLESNSSRVE
FT                   GITGKVFHNLGVAFFHLGKLAQAQDALLRAASIYRQLGLFDQEAISLATLAPVELCLGN
FT                   PREAISLVERALPYMNKLAAESYLTAENLAKAWIMCGDISNAERHLLELPEPKRDLRSH
FT                   LVTKKRLGEVYLWKGRYAEAKQLVEEVLYSNFKDQEVLDDVHLLLSRIAFLEGKTEQAR
FT                   AHLNKVVRSVHAITESAWQGLINLDTAIAELRRLGMKFDLARLLLRKGDLASLREALEL
FT                   SRTYQYGLLLHHPHYAHLWRPLVLADKGARSVFPLQIGTFGSFEARLLGTKLDLSRFKT
FT                   RKSAVLLTYMALHPSAHNRDKLAELFWSDVSNPLASLNTAVSELRKLFDAPIMEGNKGQ
FT                   VWLAFPVQTDLADFTKSTEPFLKQPLLDPNQIGRLEAQLARFDAPWLPDFPDWFDEERT
FT                   FVEHRKAKLWRLLADFYATRAPHKAVAAYQRVTCLEPFNAEAWAGLMELYNTLGEKSLA
FT                   EQAQAAMHRAMRELFPFEPILCNQK"
FT   gene            complement(318915..320258)
FT                   /locus_tag="Mrub_0346"
FT   CDS_pept        complement(318915..320258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0346"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PRIAM: Starch synthase; PFAM: Starch synthase catalytic
FT                   domain protein; glycosyl transferase group 1; InterPro
FT                   IPR001296:IPR013534:IPR011835; KEGG: bcb:BCB4264_A4996
FT                   glycogen synthase; COGs: COG0297 Glycogen synthase; SPTR:
FT                   Q5SMC5 Glycogen synthase; PFAM: Starch synthase catalytic
FT                   domain; Glycosyl transferases group 1; TIGRFAM:
FT                   glycogen/starch synthases, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27123"
FT                   /protein_id="ADD27123.1"
FT                   /translation="MKVAFVASEAFPFAKVGGLADVIGSLPQALKKQGLEPTIFIPWYW
FT                   GIQGYYVGEAWFNFEGQREKIGIGHAEHGGVRYVLVGLGDFARDKPYGYDDDFRRFVRF
FT                   AMATAELLRDFDLVHTHDWQAALLPLLRNLGWFRGRTVYTIHNLAYQGVWGSQDFYAWT
FT                   RLPGETYYGAGLEHHGSINLMKAGIVNADAVTTVSPRYAWEITTPEGGEGLDGVLRAQQ
FT                   WKLRGILNGLDTAYWNPATDPYLEHHYSASDLSGKTRNRALLLSELGLEDRPTLGVVSR
FT                   FAHQKGIDLIADAVDGLMGLGVNLVVLGSGDPHLERTFAWMAAHLKGRLAYVQGYNEPL
FT                   AHRIYAGSDGFLMPSRFEPCGLAQLIAMRYGTPPIVRAVGGLLDTVKHWETGFMFDAMD
FT                   AGGILHGVHEFLKHPDREAVAKRAMQQDFSWDGPAREYLALYRQLLGG"
FT   gene            complement(320274..320702)
FT                   /locus_tag="Mrub_0347"
FT   CDS_pept        complement(320274..320702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0347"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; SPTR: A0YQB3 Putative
FT                   uncharacterized protein; InterPro IPR009288; COGs: COG2105
FT                   conserved hypothetical protein; KEGG: stm:STM4411 putative
FT                   cytoplasmic protein; PFAM: AIG2-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27124"
FT                   /protein_id="ADD27124.1"
FT                   /translation="MNAPEAVFVYGTLKQGERNFQVSKAAGWLRSAEAYIEGFRLFHIP
FT                   RSEVRPYAYPGVVRGEGRVWGEVQWFADLAHALELLDELEDEGREYRRISATAYLSQQA
FT                   PQPCAVWVYTYPSLEAMRSVSGLWLPEGVWREQTQPKG"
FT   gene            complement(320760..321449)
FT                   /locus_tag="Mrub_0348"
FT   CDS_pept        complement(320760..321449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0348"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; InterPro IPR000415; KEGG:
FT                   sfu:Sfum_0229 nitroreductase; SPTR: A3CX61 Nitroreductase;
FT                   PFAM: Nitroreductase family; TIGRFAM: SagB-type
FT                   dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27125"
FT                   /protein_id="ADD27125.1"
FT                   /translation="MDKHPGKVFYRLTRIFPGDELPGGRAPAAKVYANPLESVELAEPA
FT                   RDGGPAVWRVLSRVAPTTPKVGSSITQAELSQVLAPLAVRREGRGYPSAGGAYPLEVYL
FT                   AVQRLQDTFQGIYHYAAKQHQLEQLSSRFDPQSWRAALMDLEAVETSAALVVFSAVPER
FT                   SEAVFGLRGFRYALLEVGYAVGEVMVAATALGLQAYPAATFYDEEVRKLLALPEAEYPV
FT                   VVLLLGR"
FT   gene            complement(321518..322759)
FT                   /locus_tag="Mrub_0349"
FT   CDS_pept        complement(321518..322759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0349"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; InterPro
FT                   IPR005835:IPR005836:IPR011831; KEGG: sus:Acid_1105
FT                   glucose-1-phosphate adenylyltransferase; COGs: COG0448
FT                   ADP-glucose pyrophosphorylase; SPTR: Q5SMC1
FT                   Glucose-1-phosphate adenylyltransferase; PFAM: Nucleotidyl
FT                   transferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27126"
FT                   /protein_id="ADD27126.1"
FT                   /translation="MSMRVLGMILAGGQGSRLFPLTAKRAKPSVPFGARYRIIDFVLNN
FT                   FLNSGIYGIYVLTQFKAQSLTEHVQRHWRFGGFLEDAFILLVPAQMYRYEELGPVWYRG
FT                   TADAIYQNLHLINNHKPEHVAIFGGDHIFKMNIAHMLDYHNDHKADLTIAAYPVPIEQA
FT                   SRFGVLQVDDQWRMVGFQEKPKNPTPIPGKPDLALVSMGNYIFRTEALVEKLEHDAKDP
FT                   NSSHDFGKDVIPRALSEGYRIQVYDFKRNPIPGQSGPNTYWRDVGTIDAYFEASMDLIQ
FT                   VTPEFDLYNPEWPLRAANFNSPPAKFVHEAGARTGQAFNSLIAGGCIISGGTIRESVIF
FT                   RRTRINSYALVERSVLFDEVEVGRYAKLRNTIVDKNVIIPPHTEIGYDLEADRARGFTV
FT                   TPEGIVVVPKSYRF"
FT   gene            322879..325047
FT                   /locus_tag="Mrub_0350"
FT   CDS_pept        322879..325047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0350"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; SPTR: A4U2M7
FT                   ATP-dependent protease LA; InterPro IPR008269; COGs:
FT                   COG1067 ATP-dependent protease; KEGG: aeh:Mlg_1517
FT                   peptidase S16, lon domain-containing protein; PFAM: Lon
FT                   protease (S16) C-terminal proteolytic domain; TIGRFAM:
FT                   lon-related putative ATP-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27127"
FT                   /protein_id="ADD27127.1"
FT                   /translation="MRLSYEALEWRTPIENSAEPVSLPPPPPFFGQERAREALELALRG
FT                   GFHAYLVGPSSLGKHEALLAYLSTQSVETPPDLLYVPLSERKVAVLTLPSGQEIHLAEA
FT                   VEGLLLEVNRLDELFRQGSFLREKTQLEARFKAAREQQLAALQQEAQEAGFALSVNGER
FT                   LELTGPGPVPAELSARLEEVTLGSLAASAELEVALRRLRRDWALHYLNNRFEPLFQRFP
FT                   QARTYLEALRARLARYAETGEPLDPAQWRPNLLTSSSSGTPPPIVYEPYATAPRLFGRL
FT                   DYLVDRGVWSTNVSLIRPGAVHRAQGGYLILDALSLKREGTWEAFKRALRNGQVEPVTE
FT                   PQAPAGLEVEPFPIQMQVMLVGTPEAFEALEEDPAFSELFRIRVEFSPTLPASPENRAA
FT                   LGGWLQTQGFQLTQGGLTRLYDEARRSAEQRDRMDARLVEIRALAEEAAVLGEGLVSAE
FT                   SVERAIAAREHRSFLSEEEFLRAVREGVISLRTTGKAVGEVNSLVVVEAAPYWGRPARL
FT                   TARAAPGRDHLVSIDREAGLGGQIFHKAVLTLAGYLRSRYTEHGSLPVTISLAFEQNYV
FT                   SIEGDSAGLAELVAALSAIGNFPLRQDLAVTGAVDQTGKVLAVGAINAKVEGFFRVCKT
FT                   LGLSGTQGVILPQANLANLTLRAEVLEAIRAGQFHIYAVETAEQALELLADARMEGYRG
FT                   LQDKIRAGLEAFAKLEEGQDKEDKENSQ"
FT   gene            325094..326104
FT                   /locus_tag="Mrub_0351"
FT   CDS_pept        325094..326104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0351"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; SMART: peptidase S41; InterPro
FT                   IPR005151; KEGG: rce:RC1_1530 carboxyl-terminal protease;
FT                   COGs: COG0793 Periplasmic protease; SPTR: A3IPI9
FT                   Carboxyl-terminal protease; PFAM: Peptidase family S41"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27128"
FT                   /protein_id="ADD27128.1"
FT                   /translation="MRWWVMGLVLWGSLALAQDTQAFAVRFEQAWRLVKERYYDTSFKG
FT                   LNWEAIGHAYRQRLGEVRDWDGLYRLLDEMYGELRDDHSRVLSPAEARRLLSGAQCLPL
FT                   PFKDQDLLPNATPSNPNTPSPRPAQPANPVSPPSQPSRTPYVTPQVRFTDGVVIVRLNN
FT                   LVDAVGPSALQEAIRRYEARARGYVLDLRGNPGGLALRMAEVAGIFMRGVPWRIVSRGL
FT                   GGIPLPTTPFLGRPQTQKPLVVLIDGNVHSAAEGLAGALKNAGRAYLIGTRSAGNTEAL
FT                   TPYCFPDGGVALVAGGVLAPFSGPTWEGRGVEPDLVEENPDKQLEAALRYILHQR"
FT   gene            complement(326112..327311)
FT                   /locus_tag="Mrub_0352"
FT   CDS_pept        complement(326112..327311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0352"
FT                   /product="acyltransferase family protein"
FT                   /note="KEGG: mxa:MXAN_5081 acyltransferase family protein;
FT                   SPTR: A1ZK66 Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27129"
FT                   /protein_id="ADD27129.1"
FT                   /translation="MEKRIHYLDWLRLLAVFLGLVFHAGRPFDGWPWIIKGPEIRWLTY
FT                   FNEALTTVRLPLLFFVSGAATVFALRKASAIAYATDRFKRLIIPLVMGVLLIVPPQQYI
FT                   RRLSLDSSNPQHFEGSYGQFLIGPWWGDGSFLFFNLHTEHLWFLLYLFYFSLLALPVFL
FT                   YLRSPLGLGFLARLETWFQAAPWRIWLLVITPATLGALLPLGLGSHPGLAEDLANLGFY
FT                   FELFVLGFALYLRPSLLQAIFGQRRQFLLAGLGLILLKAYFYSSVLHRNLFVSSELLPY
FT                   HEVYWSLRDLAALSLIFAILAYAHRFLNKSSGFLDRARHWVYPFYIWHQTVIVVLGYFV
FT                   LKLALPVGWLYALLLTGSLVVTVLLSELVQRSAVSRFLFGVHHKAQPATTRTSRTSESN
FT                   "
FT   gene            complement(327351..329186)
FT                   /locus_tag="Mrub_0353"
FT   CDS_pept        complement(327351..329186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0353"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PRIAM: Asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: asparagine synthase;
FT                   glutamine amidotransferase class-II; InterPro
FT                   IPR001962:IPR000583:IPR006426; KEGG: wsu:WS2192 putative
FT                   asparagine synthetase (glutamine-hydrolyzing); COGs:
FT                   COG0367 Asparagine synthase (glutamine-hydrolyzing); SPTR:
FT                   A3CX83 Asparagine synthase (Glutamine-hydrolyzing); PFAM:
FT                   Glutamine amidotransferases class-II; Asparagine synthase;
FT                   TIGRFAM: asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27130"
FT                   /protein_id="ADD27130.1"
FT                   /translation="MCGIAGAFSTSQPMPELTKLVGKIVNSQLPRGPDHQAVVELPQPA
FT                   GQLVLGHNRLSIIDLSEHSNQPLWDHSRRYCIVFNGEIYNYLELRTELQTLGHRFQTQG
FT                   DTEVILEAYKAWGKQAWERFIGMFAFALLDTQAGQLWLVRDRFGVKPLFYRLQHGLLAF
FT                   ASSTEALAQHFGLSPNLEYVSRGLFYYVYEDDSDISPYTGLHALPAGHHACVQLSQPSI
FT                   EPQPYYDLKSRVEQKIQALRGMDEKALLEELETTLHSAVQLRLRSDVPLAVSLSGGLDS
FT                   SLVAALAAQQHERVVGFCYGHPQAPRSEGPLARELAQKAGIDVHFVWPELSKEHLVQAF
FT                   EKTLAAQDAPFPTLSILAQNFVYKAARSEGYKVLLGGQGGDEGFMGYRKFFLFQLRYLL
FT                   AQKQYLELAGFALGLARLLSAELYKLGLFWQNRQRYFGGPAQGNLRLPSVRLALGTDHR
FT                   QAPWLRQMLDVTRYSLPTLLRYEDRNSMGHSIESRLPFLDYRVLELGLALPVHLKLRHG
FT                   YGKWALRQMAQGKIPDSIRTARYKRGFDVTQSWLATGLGSHLQEQIQAAEPVLREVLTP
FT                   NLNLAHTYSPAQMQQQPHRLAEAISLVWLARKLSS"
FT   gene            complement(329187..330332)
FT                   /locus_tag="Mrub_0354"
FT   CDS_pept        complement(329187..330332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0354"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: aba:Acid345_3307 glycosyl transferase,
FT                   group 1; SPTR: A3SJ03 Probable glycosyltransferase; PFAM:
FT                   glycosyl transferase group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27131"
FT                   /protein_id="ADD27131.1"
FT                   /translation="MPQPLPKIVHLTSAHPPFDVRIFHRECVSLAQEGYPVVLVAPHEG
FT                   DEVRQGVQVRSVTKTKGRLGRMLGTVWAVYKQALAERGDIYHFHDPELIPVGMLLRLQG
FT                   KKVVYDVHEDVPTDILSKRWIPKPLRGLVASSMRLLERLAGSLLSGIVTVTEPIAARFP
FT                   AHKTILLQNFPHPQEIAALGSTSYQNRPARVLYAGSITAVRGLFEMLEAMQHLQNPEVR
FT                   LTLIGAFAPPGLRAEAEQHPGYRYTDFLGYKNRPETLELLASSRIGLAVLHPIPSFLVS
FT                   QPTKLYEYMMAGIPFVASDFPLWRRSIGDVSCGLFVNPNDPKAIAEAIRWLLEHPAEAE
FT                   AMGQRGRQLILERLNWGVEFAKLTALYQRLYKAGTARHLEA"
FT   gene            complement(330350..332260)
FT                   /locus_tag="Mrub_0355"
FT   CDS_pept        complement(330350..332260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0355"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PRIAM: Asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: asparagine synthase;
FT                   glutamine amidotransferase class-II; InterPro
FT                   IPR001962:IPR000583:IPR006426; KEGG: aav:Aave_0961
FT                   asparagine synthase (glutamine-hydrolyzing); COGs: COG0367
FT                   Asparagine synthase (glutamine-hydrolyzing); SPTR: A7IB45
FT                   Asparagine synthase (Glutamine-hydrolyzing); PFAM:
FT                   Glutamine amidotransferases class-II; Asparagine synthase;
FT                   TIGRFAM: asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27132"
FT                   /protein_id="ADD27132.1"
FT                   /translation="MCGIAGLALRKPGALNWAGRALEGLHHRGPDDQGWLAWSPSAAAH
FT                   RGKTWNEAQGLVLLVHRRLSILDLSELGWQPMSSPDGRYHLVFNGEIYNYLELRQELKA
FT                   LGHCFRSHSDTEVLLAAWAHWGTACLERLVGMFAFAVLDTQEQSLHLVRDFFGIKPLYY
FT                   CAFAEGVGFASEIPVLLELPGVGRQVHPQGLYRYLRFGLTDDGAQTLFSDIRQIPAAHY
FT                   LRLDLNNLQLTEPQRYWQPRLQNPLELSFEEAAEAVRAQFLENVRLHLRSDVPVGAALS
FT                   GGIDSSAIVAAMRHLEPGLELHTFTYVADNGVSEEPWADLVGQAAGVQAHKVKPSASEL
FT                   VADLDELVRVQGEPFGSTSIYAQYRVFRLAQEAGIKVMLDGQGADEVLAGYAVYGGARL
FT                   ASLVRQGRWLEALAFLRTSRLEPALKDTWKSAIGFLIPASLEPLARRLAGQELAPPWLN
FT                   TTWFTERNVQLASPRAAHGREVLRHELLQSLTETSLPKLLRYEDRNSMAHSIESRVPFL
FT                   TPKLVELLLNLPEAHILSPQGQTKAVFRRAMQGLVPQAILDRKDKVGFATPEQHWLHQL
FT                   APWVHQLLDSETLGRIYPIQQTAVKEEFAAILAGRKPFDFRVWRWINLIAWARAFHVQF
FT                   N"
FT   gene            complement(332280..333395)
FT                   /locus_tag="Mrub_0356"
FT   CDS_pept        complement(332280..333395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0356"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PRIAM: Glutamine--scyllo-inositol transaminase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; aromatic amino
FT                   acid beta-eliminating lyase/threonine aldolase; Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; InterPro
FT                   IPR000653:IPR001597:IPR000277; KEGG: aeh:Mlg_0663
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; COGs: COG0399
FT                   pyridoxal phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis; SPTR: P15263
FT                   Pleiotropic regulatory protein; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27133"
FT                   /protein_id="ADD27133.1"
FT                   /translation="MSTLTQIPILDLKAEVDELWDELNAAIQRVLRSTQFIMGPEVQAL
FT                   EQQLAQYLGVKHAVALNSGTDALVIGLRALGVGPGDEVITSPFTFFATAEAISLLGARP
FT                   VFVDIDPQSFNLDPAGLEAAISPQTRAIIPVHLYGNPAAMGPILEIARRHGLKVLEDCA
FT                   QSFGARYEPLHRFTGTLGDAGAFSFFPSKNLGAYGDGGLLVTADDAVAEQARMLRAHGS
FT                   RKKYHNEVVGYNSRLDTLQAAILLVKLPHLERYNQARRAIAQRYNEGLAGLEGLIPPAL
FT                   TPGHVFHQYTVRILGNRRDAVQARLAELGIGTMVYYPVPLHRLPIYQPLGLHLPESERA
FT                   AAEVLSLPIWPQMQPEAQRAVIEAVRAAVQG"
FT   gene            complement(333392..333970)
FT                   /locus_tag="Mrub_0357"
FT   CDS_pept        complement(333392..333970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0357"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; SPTR: A3L6J8 Bacterial transferase
FT                   hexapeptide-like protein; InterPro IPR001451; COGs: COG0110
FT                   Acetyltransferase (isoleucine patch superfamily); KEGG:
FT                   lch:Lcho_0290 acetyltransferase; PFAM: Bacterial
FT                   transferase hexapeptide (three repeats)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27134"
FT                   /protein_id="ADD27134.1"
FT                   /translation="MDYFKHETAIVDEGAQIGRGTKIWHFCHISAKAVIGENCTLGQNV
FT                   YVANNVIIGNGVKIQNNVSVYEGVILEDYVFCGPSMVFTNVLTPRSEFPRNTAADYGRI
FT                   LVKRGASIGANATIVTGVTLHEGAFVAAGAVVTKDVPAYAIVAGVPARIIGWMSAYGDR
FT                   LDFSQSDTVTDSQGHVYQKVGPFEVRRIK"
FT   gene            complement(333972..334916)
FT                   /locus_tag="Mrub_0358"
FT   CDS_pept        complement(333972..334916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0358"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; SPTR: A3SJ11 MviM protein; InterPro
FT                   IPR000683:IPR004104; COGs: COG0673 dehydrogenase and
FT                   related protein; KEGG: glo:Glov_1510 oxidoreductase domain
FT                   protein; PFAM: Oxidoreductase family, C-terminal alpha/beta
FT                   domain; Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27135"
FT                   /protein_id="ADD27135.1"
FT                   /translation="MKNFALIGAAGYIAPRHLKAIKDTGNRLVAALDPFDSVGIMDSYF
FT                   PEAEFFTQPELFEDYLYRLRGTPQQVDYVSIASPNYLHNAHIRMALRAGADAICEKPLV
FT                   LNPEEIRELKDLEAETGRRVWTILQLRTHEALLSLHARLQAQPPRKYQLDLTYITSRGT
FT                   WYLRSWKGRTEQSGGLATNIGVHFFDMLTWLFGKVEQVEVHRRDDTVASGYLELERAQV
FT                   RWFLSIDVEYVPPALRAQGKRTYRSMRLDGEEIEFSEGFTELHTRVYERTLAGQGFGLE
FT                   DTYEAIATVARIRTLPLSDRTATMHPFLQKVKQ"
FT   gene            complement(334925..336244)
FT                   /locus_tag="Mrub_0359"
FT   CDS_pept        complement(334925..336244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0359"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PRIAM:
FT                   UDP-glucose 6-dehydrogenase; PFAM: UDP-glucose/GDP-mannose
FT                   dehydrogenase; UDP-glucose/GDP-mannose dehydrogenase
FT                   dimerisation; UDP-glucose/GDP-mannose dehydrogenase ;
FT                   6-phosphogluconate dehydrogenase NAD-binding;
FT                   InterProIPR014027:IPR014026:IPR001732:IPR006115:IPR 017476;
FT                   KEGG: ank:AnaeK_1384 nucleotide sugar dehydrogenase; COGs:
FT                   COG0677 UDP-N-acetyl-D-mannosaminuronate dehydrogenase;
FT                   SPTR: A6CP32 UDP-N-acetyl-D-mannosaminuronate
FT                   dehydrogenase; PFAM: UDP-glucose/GDP-mannose dehydrogenase
FT                   family, central domain; UDP-glucose/GDP-mannose
FT                   dehydrogenase family, NAD binding domain;
FT                   UDP-glucose/GDP-mannose dehydrogenase family, UDP binding
FT                   domain; TIGRFAM: nucleotide sugar dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27136"
FT                   /protein_id="ADD27136.1"
FT                   /translation="MQTVVDPKTLLLQRIEDKTALVGVVGMGYVGLPFAVEKAKVGYRV
FT                   VGIDRSAKRVAMINQGQNYIGDVKDEELRDLVAQGLIRATTGFEEVPELDVIVIAVPTP
FT                   LTKNLVPDLQYVEGVTREIAKYLRPGQLVSLESTTYPGTTEEVMLPILEQSGLKLNQDF
FT                   FLAHSPERVDPGNARYTTKNTNKVVGGVGPQSLEVAVAFYSKTINHVVPVSSAKAAEMV
FT                   KVFENTFRAVNIALVNELTLLCDRMDLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIPL
FT                   DPHYLEWKAKEYNFNTHFINLAGEINRKMPEFTVDKAARVLSQHGKPLRGAKVVLLGMA
FT                   YKANLDDYRESPAIEVFKLLQKRGAEVVFHDSWTPHVEEHGFVADSVELTDELLQNADL
FT                   VIITTNHSNVDYARVVALSKVVLDTRYATRGIKADNVVLL"
FT   gene            complement(336254..337492)
FT                   /locus_tag="Mrub_0360"
FT   CDS_pept        complement(336254..337492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0360"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; SPTR: A6CP41
FT                   Putative uncharacterized protein; InterPro IPR001296; COGs:
FT                   COG0438 Glycosyltransferase; KEGG: aba:Acid345_3305
FT                   glycosyl transferase, group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27137"
FT                   /protein_id="ADD27137.1"
FT                   /translation="MRFLFLTQYFPPEIGAAQVRLASVIRELVRLGHQVEVVTAMPNYP
FT                   TGRVFEGYRGRLWLEEDWEGVRVVRTWLYPAMGTGPKRLLNYFSFVLSALGGVLKVQKP
FT                   DYIFVESPPLFLSLTGYLASRRFGVPFIFNIADLWPDSVRQLGLMKEGPLLCLAEGLES
FT                   WSYRQAHFITAVTEGIQKVLLEEKKVPPHKILYLPNGVDTDLFKPMPPDLALARELGLE
FT                   GKKIILYAGNHGYAHGLEVALQAARLLTDPQVVLVLIGDGSEKPRLKQMAQEMGLTNVR
FT                   FLDPKPPAYIAQLYSLAVAGLSTLRNSPLFEMTRPVKIFAGMSCAKPILYAGQGEGARL
FT                   VEGARAGLVSLPEDAQTLAHNIMAVVQNPHLAEQLGQNGRRYVETHLSWSVLIENWLYQ
FT                   LQSQQPKAEKVPV"
FT   gene            complement(337744..338769)
FT                   /locus_tag="Mrub_0361"
FT   CDS_pept        complement(337744..338769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: P94576 Uncharacterized protein ywoF; InterPro
FT                   IPR010916; KEGG: pna:Pnap_3111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27138"
FT                   /protein_id="ADD27138.1"
FT                   /translation="MFGIPSGPTYYVSPSGSNANDGSRERPWATLSFAVQKLKPGDVLR
FT                   VLPGSYNESVQVTASGTSSQRITIASDIRWGAKLNAQGNLFGIDVRGSYVDIVGFEVTN
FT                   ATNSGIISWAPYNRFLFNHVYGIRAQCDSNGGAGINASQPNAGNTSILSNLVHDIGDLT
FT                   AGPCTRIHGIYQGSPKGIIQNNIIYRARGFGITTWQAATAVVMTHNLSFANLYGGISVG
FT                   SGENTLGNKAENFLVANNIVVSNPRGISEENNTGVNRFLNNLVWNNTTNWALLTSSQQN
FT                   SLTEDPRFVNFKADGSGNYYLSNDSPAIDKGIREAAPSFDFMGHPRILGIAPDLGPLET
FT                   R"
FT   gene            complement(339065..339850)
FT                   /locus_tag="Mrub_0362"
FT   CDS_pept        complement(339065..339850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0362"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein;
FT                   InterPro IPR003856; KEGG: pde:Pden_0846 lipopolysaccharide
FT                   biosynthesis; PFAM: Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27139"
FT                   /protein_id="ADD27139.1"
FT                   /translation="MRSTSSINDFDRLLLSFSRYMWALLGVSVLIAVVAYLLSISQPRI
FT                   YEASARLLSAQPVELGSTISAPRFQPLAAAAYREAAYGTLVLEQMNRRFPGVLPSEVAK
FT                   VREKLRIRSIETVGSSSIVFVLSARDSDPRRSAALANAWAEALRNWEEALIRDNFKRAS
FT                   VSLENRIRWVDIQITQAASRTDQNILRELRTNLERELGIIRSLENSATGQLSLLAQAEV
FT                   PTEAIWPRPLLTAGIAAISTLLLGFILLAVRDRLLGPTG"
FT   gene            340098..341528
FT                   /locus_tag="Mrub_0363"
FT   CDS_pept        340098..341528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0363"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; SPTR:
FT                   A3CTD1 Polysaccharide biosynthesis protein; InterPro
FT                   IPR002797; COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; KEGG: reh:H16_B0030
FT                   O-antigen translocase; PFAM: Polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27140"
FT                   /protein_id="ADD27140.1"
FT                   /translation="MTRIKGFLTQTSFVGNAALLASSTVLGQGLVVLVQPLLTRIYRPE
FT                   DFGWWALYGSILSLAAVMINLRYEQAIQLPREEPEARGLLLIAVGVGLGLSLLIGGVFW
FT                   FFRDVFSVWLGVQIPGWFAALVGVGLACIALMQSGSMWALRLQRFGALAQTKFQQGLWQ
FT                   ALAQVGLGLLVKGPAGLLLGDVLGRLGGVQALWRLLPRSLEGITWRTLQQTARRYRSFL
FT                   VFGTSAALLTAASFHLPFILLTAFFGAAAMGQFSLSYRITTIPVTLVAQSIGQVFFARA
FT                   AAARETPELAQLTIRTSTMLIAVGLPIFGALFVVAPQAFPLIFGSNWYEAGVYARLLAP
FT                   YLLLSIVAQPLSTLLTVKEWQQALLVFTVFELALRMGAIYWGIAIQQMYWAVFLFASSS
FT                   ALVAGISLGLFFRAAGARWADFGRGLRRYIWLNLPALLLLWGLTHWVAGWSLLGLTVLV
FT                   SATVLFFTARELRKEGLV"
FT   gene            341525..342811
FT                   /locus_tag="Mrub_0364"
FT   CDS_pept        341525..342811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0364"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; InterPro IPR007016;
FT                   KEGG: sus:Acid_6617 O-antigen polymerase; SPTR: A3WF85
FT                   Putative uncharacterized protein; PFAM: O-Antigen
FT                   Polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27141"
FT                   /protein_id="ADD27141.1"
FT                   /translation="MRSVAPVTAALLFPLWSWLAFPQILLYLYTFSLPLEGVFAIEGVF
FT                   TLSKALLGLFLLSLVFQIRRPKIAWFPALVLTWRYIPRLRISILAVVLLFWACLSYFWS
FT                   VDPSATWDKLQALAQQLVGALAIAFFIMVRPNTLQPMLFFYSLGASIAALQGIFNYLRN
FT                   PLSRTTFTGAADAADFAAVVLLGSLIAVGLWLTTRSPWMRWYSMFCFALCTLAVVLSGT
FT                   RSAWVAIVITLALVVLPRLGWRQFLSLGLTFGLVGLALFQLPAVNQFLSSRITSAAEDG
FT                   GAGRTAIWTVGWHIAQQNLIFGHGLGTFTTLFGQGIAAESDLESIDTYYITDGRGAHNI
FT                   YLELVSEVGLVGLGIFLAWMWVLLQVSLRQAVHPDLILILKACLLAYLIQGAFLGILER
FT                   KYLWLTIALLHGLAMMVRGNSYARIVSKP"
FT   gene            342786..343949
FT                   /locus_tag="Mrub_0365"
FT   CDS_pept        342786..343949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0365"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; SPTR: O32272
FT                   Putative teichuronic acid biosynthesis glycosyltransferase
FT                   tuaC; InterPro IPR001296; COGs: COG0438
FT                   Glycosyltransferase; KEGG: bsu:BSU35590 biosynthesis of
FT                   teichuronic acid; PFAM: Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27142"
FT                   /protein_id="ADD27142.1"
FT                   /translation="MRVLFLSPDFPSNVHPSACIFVQTQALELQRLGVQVDVHAPIPLV
FT                   LPGMARLKPNWRAYTQIPNQYDVEGVRVLRPRYLAFPSENLWGWPHRLKAFSLPAHSCD
FT                   LIHAHFAHPEGTLGLLLKRRWKKPLVVTLHGDDANTYPEQSPRYRKYYKQVLAQADLIL
FT                   TVSDGIRQKAQAHTQRPVLTHRVGLRLPPMQERPDKRGLRSQLGLPQDRFVLLFVGTLV
FT                   QYKGVLELSEALRQLDDEGVLAVFIGDGPLRDGLGSSSRTQRILLGQQPNAVVRRYMVA
FT                   ADALILPSYREGLPTVVVEAGAVGLPVIASNRGGTPEIVTPETGYRLEEISPAAILAAI
FT                   AQVRSDPLEAQARGERLRQHVYRHYDASRNAQQLVRLYRRLLEGGLG"
FT   gene            343952..344857
FT                   /locus_tag="Mrub_0366"
FT   CDS_pept        343952..344857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bav:BAV0088 lipopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27143"
FT                   /protein_id="ADD27143.1"
FT                   /translation="MSTPSKPLKFQQALRSSWHRFYSDFLLPSRVHELRSLLEQALAQG
FT                   YQVHSIASIWEKIKAGQLQDGPYLVLRLDIDTDLRTTRALWQVVREMGVQASFYFRLST
FT                   LDVNLMQEIHASGSEASYHYEEIATYAKRHRLKNRAEVEACMPAIRALFAENYRRIKAL
FT                   TGLPLHTVASHGDWLNRRLGVINHELLQDRGLREELGIELEAYDPVLQQRYTQRFSDGA
FT                   YPNLWLDGNPLEAIRTGLPFVEVLLHPRHWGANIPVNLRDNLHRLGEELAYRQSGWFCL
FT                   IGPMISLWPIVQGGLVESGF"
FT   gene            345260..347326
FT                   /locus_tag="Mrub_0367"
FT   CDS_pept        345260..347326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0367"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /note="PFAM: Ig domain protein group 2 domain protein;
FT                   SMART: Ig domain protein group 2 domain protein; InterPro
FT                   IPR003343:IPR010916; KEGG: mxa:MXAN_5490 hypothetical
FT                   protein; SPTR: A1ZK61 Cell surface protein, putative; PFAM:
FT                   Bacterial Ig-like domain (group 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27144"
FT                   /protein_id="ADD27144.1"
FT                   /translation="MTYRWFVLLLAALFLAACGGGGAPSINTIEVSPSSASKQVGQTQQ
FT                   FTAVAKDAGGNVISGVTFTWSSSNTAVATVNNSGLATAVAAGTATITASAGGKSGSATF
FT                   TVTNPAPPTIETIEVSPSSASKQVGQTQQFTAVAKDAGGNVISGVTFTWSSSDTAVATV
FT                   NNSGLATAVAVGTATITATAGGKSGSATFTVTPTPTYTVGGEVRYLNGSGLVLALGSQT
FT                   KTISSNGPFTFDTPVQDGTYSVSVQTQPTNPSQNCTVTPSSVTVSGANVTNLVVECSPY
FT                   TKWLASSATDIGNAITTDAQGNVIVAGLSKEVLGDEVGTLALAFPDVVVAKYAPNGSRL
FT                   WVKQFTVGDPSTPGSAESQAKGVATDAAGNIYVVGSAYVASSNAFKGFILKLSPAGAKL
FT                   TSIKLDENTLNVENGLTSVAVVGSDVYVGGYTAGTVPSGTNAGGEDAALYKYDTGLTLQ
FT                   WARQLGSTGSDRITSVAVDASGAVYAAGFAGGALPSKTHLGDTDAFVVKYDNAGTQQWL
FT                   EQFGTAYGDGANAVAVQGSDVYVAGYVTGAYGTGFSYNGGTDLFVTKFSSSGTETWRRQ
FT                   YSPTDPAQINPYGMVADASGNVYIVGDVNVSVDGTATHAGAKDVFILQYLADGTVGWAR
FT                   QQGSTQDEIALAVTLRDSDLYLTGWSKGALDNYTNQGEEDIFVLKYGTDGSKK"
FT   gene            347557..348747
FT                   /locus_tag="Mrub_0368"
FT   CDS_pept        347557..348747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0368"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; SPTR: A7K3E6 Pilin glycosylation protein; PRIAM:
FT                   Glutamine--scyllo-inositol transaminase; COGs: COG0399
FT                   pyridoxal phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis; InterPro
FT                   IPR000653:IPR001597; KEGG: sat:SYN_02688 UDP-bacillosamine
FT                   synthetase; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27145"
FT                   /protein_id="ADD27145.1"
FT                   /translation="MLKEPFIAVPFAPWPYFAPDEIEAATKVLQSGKVNYWTGQEGRLF
FT                   EREFADYVGTKHAIALHNGTVALELALYAMGVGEGDEVITTPRTFIASASAAVMRGARP
FT                   VFADVDPESGLITAETIERAITPRTKAIIVVHLAGWPADMDAIMALAHKHNLWVIEDCA
FT                   QAHGARYKGRSVGSIGHAGAWSFCQDKILTTGGEGGMLTLNDDELWSKAWSFKDHGKSY
FT                   DAVYNRQHPPGFRWLHEDFGTNWRMLEVQSAIGRVILRKLDGWVEQRRANAHYLSERFR
FT                   QIPALRVPEVPAHLHHAYYKYYVYVRPERLKPGWSRDRIMQAVSELGIPCMSGSCSEIY
FT                   LEKAFTRRGWQPAERLPVARELGETSLMFLVHPTLGQAQMQATADAVERVMEQASI"
FT   gene            348828..350333
FT                   /locus_tag="Mrub_0369"
FT   CDS_pept        348828..350333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0369"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; SPTR: A0YZB2 Putative
FT                   sugar nucleotide epimerase dehydratase protein;
FT                   InterProIPR013120:IPR002225:IPR003869:IPR005913:IPR 001509;
FT                   COGs: COG0451 Nucleoside-diphosphate-sugar epimerase; KEGG:
FT                   mgm:Mmc1_2166 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27146"
FT                   /protein_id="ADD27146.1"
FT                   /translation="MVAGSFAVAMVIHLLWAYRGAADAVLLGAYAQIYAKNVGILMLIA
FT                   FVVFAASGFYSRGRAYQSRYKMLVVAQAVLLAYLIFGFAVFMLPLVDPPRSVLFASGFL
FT                   TLGLTLASRAWVHYWDSVEARRKAKASPIPSLIADERIVLVIGGAGYIGSGLLPRLLER
FT                   GYRVRLLDLLLFGKEPIAHVLHHPNLEIIQADFRQVDKVVEAMRGVDTVVHLGGLVGDP
FT                   ACALDENLTIEINLVATRTIAEIAKGMRVRRFIFASTCSVYGASDLVLDERSNLNPVSL
FT                   YARSKIASEQVLRQLQSDDFSVVILRFGTIYGLSGRTRFDLVVNLLTAKAVVDKKITVF
FT                   GGDQWRPFVHVDDAAHAVMLAVEAPKERVHNETFNVGSNEGNMTLGMVGELVKKLVPDA
FT                   ELIDSGRDGDRRNYRVDFSKIRNRLGFEPQWTVEQGIQQVIEALKSGKVRDYRSAMYSN
FT                   VKYLTEGATSDAVKQYYLGWEKSLIQQTYEAKEEQGSATVPQA"
FT   gene            350395..353151
FT                   /locus_tag="Mrub_0370"
FT   CDS_pept        350395..353151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0370"
FT                   /product="Galactose oxidase"
FT                   /EC_number="1.1.3.9"
FT                   /note="PRIAM: Galactose oxidase; PFAM: Domain of unknown
FT                   function DUF1929; Kelch repeat protein; Fibronectin type
FT                   III domain protein; PA14 domain protein; Kelch
FT                   repeat-containing protein;
FT                   InterProIPR011498:IPR015202:IPR003961:IPR011658:IPR 006652;
FT                   SPTR: A8EDL8 Putative galactose oxidase; KEGG:
FT                   mxa:MXAN_5265 kelch domain protein; SMART: PA14 domain
FT                   protein; Kelch repeat-containing protein; Fibronectin type
FT                   III domain protein; PFAM: Kelch motif; Fibronectin type III
FT                   domain; Domain of unknown function (DUF1929); PA14 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27147"
FT                   /protein_id="ADD27147.1"
FT                   /translation="MKAILALPRVFLLVLALAFLGLTGCNTTRPPATPSNFQATPDATP
FT                   RVVLRWEAAAGATDYVLERRTNSGAFAVLGVVTNTDYTDESVDYSTTYTYRLTARNNAA
FT                   ASSPVEQSATTPARPLAAPDAPSNFQATPDDTPKVVLRWTAPERVARYVLERRTRDGSF
FT                   ATLSSTLPASTTEYTDEAVGSGTPYTYRLTPYNSAGSGSQATLQTDTPAYSEPGFTQTA
FT                   SSYSFSDDRPAGQDPGINPLTSPDLGLDVEYFDNPDLTGLFARRIETNINHTFSGQPPR
FT                   PGMGPDTFSIRWTGLITAPASGTYTFTVLADDGVRLWVNDQLLISAWFDQNLTRRSATI
FT                   SLSAGQAYRIKLEYYNQDARGAIKLRWAYPGQSEQVVPPSAFVRHQKARIGYFGPKLPW
FT                   PTVATHAALLPDGRVMTFHGLDPVGKGQGDNYRDYSKHASTQVFVWTPGTPTDAQSQAR
FT                   YDNTRTDLFCSGYVLAANGKLYLAGGNLGYDYTASGGEYGFPAGHKHTNIFDPSTNTWS
FT                   AGPDMTYGRWYPSVITLPNEEMLIIGGNRDQHNGDGDIYRQDWNTIPDVWNPFTNTLRR
FT                   LTGAESIDINGNVLINHFYPWVHVAPNGQVFLSGNYEKWFYINTTGQGSLGPVHSSLVD
FT                   RYYGSSVMYQPGKILILGGGDVQKSNPPGISRGENSAQVIELNPNNQSISVRNVAPMAY
FT                   KRTHVNATLMPDGRIFVNGGNEDGIQFSNATAVYESEIWSPLTETFKRAAEAQCPRTYH
FT                   STALLLLDGTIITMGGGATGGDDLPNLPECDKTKGNEQKVNQLNAEIYYPPYLHNADGS
FT                   LASRPVVQSAPDRISYGQSFALTTDVPATAVERVTLVAFGAVTHAFNMGQRFIELNFTR
FT                   TGPNSLQVTAPASPNLATPGFYQLYVLDGRGVPSEARVVRLRDASLP"
FT   gene            complement(353148..354590)
FT                   /locus_tag="Mrub_0371"
FT   CDS_pept        complement(353148..354590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3111 hypothetical protein; SPTR:
FT                   A6C2D0 Parallel beta-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27148"
FT                   /protein_id="ADD27148.1"
FT                   /translation="MRQLFFLLLVGLITACATDQSAPSPSSSSNQAPSIRILSPSNGAT
FT                   VSGAGTRAEVSISDDKAVTRLTRQVNGGPEQDIAIQPTQSGNIIFWIPLVSGSNTAVIR
FT                   VYDAEGLSASATLNLQVGGSSSGGSGGGSFGTDYGGYTLPSGPTYYVSPSGSNANDGSR
FT                   ERPWATLSFAVQKLKPGDVLRVLPGSYNESVQVTASGTSSQRITIASDIRWGAKLNAQG
FT                   NLFGIDVRGSYVDIVGFEVTNATNSGIISWAPYNRFLFNHVYGIRAQCDSNGGAGVNMS
FT                   SPDSSDGVMLGNLVHDIGDLSAGFCTRIHGIYQGAPRGLVQNNITYRARGFGITSWHAA
FT                   TAVTISNNLSFANLYGGISVGSGDNTRGNRAENFLVANNIVVGNPRGISEEGNTGVNRF
FT                   VNNLVWNNTTNWRLQTSTQQGSLSLDPGFVNFQPDGSGNYTLQSSSPAIDKGITERAPA
FT                   IDFQAKPRLQGSAPDLGPFEVR"
FT   gene            354868..355812
FT                   /locus_tag="Mrub_0372"
FT   CDS_pept        354868..355812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0372"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; SPTR: A1HRC3
FT                   Glycosyl transferase, family 4; InterPro IPR000715; COGs:
FT                   COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase; KEGG: bsu:BSU35530 teichoic acid linkage unit
FT                   synthesis (synthesis of
FT                   undecaprenylpyrophosphate-N-aetylglucosamine); PFAM:
FT                   Glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27149"
FT                   /protein_id="ADD27149.1"
FT                   /translation="MNELLLALLATLTAAVLVGLSLPLARSLGIVDRPGVIKIHTLPTP
FT                   RFGGVGIVASVLLWGYYTQVVAGWALLGLLVIAITGGLDDRFSLSPRLRLLAELVAGVV
FT                   LGMHFWSALGWGGVGLAVVLVLLMSNAVNLIDGMNGLAAGNALISAVGIAILLWSIPAG
FT                   AGLAVILAASLLGFLFWNYPRAKTFMGDSGSLSIGYLLAMLLLMAAAQGGATFGAALMM
FT                   VGFPLYDTAAGIIRRWRRGKPIFDGDRDHTYDRLDQLYLRNPAKTVAVVWLVSGVLVLA
FT                   GLVIGKVDVGMGLVLGVLLAAVLFWGAYRLGSL"
FT   gene            complement(355818..356090)
FT                   /locus_tag="Mrub_0373"
FT   CDS_pept        complement(355818..356090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27150"
FT                   /protein_id="ADD27150.1"
FT                   /translation="MESARPYLLKMHTPTNPLKRFEEAPPKSREALLKLWAALGPRVRT
FT                   ADPTRYYAVQEALELDIPFPVLVLYVFRECRRALEDNPIQERLAE"
FT   gene            complement(356137..357036)
FT                   /locus_tag="Mrub_0374"
FT   CDS_pept        complement(356137..357036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0374"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; SPTR: Q5UXM4 NADH
FT                   dehydrogenase/oxidoreductase-like protein;
FT                   InterProIPR013120:IPR002225:IPR005913:IPR008030:IPR 001509;
FT                   COGs: COG0702 nucleoside-diphosphate-sugar epimerase; KEGG:
FT                   ppd:Ppro_0490 NAD-dependent epimerase/dehydratase; PFAM:
FT                   NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27151"
FT                   /protein_id="ADD27151.1"
FT                   /translation="MKVLIVGGSGYVGTHMAQHLLERGHQVTVASRRGEGPLSGVRYVM
FT                   ADAAKNEGLLEAAQGQEALIYLVGIIRERGDQTFRQAHVDGVRHSLAAAKAAGIARFVH
FT                   MSALGTARGTGSRYYETKAEGEELVQASRLDWTILRPSLIFGQGDEFFGGILKGLVTAP
FT                   IPFIPLIGDGRFVFRPIWVGDVAAAFEQALGRPNTIHRSYNLVGPKEYTFRELLLLVRD
FT                   TLGSRKPLLSIPLTLMDWVVPLISPLPFSPITRDQYLQLKMGNTADPVHMRHAFALEER
FT                   SLETELPKILSAKRLVGA"
FT   gene            complement(357044..357634)
FT                   /locus_tag="Mrub_0375"
FT   CDS_pept        complement(357044..357634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0375"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; SPTR: A4AEI3
FT                   Transcriptional regulator, Crp/Fnr family protein; KEGG:
FT                   scl:sce3757 CRP family global nitrogen regulatory protein;
FT                   COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR001808:IPR000595:IPR012318; PFAM:
FT                   Bacterial regulatory proteins, crp family; Cyclic
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27152"
FT                   /protein_id="ADD27152.1"
FT                   /translation="MKKVRRKEVIYRAGDRADALYHLERGLVRIIEILPDGRQLTLRHV
FT                   LPGDYFGEEVLSERQYKYTAEALTDAAAFAVDPQTLSSDDLRALAASLASQMAQVQAYE
FT                   THLQWGELRSRICRYLLYLAATAAQGQDERGIYVTASHEEIADATASTRESVSKLLSDL
FT                   RHEGILDTGYRKIYLVDRKTLELEAESRMLQAV"
FT   gene            complement(357705..358586)
FT                   /locus_tag="Mrub_0376"
FT   CDS_pept        complement(357705..358586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0376"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; cobalamin B12-binding
FT                   domain protein; SMART: regulatory protein MerR; InterPro
FT                   IPR000551:IPR006158; KEGG: bba:Bd0931 MerR family
FT                   transcriptional regulator; COGs: COG0789 transcriptional
FT                   regulator protein; SPTR: A6GDQ0 B12 binding
FT                   domain/transcriptional regulator, MerR family protein;
FT                   PFAM: B12 binding domain; MerR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27153"
FT                   /protein_id="ADD27153.1"
FT                   /translation="MRNDLGVYTIAEVEERTGLSSALLRQWERRYGFPRPERSPGGHRL
FT                   YSQTDLEALRHIKKWIAEGVAPAQAVRRYLEGLTQEGPRPPEALSMELEEALLRADTEA
FT                   AERTLSEAYRLHPMETVVMEVIAPCLRRIGDGWHLGRVSTAQEHFASTYLRGTLHGLLN
FT                   LMGGSLGPTLVVSTLPGEQHEIGSLITALFLRRAGYTVHYLGPNTPLADLRSFAERTGA
FT                   KAVVLSAVQPVSLESLPHNALRHLAPVVVVGGRAAASDPHLVERLGAYYLGNDPRELAE
FT                   MLSVTLKEAGLW"
FT   gene            358708..359385
FT                   /locus_tag="Mrub_0377"
FT   CDS_pept        358708..359385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0377"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; putative RNA
FT                   methylase; SPTR: Q9HKG9 Putative uncharacterized protein
FT                   Ta0630; InterPro IPR013216:IPR004033:IPR013217:IPR000241;
FT                   COGs: COG2226 Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis; KEGG: mno:Mnod_8065 methyltransferase type
FT                   11; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27154"
FT                   /protein_id="ADD27154.1"
FT                   /translation="MQELSPDQRPKAPLTLAARTNLWPLTALGYEVWRRRALTLLSGRP
FT                   FPLEEELSLMLTRVQPVVGRVFLDLGTSTGLYARALLEAGAARVYALDLSPAMLRVALQ
FT                   KARGHPGFVPLLARAEAIPLPQASVDGVVVGGSWNEFPDPQPVIHELYRVLKPDGRLWV
FT                   MFSHRSQSPLQRLLEAAGLRFPTLSGLMDSLTQSGFKVDGWREGSVGFVAGTKVTMQSS
FT                   VQS"
FT   gene            359421..360254
FT                   /locus_tag="Mrub_0378"
FT   CDS_pept        359421..360254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0378"
FT                   /product="Phytoene synthase"
FT                   /EC_number="2.5.1.32"
FT                   /note="PRIAM: Phytoene synthase; PFAM: Squalene/phytoene
FT                   synthase; InterPro IPR002060; KEGG: afw:Anae109_4080
FT                   squalene/phytoene synthase; COGs: COG1562 Phytoene/squalene
FT                   synthetase; SPTR: P37270 Phytoene synthase; PFAM:
FT                   Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27155"
FT                   /protein_id="ADD27155.1"
FT                   /translation="MRMEPNWQAVSAIIRHHSATFYYGSLLFRGETRKGAWAVYAACRI
FT                   GDDAVDESANPRADLDEWWAGIERAYAGVPREDWEAALAWALARWEIPKQAFADMKEGF
FT                   LADLNPVRLNTLEELYTYCYRVAGTVGLMIAPIGGAGEAGRDAAIKLGQAMQLTNCLRD
FT                   VGEDLALGRVYLPAELMRKYEVSLEDLRQGHISPRYIGLMRELAQEARRLYREGLAGLK
FT                   HLKTGRGAVALAALQYQGILDKLEINGWDNLSRRASLSAYERVMLLPKAIWLRGA"
FT   gene            360320..360532
FT                   /locus_tag="Mrub_0379"
FT   CDS_pept        360320..360532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0379"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; InterPro IPR002145; KEGG: gme:Gmet_A3570 CopG-like
FT                   DNA-binding protein; SPTR: A4BU88 Putative uncharacterized
FT                   protein; PFAM: Ribbon-helix-helix protein, copG family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27156"
FT                   /protein_id="ADD27156.1"
FT                   /translation="MLAIRLPKEIEERLEALAQKTGRSKSYYVRQAILEHLDDLEDYYL
FT                   ALERLEQNLPGIPLDEVERRLGLQD"
FT   gene            360516..360785
FT                   /locus_tag="Mrub_0380"
FT   CDS_pept        360516..360785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0380"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; InterPro
FT                   IPR007712:IPR012753; KEGG: rru:Rru_A3196 plasmid
FT                   stabilization system protein; COGs: COG2026 Cytotoxic
FT                   translational repressor of toxin-antitoxin stability
FT                   system; SPTR: A7BAH6 Putative uncharacterized protein;
FT                   PFAM: Plasmid stabilisation system protein; TIGRFAM:
FT                   addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27157"
FT                   /protein_id="ADD27157.1"
FT                   /translation="MGYRIEFDPRAEGELAKLDREVARRIVRFLRERVASLDDPRSIGE
FT                   ALHGPELGRFWKYRVGDYRLICHIQDQRVTVLVLRIGHRQVVYR"
FT   gene            360827..362359
FT                   /locus_tag="Mrub_0381"
FT   CDS_pept        360827..362359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0381"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG1233 Phytoene dehydrogenase and related
FT                   protein; InterPro IPR003042:IPR000759:IPR006076:IPR002937;
FT                   KEGG: acp:A2cp1_3444 amine oxidase; SPTR: A0YY35 FAD
FT                   dependent oxidoreductase; PFAM: amine oxidase; FAD
FT                   dependent oxidoreductase; PFAM: Flavin containing amine
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27158"
FT                   /protein_id="ADD27158.1"
FT                   /translation="MPDFDVAVVGAGHNALVTAAYLAQAGYRVGVFERRRVPGGAVSTI
FT                   DYQGFRFDLGGSAHILIRLTPVVEELELSRYGLEYLELDPLFHASDARESWFVWRDPER
FT                   TAAELDERYPGQGQAYRRFMRDWLPFAQAVKEAFLASPSPLNLGRKMLWGAGFGRDWQK
FT                   RLPQILRPYGDVAREYFSEERVRAPLVWMAAQSGPPPSDPLSSPFLLWHPLYHVGGVAR
FT                   PRGGSGGLSLALVRAIEAKGGKVHLDSPVAGIVLEGRRAVGLRLADGQSVSARAVVAGA
FT                   HIQKTLALLPADQIPEVARGLRVGNGFGLVLRLGLLEKLCYQTHPGPEARIGLGLLITD
FT                   ELQLSRAYGDYLAGEPTRDPPLIAMSFSAVDETLAPPGGETLWLWAQYYPYRLAAGTWE
FT                   TRAMEAREGVIRSFERFDPAIRRKIVAELVQTPLWLEQEFAMPAGNVMHLEMTPDQMFM
FT                   FRPWLGAHEYRFPGLKGLYLTGASTHPGGGIMGASGRNAARVLLGDLSRNRV"
FT   gene            362480..363673
FT                   /locus_tag="Mrub_0382"
FT   CDS_pept        362480..363673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0382"
FT                   /product="Lycopene beta and epsilon cyclase"
FT                   /note="PFAM: Lycopene beta and epsilon cyclase; FAD
FT                   dependent oxidoreductase; SPTR: A4BXN5 Putative lycopene
FT                   cyclase; InterPro IPR006076:IPR008671; COGs: COG0644
FT                   Dehydrogenase (flavoprotein); KEGG: pub:SAR11_0122 lycopene
FT                   cyclase; PFAM: FAD dependent oxidoreductase; TIGRFAM:
FT                   lycopene cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27159"
FT                   /protein_id="ADD27159.1"
FT                   /translation="MSAAYDYDYIIVGAGAAGLSLAYHLVQAGLHDRRILLLERAPKTL
FT                   NDRTWCFWEVGEGPFEPVVFRRWNRIWFYGEGLSERLEIAPYAYKMIRGLDFYNFMHRW
FT                   MAKQPNVRLHYGEVTRLEEAPQGVRVEAGGQVFTGRWAFSSLYQPAPRQPGYHYLLQHF
FT                   KGWVVRTPRPAFDTGAATFMDFRVPQEGAVRFAYVLPFDARTALVEYTLFSPELLPPDA
FT                   YDAGLRAYLEGPLGLAQYEVLETEFGVIPMTDAPFARRPSPHVMNIGTAGGCTKASTGY
FT                   TFRRIQQQARRIAEALAQTGQPFFPEPTFNRYAYMDSVLLNVLAHRRSPGKQVFSDLFR
FT                   KNPPQRVLRFLDEKTSLLEDLQIMSSVDIPAFLRAALAVGRSRWPLARSGRMEPRRG"
FT   gene            363805..364839
FT                   /locus_tag="Mrub_0383"
FT   CDS_pept        363805..364839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0383"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; SPTR:
FT                   A0ZKY3 Putative uncharacterized protein; InterPro
FT                   IPR007354; COGs: COG2324 membrane protein; KEGG:
FT                   afw:Anae109_4078 membrane protein-like protein; PFAM:
FT                   Protein of unknown function (DUF422)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27160"
FT                   /protein_id="ADD27160.1"
FT                   /translation="MGLALLGAVLLVWGWGGLLGAALAGWGCVLALLAVWGGDLLWAGR
FT                   RVWLVAGGAAALLAGGVGWLFYQSPALGVWALLAATATAQALWLMAQPQARARLGGLRR
FT                   HLQPWMLPLALAVLVRIPVPLWPEGFPLISLVQMLLISLAALLWGWGRVGVRIVLLAVL
FT                   AFALGLGVELLGSQTGFPFGLYSYQGAPQPTIGGVPLIVPLGWFALVLSAHVLAGGRPW
FT                   RTGLLVVAWDLGLEALMPAQGYWAWQDPNPLWYGAPIQNYLAWFAVGYAISWMYRRLGP
FT                   RLHQDGAFAWAYRLEALFLPVGLALLGLWPAALLCGLAMNGLAWLEYLPLGGCGGLKRS
FT                   RGQT"
FT   gene            364836..365525
FT                   /locus_tag="Mrub_0384"
FT   CDS_pept        364836..365525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0384"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; InterPro IPR002123;
FT                   KEGG: mxa:MXAN_0902 acyltransferase domain protein; SPTR:
FT                   A1HTW7 1-acyl-sn-glycerol-3-phosphate acyltransferases;
FT                   PFAM: Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27161"
FT                   /protein_id="ADD27161.1"
FT                   /translation="MMRPWERLLSVAFKALFRRTVQRGLRGVWVRGALPGQACVLAGNH
FT                   HSWWDGYLLPVLFWGGGRPFKIVVGERRLQEFAFFRRLDTVSASKPREALAALGRGEVL
FT                   IVFPEGELRPPGPLGGLNRGVVWFAERAGVSVVPVASRVVLRGHELAEAYLVFGAPIEP
FT                   DLRLLREQLERMLAELDDQIRTAPAEEPLPGFELRLAGRRSTHERMAAWGAALGKLIGL
FT                   AERKGAP"
FT   gene            365530..366618
FT                   /locus_tag="Mrub_0385"
FT   CDS_pept        365530..366618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0385"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; SPTR: A4CTP8
FT                   Putative glycosyltransferase family 2; InterPro IPR001173;
FT                   COGs: COG1215 Glycosyltransferase probably involved in cell
FT                   wall biogenesis; KEGG: met:M446_3158 glycosyl transferase
FT                   family protein; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27162"
FT                   /protein_id="ADD27162.1"
FT                   /translation="MVSILEVLWYGVLAWLGLKLLVLLLNMLFFPVLKREKLRGPRPTV
FT                   SLLVPARNEAHNLRETLPGLLLQGVQEILVLNDHSTDATAQVVEEFSRQDARVRLLAGL
FT                   PKPEGWMGKTWACYQLAQAAQGEVLIFTDADVHWHKRGVRAVLARMERERAGLVSVYPR
FT                   QMTHSLAERVILPLIDDVLLCYLPYPLLRTPFPSASAANGQVMAFTRPAYLASGGHAAV
FT                   RGEVLEDVRLAQKTKGAGQRLALALGGGLVAVRMYRGFAEIVEGLGKNLIEFHGRSRVV
FT                   LALSYMGHLLAYTLCWPLALFNPLWLWVGVLGLLERLLLGLKTGRAWWELVLVPLAPLL
FT                   STPIYWRSAQRKYTWKGREYSR"
FT   gene            366615..367970
FT                   /locus_tag="Mrub_0386"
FT   CDS_pept        366615..367970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0386"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; amine oxidase;
FT                   SPTR: A6DYH8 Amine oxidase; InterPro
FT                   IPR000759:IPR002937:IPR006076; COGs: COG1233 Phytoene
FT                   dehydrogenase and related protein; KEGG: bra:BRADO1614
FT                   hydroxyneurosporene and rhodopin dehydrogenase; PFAM: FAD
FT                   dependent oxidoreductase; TIGRFAM: phytoene desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27163"
FT                   /protein_id="ADD27163.1"
FT                   /translation="MKAIVIGAGFAGLAAALRLRKAGLEVTVLEQFNQPGGKAIGWEGV
FT                   PTGPTVLTLPEIPRRIFAAFGAVLPELKPVSPLTRYTWPDGRVFAPELDLEATLAQLSL
FT                   REARHYQRLLRVARAMYEGARGTFIEGTPPHLAQLLRYALRDGLKAHPTRSLAALVQSG
FT                   PYLTPFFLRFATYLGANPYRAPAVLHNIAWVELGLGVFHLAGGMRALADHLFRLALAQG
FT                   VEFLFGQRVLQMQRLPGRVDALQTDQGWHRADLYISAADRHFTLKWLGLPLPGYALGVS
FT                   GFALLLKLAEAVPLGHHIYFSPDYRAEWQAIAAGRWPQDPTLYLHTDGEAAFLLVNAPP
FT                   MGRAEPPEAEGYARLLLDKLAQVHPLPIAAWRAMSPQDYSLTAYRGALYGRAPHGLLGA
FT                   LRPGWGVAGLRNFAQVGGTVHPGGGVPLSMLSGWNGAGWLLDRTRGGNGLEP"
FT   gene            367954..369090
FT                   /locus_tag="Mrub_0387"
FT   CDS_pept        367954..369090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0387"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; SPTR: A2TU89 Cytochrome P450
FT                   hydroxylase; InterPro IPR001128:IPR002401; COGs: COG2124
FT                   Cytochrome P450; KEGG: mxa:MXAN_2304 cytochrome P450 family
FT                   protein; PFAM: Cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27164"
FT                   /protein_id="ADD27164.1"
FT                   /translation="MGLNLKGASKAGLRGLPQPRGYPWGPLAHLPRWAGEPLALLEEGA
FT                   ALGPIFALGLGRLAVVGYSPEWNRRLLGDLETFRSKGSFSSLVPYLNGGIITTDAPAHR
FT                   ARRQELNPHFHARALGGLEARIRAALQEIRPQGVFEANRWASEVAQTSLNVAYFEGQFP
FT                   KAELARFLAPLKQPFPAPLWPRPLLFARMRRRIGEMQARGLGLAAHLPLEEVLIGLAAG
FT                   YDTTAHTLAWALWHAACYPDWHHPAGHPLLIKETLRLYPPGFIGSRRVARALEFEGIFI
FT                   PQGALALYSPYLTHRHPDLWQNPLVFDPARFEGRIPAWGYLPFGGGERTCLGMHFAQMV
FT                   LGVALSLFGPLEPLQGDPQPRPGLTLAPRGALWLRSGQ"
FT   gene            complement(369084..369647)
FT                   /locus_tag="Mrub_0388"
FT   CDS_pept        complement(369084..369647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0388"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; SPTR: A8CRT4
FT                   GCN5-related N-acetyltransferase; InterPro IPR000182; COGs:
FT                   COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: bca:BCE_2976 acetyltransferase;
FT                   PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27165"
FT                   /protein_id="ADD27165.1"
FT                   /translation="MTLSNTWPRHGKVTLKPFTEALTETEWRRFYECFRDPEIAEWNGS
FT                   RPLRMPLWLFKRVVMGEVSRGDRMGFGILDENGEWLGTVELYEMSRTEATLGILIGAKD
FT                   RWGQGYGTDAVRAVLEYAFCTLRLQKVRLRTYKHNLRAQRAFQKAGFRYLEPPPAPTPR
FT                   FNFGLAPKAEFVPMEITREDWTCY"
FT   gene            complement(369702..370979)
FT                   /locus_tag="Mrub_0389"
FT   CDS_pept        complement(369702..370979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0389"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; SPTR:
FT                   A3RRM9 GdhA; InterPro IPR006095:IPR006097:IPR006096; COGs:
FT                   COG0334 Glutamate dehydrogenase/leucine dehydrogenase;
FT                   KEGG: rso:RSc0480 glutamate dehydrogenase (NAD(P)+)
FT                   oxidoreductase protein; PFAM: Glu/Leu/Phe/Val
FT                   dehydrogenase, dimerisation domain;
FT                   Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27166"
FT                   /protein_id="ADD27166.1"
FT                   /translation="MKSEPLSYLCSDNIGPWEIYLAQVDRVTPYLGKLAFWVEDLKRPK
FT                   RVLIVDVPVQMDDGSVAHFEGYRVHHNTFRGPAKGGIRYHQDVTLSEVMALAAWMTIKN
FT                   AAVGLPYGGGKGGIRVDPRKLSPGEIERLTRRYTSEIGIIIGPDKDIPAPDMGTGAREM
FT                   AWMMDTYSMNVGRTAPGVVTGKPIAVGGSLGRQDATGRGVFVTAAAAAEKIGLPVAGSR
FT                   VAVQGFGNVGNAAARIFHDHGARIVAVSDVTGGIRNDGGIDPYDLTTYVRQMGGVKGYP
FT                   KAEPIPAPEVLTTPCEFLVPAALEKQITEANAWKVQCKIVAEGANGPTTPAADDILAER
FT                   GILVIPDVIANAGGVTVSYFEWVQDFNSFFWTEDEINARLERLMRQSFEAVWQVAQDKK
FT                   VTLRTAAYIVAATRVLEARSLLGLYP"
FT   gene            complement(371021..372295)
FT                   /locus_tag="Mrub_0390"
FT   CDS_pept        complement(371021..372295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0390"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; SPTR:
FT                   P96110 Glutamate dehydrogenase; InterPro
FT                   IPR006095:IPR006097:IPR006096; COGs: COG0334 Glutamate
FT                   dehydrogenase/leucine dehydrogenase; KEGG: ppd:Ppro_1713
FT                   Glu/Leu/Phe/Val dehydrogenase, C terminal; PFAM:
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation domain;
FT                   Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27167"
FT                   /protein_id="ADD27167.1"
FT                   /translation="MPLRNAYRPPGDSSLWDSFLRRLETTIQVARIHPATIQYLTHPKR
FT                   IVGVSLPVVMDDGGVRNFTAYRVIHNIARGPALGGVRYHPEVGLGQTCGMAAWMTLKSA
FT                   VFGLPFGGSAGGVVVEPAKLSRRELERLSRRYVTELIELIGPDEDVLAPDVGTNATVMA
FT                   WFQDTFTMTRGQTTLSAVTGKPTPLGGVAVRDEGGGQGLVYTLADLARAKGWPLDGASI
FT                   AIQGFGQVGSAVARYAVREGLKVVAVSTSRGGVYNPEGLDVAALEQHYALHGHLEGFPE
FT                   AKFITNHELLTLKVNYLVPAAIEGVIHEHNARQIAAEVVIEGANGAITPEAEYLLKLQG
FT                   VQVVPDILANGGGLVLSYLEWVQDLSMLFFEEAEVQQKLREFIHQSLQAVLERAKPLQG
FT                   DLRAGAYALALERINEATRLRGVYP"
FT   gene            372469..372828
FT                   /locus_tag="Mrub_0391"
FT   CDS_pept        372469..372828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0391"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; SPTR: A6ZII7
FT                   Acyl-CoA thioesterase; InterPro IPR006683; COGs: COG1607
FT                   Acyl-CoA hydrolase; KEGG: rpt:Rpal_2645 thioesterase
FT                   superfamily protein; PFAM: Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27168"
FT                   /protein_id="ADD27168.1"
FT                   /translation="MSEARTLELVFPEHANPGGNAFGGFVLGLMDKVGSYAAIRHARKR
FT                   CVTVRVGEVVFEVPIKVGDLLEVVAKVVRVGRTSLTVEVEVYRENLREPKVLATKGNLT
FT                   YVAVDEHGKPTPVEG"
FT   gene            complement(372832..373791)
FT                   /locus_tag="Mrub_0392"
FT   CDS_pept        complement(372832..373791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0392"
FT                   /product="Dimethylallyltranstransferase"
FT                   /EC_number="2.5.1.1"
FT                   /note="PRIAM: Dimethylallyltranstransferase; PFAM:
FT                   Polyprenyl synthetase; InterPro IPR000092; KEGG:
FT                   mpt:Mpe_A0510 dimethylallyltransferase; COGs: COG0142
FT                   Geranylgeranyl pyrophosphate synthase; SPTR: A2WCW1
FT                   Trans-hexaprenyltranstransferase; PFAM: Polyprenyl
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27169"
FT                   /protein_id="ADD27169.1"
FT                   /translation="MSIKDFTPDLPTLLEAFELRLREVVRSEVEFVRLIEEDLVTAGGK
FT                   RVRPRLVFLASNALGGVPYAMELALAVELLHSASLLHDDLVDDAETRRGKEAAFRKYGN
FT                   AVSVLSGDYLLSRLMALLAQTGRMELVAMFAETARQLSEAEVLQFQVAALHDYSLENYE
FT                   RIIDGKTASVMRVACEGAAVLGDAPPAEREALARFGSFYGQAFQMRDDYLDLMGTAEVL
FT                   GKPAGGDVREGKVTLITLRLLEAYPEEVGAIFKRRAAKPGDIARLQELAVRSGADLEVT
FT                   EAIAARVDRAIAALRALPHSAYRDELEALARRELVRIK"
FT   gene            complement(373847..374245)
FT                   /locus_tag="Mrub_0393"
FT   CDS_pept        complement(373847..374245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2394 transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27170"
FT                   /protein_id="ADD27170.1"
FT                   /translation="MKRFIALVIAAFALAGCSNFVTDFGIPTLRFHPVSFGPAAGGYQV
FT                   SFEVQPIPGSPSAYVTRIYINGTPSQLSGFGVAECLPPTTADACPKLAQTLTFAANPGT
FT                   LEITGYQAQSLNGTVRDITLPAPVLINP"
FT   gene            complement(374242..374883)
FT                   /locus_tag="Mrub_0394"
FT   CDS_pept        complement(374242..374883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0394"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; SPTR: Q5SHS3 Redox-sensing transcriptional
FT                   repressor rex; InterPro IPR009718:IPR003781; COGs: COG2344
FT                   AT-rich DNA-binding protein; KEGG: dvl:Dvul_2068
FT                   redox-sensing transcriptional repressor REX; PFAM: CoA
FT                   binding domain; Putative DNA-binding protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27171"
FT                   /protein_id="ADD27171.1"
FT                   /translation="MAKVPSAAISRLVTYLRILEDLEARGINRTSSEQLAEEAQVTAFQ
FT                   VRKDLSYFGSYGTRGVGYTVQVLRRELRQILGLNRRWGLCIVGMGRLGQAIADYPGFSE
FT                   IFELRGLFDRDPSKITTTFRGLQVESMDNLPRAIAERRIEFGLLAVPADSAQAVADRLV
FT                   ESGIKGILNFAPAVLEVPKEVAVENVDFLTGLSRLSFFVLNPKWREEMIG"
FT   gene            complement(374906..375340)
FT                   /locus_tag="Mrub_0395"
FT   CDS_pept        complement(374906..375340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0395"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; InterPro
FT                   IPR007730; KEGG: azo:azo1051 hypothetical protein; PFAM:
FT                   Sporulation related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27172"
FT                   /protein_id="ADD27172.1"
FT                   /translation="MVVGAFGDRENAERLTTTLRQQGYPVGLEAAGNLTRVWVGPYSTQ
FT                   DRARAVAGTLEQYQPQVGRVPTPTPRAETTPEAGRYLQVGAFRKAQSAQAVIEAVRQAG
FT                   YPVVLVEEGGLVKVRVGPLEDTTAAATDLRARGLEVLEVR"
FT   gene            complement(375770..377209)
FT                   /locus_tag="Mrub_0396"
FT   CDS_pept        complement(375770..377209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0396"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_3; SMART: Tetratricopeptide domain
FT                   protein;
FT                   InterProIPR011717:IPR001440:IPR011716:IPR013105:IPR 013026;
FT                   KEGG: rpc:RPC_3120 TPR repeat-containing protein; SPTR:
FT                   A3CV42 Tetratricopeptide TPR_2 repeat protein; PFAM:
FT                   Tetratricopeptide repeat; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27173"
FT                   /protein_id="ADD27173.1"
FT                   /translation="MKQLLCAALLFVSLSWAQQSQPPAIEQTLQQAQAALEAGRLNEAV
FT                   QGFEAVIARDFTNYSAHFGLGLALYRLGDLRGAAFEFTQLTVLDPNRFEGWFNLGVVRD
FT                   RQGQAAEAAEAFGKAIEVGEKAGLGLNELKPAYIGQVKALRTQGQHEAAATAARKALEK
FT                   ASGDLELTSLLADSLVKANKPLEALPVLYQILAKDPANTQAVSQIADIYMAQGLPLRAL
FT                   REIDRGLEAAKDNAVRAQLLLKKSTLQQGREQQATLQEAVRLDPKLWAAHYNLGVARLR
FT                   DGNARGALESFQNAYAQNPDEPRVLLGLATTHDRLGQAAEAARFAEMAAKASQGTDRLE
FT                   ALFLQGKSAYTLRRYSEAAELLSQVTQQKADNAEAWFFLGVAQFNLKDYAAAAESLEKA
FT                   QALAPSAATAANLGAALYSAGRYSDAERVLSQAVTLDGRNAVAWYNLGLTLRSLGRVAE
FT                   ARRAWQRSADLGYAPARDLLR"
FT   gene            377362..377438
FT                   /locus_tag="Mrub_R0006"
FT   tRNA            377362..377438
FT                   /locus_tag="Mrub_R0006"
FT                   /product="tRNA-Met"
FT   gene            complement(377470..378492)
FT                   /locus_tag="Mrub_0397"
FT   CDS_pept        complement(377470..378492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0397"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 2; PRIAM: Isopentenyl-diphosphate Delta-isomerase;
FT                   PFAM: FMN-dependent alpha-hydroxy acid dehydrogenase;
FT                   ferredoxin-dependent glutamate synthase; InterPro
FT                   IPR000262:IPR002932:IPR011179; KEGG: psa:PST_3876
FT                   isopentenyl pyrophosphate isomerase; COGs: COG1304
FT                   L-lactate dehydrogenase (FMN-dependent) and related
FT                   alpha-hydroxy acid dehydrogenase; SPTR: Q9RVE2
FT                   Isopentenyl-diphosphate delta-isomerase; PFAM: Conserved
FT                   region in glutamate synthase; TIGRFAM:
FT                   isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27174"
FT                   /protein_id="ADD27174.1"
FT                   /translation="MSNATDIQTRKRKHLEVCLREPVAYTRLTTGFERYRLRYRALPEL
FT                   ALEEVDLTTRFLGKTLRAPFLIGAMTGGEAHGGRINRALAQAAEQLGVGMMLGSQRVML
FT                   EHPQARASFQVRAVAPNTLLVGNLGLVQLNKGYGLEHLEQAVKLVQADALALHINPLQE
FT                   ALQVGGDTDFRGLLDKLRGLLPQLPFPVVLKEVGHGIGREIAQQLAPLPFAALDVAGAG
FT                   GTSWARVEELVHHGRILHPELVEVGIPTAQALVECRSVLPHQPLIASGGIRNGTEAAKA
FT                   LALGAQVVAVARPLLEPALQGPEAVVAWIKNFLHELRVALFAIGARTPAEALGRIEQVQ
FT                   "
FT   gene            378550..379461
FT                   /locus_tag="Mrub_0398"
FT   CDS_pept        378550..379461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0398"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; SPTR: A9U6K0 Predicted protein; InterPro
FT                   IPR006140; COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase; KEGG: hypothetical protein; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27175"
FT                   /protein_id="ADD27175.1"
FT                   /translation="MIVLVPEAVEARLLQGFPEGVEIAFLPKEGPLSEKALQAEFAVAP
FT                   YGGARRFFAELPNLKELKVVQTLTAGVDWILPYLPPGLVLCDAAGVHDIPVSEWIVAAI
FT                   LSAIKRFPEFRDAQHEQRWAYRWVDDLEGSTVLFLGYGSIARATEERLAPFGVSFLRVA
FT                   RTARPGVHTWAELPELLPKADVIVNLLPYTPQTDKLVGAAQLALMKPGVLFVNAGRGKT
FT                   VDQEALVEAIRAQRVRLVTDVTAPEPLPEGHPLWSLPEVFLTPHIAGSTPKLFERGFRL
FT                   VREQVARYLRGEPLLNVVTDGY"
FT   gene            379451..379918
FT                   /locus_tag="Mrub_0399"
FT   CDS_pept        379451..379918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27176"
FT                   /protein_id="ADD27176.1"
FT                   /translation="MAIDLLLALVFALLAWAMALWVSAEVSLSPAQNRLQSRIHLGLTL
FT                   ATQLLYVWLVQTVGSWRDALLVISVMLALAWYAMLGLTKALRQNTTEKRSLVERLELSG
FT                   HRAFAFTALILMGAGALFALFDPTLALTIALPLGVALFCTLWVTYWVRKSA"
FT   gene            complement(379922..380356)
FT                   /locus_tag="Mrub_0400"
FT   CDS_pept        complement(379922..380356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0400"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; SPTR:
FT                   O32217 Disulfide bond formation protein C; InterPro
FT                   IPR003752; COGs: COG1495 Disulfide bond formation protein
FT                   DsbB; KEGG: bsu:BSU33470 thiol-disulfide oxidoreductase;
FT                   PFAM: Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27177"
FT                   /protein_id="ADD27177.1"
FT                   /translation="MSPMQTQSTPLDRNALLLAFAWLVALVATLGSLYYSEVRNFIPCT
FT                   LCWYQRIAMYPLVLILGLATWRNDVHIRPYALTLSLVGLFWSSYHLLELWVPGLAPNVC
FT                   KGPIPCNVEYIPSFPIPLQAGIAFTLISLALFLLRPTRRS"
FT   gene            complement(380353..381000)
FT                   /locus_tag="Mrub_0401"
FT   CDS_pept        complement(380353..381000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27178"
FT                   /protein_id="ADD27178.1"
FT                   /translation="MTPRDLYPLYRPLASRLHSGEVEGIPYLLQPNCPLLLANTAFGYL
FT                   EAAQKELEARFRAVGAPPAFTVLEGSETSALLASGYQATAAFELCQSEPSPRAHWTEQV
FT                   PWSEAWSIARILTEAYQAPQWRFALAERVGKLLQDPHSQAFVAYLYGDAVGAILTHQNI
FT                   GLLAGVVPPRLGNGVGAALVGRIHPRLFVRLAGTEAELPGRVLSRFIRYALE"
FT   gene            complement(380997..381914)
FT                   /locus_tag="Mrub_0402"
FT   CDS_pept        complement(380997..381914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0402"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; InterPro
FT                   IPR013822:IPR000897:IPR003593:IPR004390; KEGG: noc:Noc_1934
FT                   cell division transporter substrate-binding protein FtsY;
FT                   COGs: COG0552 Signal recognition particle GTPase; SPTR:
FT                   P83749 Cell division protein ftsY; PFAM: SRP54-type
FT                   protein, helical bundle domain; SRP54-type protein, GTPase
FT                   domain; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27179"
FT                   /protein_id="ADD27179.1"
FT                   /translation="MSWLQRLKEGLSKTRDNLVKAIPWGEDPEAVLEELEFALIAADVG
FT                   VEATQEVLEEVRQSGKKDLREALKQALTVQLEPDRFRAKIRKAGFNPNAKKSTVEPAGK
FT                   VILMVGVNGVGKTTTIAKLGQYYQSKGRSVMFCAGDTFRAAGGAQLGLWGERLGIPVIQ
FT                   GPEGSDPAALAFDAASARKARGLDLLLVDTAGRLHTKHNLMEELAKVKRSIAKADPGEP
FT                   GEVWLVLDAVTGQNGLEQAKKFHQTVGLTGVIVTKLDGTAKGGVLVPIVRTLGVPIKFI
FT                   GVGEKADDLQPFDAGEFVEALLGA"
FT   gene            381979..382929
FT                   /locus_tag="Mrub_0403"
FT   CDS_pept        381979..382929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0403"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein; InterPro
FT                   IPR006070:IPR005145:IPR004388; KEGG: rsq:Rsph17025_2463
FT                   SUA5/YciO/YrdC/YwlC family protein; COGs: COG0009 Putative
FT                   translation factor (SUA5); SPTR: A6C3T1 Sua5 related
FT                   protein; PFAM: yrdC domain; SUA5 domain; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27180"
FT                   /protein_id="ADD27180.1"
FT                   /translation="MVVPPTPENLERAAQIIRSGGLVAFPTETVYGLGANALDARAAAR
FT                   IFEAKQRPSFDPLIVHVADRGMLQKVVQEVPALAERLMERFWPGPLTLVLPRSERVPGL
FT                   VTSGLPTVAVRMPAHPVAQELIRRAGLPLAAPSANPFGYLSPTRAEHVERMLGGRVDLI
FT                   LDGGRTEFGVESTIVLLAEKPTVLRYGAVAVEELERVLGRLELQVGAREKPLVPGQLPQ
FT                   HYAPHTPIRIAPPSEIPLGLRKRVGYLAFQEVPKGFKVVKVLSPTGSLLEAAAHLFEAL
FT                   HQLDRLGLEAIYAEPIPEVGLGRAIMDRLRRASSA"
FT   gene            382971..383477
FT                   /locus_tag="Mrub_0404"
FT   CDS_pept        382971..383477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27181"
FT                   /protein_id="ADD27181.1"
FT                   /translation="MRGRNVFLLVLIVAMAVFAWRNWAVFSEEKTLSLFFTQITAPFGI
FT                   VMLTIMAVLVAIYFMYTVGLETAALLEVKRYARELLAARKLADEAEASRFSELKKWLEG
FT                   ELAGLKAQSPTGLEARLQAIAERIDRLEDELREDIEKAGNTLAAYIGELEDQITGQDRH
FT                   PPPPR"
FT   gene            383516..383592
FT                   /locus_tag="Mrub_R0007"
FT   tRNA            383516..383592
FT                   /locus_tag="Mrub_R0007"
FT                   /product="tRNA-Met"
FT   gene            383687..384844
FT                   /locus_tag="Mrub_0405"
FT   CDS_pept        383687..384844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0405"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="PFAM: protein of unknown function Met10; SMART: PUA
FT                   domain containing protein; InterPro IPR003402:IPR002478;
FT                   KEGG: gsu:GSU2626 hypothetical protein; COGs: COG1092
FT                   SAM-dependent methyltransferase; SPTR: A5TUK5 Possible
FT                   methyltransferase; PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27182"
FT                   /protein_id="ADD27182.1"
FT                   /translation="MNRVIAKAGKGKKVRNFYPGLFADELASVPEQAGVVQVYSEEEGF
FT                   LGVGYYDPQSRVAVRVYRFDEGPLDKRFFLQRFERAQKKRAQLDPFHRLVHAEADGLPG
FT                   LVVDRFGGVLVVQVRNRAMEALRAHWLPALIEALQPASIYERSDVDSRRQEGLPERVGV
FT                   LYGEAPSVLEVQEDGLVFQIPLALAQKTGYYLDQRENRRRLEQVVGPGERVLDVYSYVG
FT                   AFALRAARKGAYALAVDKDLDALAVLDRAASMQGLRVDIRQGDAVAVLEDLARGKTPPF
FT                   RHVLLDPPTLVKKPDELPRVKRLLVDLLRPALRLLDREGWLWLSSCAYYLGVDALLEVT
FT                   RRAAADEGRRLRVHAVHYNPPDHPWSLHVPESLYLKTVVFQDDPL"
FT   gene            384971..385363
FT                   /locus_tag="Mrub_0406"
FT   CDS_pept        384971..385363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0406"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; SPTR: Q98BB4 Protein
FT                   apaG; InterPro IPR007474; COGs: COG2967 Uncharacterized
FT                   protein affecting Mg2+/Co2+ transport; KEGG: mlo:mll5649
FT                   ApaG; PFAM: Protein of unknown function (DUF525)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27183"
FT                   /protein_id="ADD27183.1"
FT                   /translation="MSASLPIRNDIHVKVEVVYAQAHSRPGQHVFVYFITLENQGHETV
FT                   QLLRREWFIQDGWGGVVHVEGEGVVGEKPILEPGQLYRYNSFCPLAHPPGLMWGFYTFQ
FT                   NMLGALFRVEIPAFALRLPDAHRTLN"
FT   gene            complement(385360..386103)
FT                   /locus_tag="Mrub_0407"
FT   CDS_pept        complement(385360..386103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0407"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: dal:Dalk_2887
FT                   ABC transporter related; COGs: COG1131 ABC-type multidrug
FT                   transport system ATPase component; SPTR: Q5JDA7 ABC-type
FT                   multidrug transport system, ATPase component; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27184"
FT                   /protein_id="ADD27184.1"
FT                   /translation="MIRLEDLSKRYGSFVALDGLNLEVRPGETLALLGPNGAGKSTTIK
FT                   ALVGLLRPSRGRALVGGVDVWKDPVRAKAQFGYVPDRPYLYGKLSGLELLRFAAGIYRL
FT                   PRAQAEARIEELLVQFRLERFASSLIETYSHGMRQKLSLAMSLLHAPPALILDEPMVGL
FT                   DPHATRLVKDLLREYSKNGRAVLYATHQLHLAEQVADRVALVHRGRLLALGSPKELLHQ
FT                   HGSSDLEEFFLRLTEDASESASVLA"
FT   gene            complement(386188..387504)
FT                   /locus_tag="Mrub_0408"
FT   CDS_pept        complement(386188..387504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0408"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   SPTR: A3ZAV8 Carboxyl-terminal processing protease; KEGG:
FT                   carboxy-terminal protease ; K03797 carboxyl-terminal
FT                   processing protease; InterPro
FT                   IPR001478:IPR005151:IPR004447; PRIAM: C-terminal processing
FT                   peptidase; PFAM: peptidase S41; PDZ/DHR/GLGF domain
FT                   protein; COGs: COG0793 Periplasmic protease; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: Peptidase family S41; PDZ
FT                   domain (Also known as DHR or GLGF); TIGRFAM: C-terminal
FT                   peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27185"
FT                   /protein_id="ADD27185.1"
FT                   /translation="MKRRAWLIVLGGILAALVYAQLSGGVAEAFNRNPYGQALVQTYQL
FT                   LQTQYLTRLEPDQLNRVLEGGIRGMLGALEDEFTSYSPPQRASLRNQDIQGEFFGIGAT
FT                   LAPNENGGGARVQGVIRGLPAFNAGIRAGDIIVEVNGQDVTKLDLNEIVAQIRGPQNTK
FT                   VTIGIRREGTNAILRFEMIRQRVEIISVSKTILPGNVGYVALETFGNVRVIEQLNAALN
FT                   ELKQRGVQKLVFDLRDNGGGLLDQGCQVARAFIREGPIVYTRTRNETRLYCEANGQVTW
FT                   SGPMVVLINGNSASASEIVAGAMQDTGRAKVIGETSFGKGVGQNVIDLANGGDLTLVTF
FT                   EWLTPKRRGINKQGIKPDIEVKDTRFEVPVAFEGTGAKPGETVTITIGGQTFTTKADAQ
FT                   GKFNFSQPRPAVNLPAERGQAEVDLNKDAILRRALEELR"
FT   gene            387614..388300
FT                   /locus_tag="Mrub_0409"
FT   CDS_pept        387614..388300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0409"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR003593:IPR017871:IPR005286; KEGG:
FT                   mxa:MXAN_5748 putative cell division ABC transporter,
FT                   ATP-binding protein FtsE; COGs: COG2884 ATPase involved in
FT                   cell division; SPTR: A7VHN5 Putative uncharacterized
FT                   protein; PFAM: ABC transporter; TIGRFAM: cell division
FT                   ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27186"
FT                   /protein_id="ADD27186.1"
FT                   /translation="MIHFHRVMLEYPRTQTKALFDLNLEIKKGEFVFLVGHSGAGKSSL
FT                   LNLILKRLEPTSGAVYFAGENLKALHGDRIALHRRRIGVVFQDHRLLRDRTVEENLLFT
FT                   LHVLGVPRHEWDLRVTRVLRQVGIVHKKRAYPDELSVGEAQRVAIARALVGDPQVLLAD
FT                   EPTGNLDPANALAVLEIFKLVHARGATVLVATHSRDLVEAYPQRVVVLKAGQLVRDDRE
FT                   GRYSLV"
FT   gene            388485..389036
FT                   /locus_tag="Mrub_0410"
FT   CDS_pept        388485..389036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0410"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA;
FT                   InterPro IPR003489; KEGG: bcz:BCZK4884 ribosomal subunit
FT                   interface protein; COGs: COG1544 Ribosome-associated
FT                   protein Y (PSrp-1); SPTR: Q9RVE7 Protein DR_1082; PFAM:
FT                   Sigma 54 modulation protein / S30EA ribosomal protein;
FT                   TIGRFAM: ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27187"
FT                   /protein_id="ADD27187.1"
FT                   /translation="MNVYKLVGRQIEITEALKNYLDKKMARLDRYFDNNVEAKVVLSMA
FT                   QGPRIERKAKAEIQVNVPGGIVRVEEADPDMYAAIDRSIDRLEYQLKRYKERHFQRARH
FT                   AVPEAVLAGSAHLETEEEAEPRIVRTKRFHMKPMTPEDAAFEMEALGHDFFVFRNADTE
FT                   QINVIYRRRDGNYGLIEPTA"
FT   gene            389067..389651
FT                   /locus_tag="Mrub_0411"
FT   CDS_pept        389067..389651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0411"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="SPTR: A3IXJ8 Cobyrinic acid a,c-diamide synthase;
FT                   COGs: COG1192 ATPase involved in chromosome partitioning;
FT                   KEGG: pna:Pnap_4776 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27188"
FT                   /protein_id="ADD27188.1"
FT                   /translation="MRILVTSLKGGVGKTTTAVHLAAFLRLRGPTLLIDADPAQGALVW
FT                   ARQGPGLPFEVAGPEEARPKRFEHVVIDTAGHPKGKTLREYAGKADLVVVPTSPGLLSL
FT                   ASLQQFLPMLSDLPWRVLVTLVPPFPSLEGVRAFAYLRARSIPHFKHAVHRLAAYEKAV
FT                   LAGTLVQNVPDPRAVRAWEEYVLVGREMLKR"
FT   gene            complement(389704..390864)
FT                   /locus_tag="Mrub_0412"
FT   CDS_pept        complement(389704..390864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0412"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; SPTR: A7CZ85
FT                   Aminotransferase class I and II; InterPro IPR004839; COGs:
FT                   COG1168 Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities; KEGG: csa:Csal_3036 aminotransferase, class I
FT                   and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27189"
FT                   /protein_id="ADD27189.1"
FT                   /translation="MQLDELSPRTLRDPYGYSGKWHFYPADVLPMWVADMDFPISPAIT
FT                   QAIVERLQERVGYPQMKGDGLLLERIIQQQSQFGLEGLTPENLLLTTSVVPAIYASVLA
FT                   LSSPGDEVITQVPVYPPFLNALSEHHRIARHNPLQPTPSGWEIDFDQLERLVTPRTRLL
FT                   LLCNPQNPTGRVFRRDELERLAEFALRHRLWVMSDELWADLIYEGQHIPIASLSPEIAQ
FT                   RTVTLTGPCKSYNTAGLGGGVAISHNKQILSAMAQVSKGLGGHPNVLAMAAWRAALEHA
FT                   QDWLQQVRAYLKGNRDLVTGFMQQRLPQVGYRPPQGTYLAWLDFSQTPLAQEAHKIMLE
FT                   QAKVGLNDGRMFGPQYQGWLRLNFATSRSLVQEALERIARVVQAVD"
FT   gene            complement(390915..392036)
FT                   /locus_tag="Mrub_0413"
FT   CDS_pept        complement(390915..392036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0413"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein;
FT                   InterPro IPR000160; KEGG: dvm:DvMF_2637 diguanylate cyclase
FT                   with extracellular sensor; COGs: COG2199 FOG: GGDEF domain;
FT                   SPTR: A6CMH3 Diguanylate cyclase (GGDEF domain); PFAM:
FT                   GGDEF domain; TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27190"
FT                   /protein_id="ADD27190.1"
FT                   /translation="MLPRPAPDPYVTLEVADPLETLRIRLTLWLLPLGAGAALTAWGLS
FT                   VTSNKLSLPDQYLLLPMAVGFIALEFHLWRNPQNVRWVWQIALALIAIYEIVSLFYEAA
FT                   YKLHQRDGITPAALWFPMVYLMAFNLLNRRQALRFSLVYLVLGLLAGAVGMLMSPSINV
FT                   SSINTALQFTFSNIAYLALLYMFAYLRRHYAQMHQMAHTDALTNLTNRRAMQQKLEGEL
FT                   DRARRYNRPFALLLADLDHFKQINDTYGHSVGDQVLREVAGRLAQHLRESDSLARWGGE
FT                   EFLILAPETDLQQAYLLAQRLLGAIRESPISGVQVTLSLGVACYRQGDSIAALLSRADE
FT                   AMYRAKAGGRNQIVLEEELEDIVIPSHSTTPEL"
FT   gene            392204..392851
FT                   /locus_tag="Mrub_0414"
FT   CDS_pept        392204..392851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0414"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PRIAM: Ribonuclease H; PFAM: ribonuclease HII/HIII;
FT                   InterPro IPR001352; KEGG: noc:Noc_2022 ribonuclease H;
FT                   COGs: COG0164 Ribonuclease HII; SPTR: Q5SLU5 Ribonuclease
FT                   HII; PFAM: Ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27191"
FT                   /protein_id="ADD27191.1"
FT                   /translation="MSALESDWWKLGLRVAGVDEAGRGALAGPVVAAAVILPPPKEPAL
FT                   YPFRDSKTLTPRAREHLAEQVRAVALAWGVGWAEVAEIDRLGILRATHLAAARALEQLK
FT                   VSPEALLTDYLRLEQEWQQYLRNNPSRPDAPHLLRAPPKADRHSPTVAAASILAKVARD
FT                   RYMEALEQRYPGYGFAQHKGYGTTLHLRALKALGPCGAHRRTFAPVAQTGLF"
FT   gene            392910..393404
FT                   /locus_tag="Mrub_0415"
FT   CDS_pept        392910..393404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27192"
FT                   /protein_id="ADD27192.1"
FT                   /translation="MRAKLGLVLLVVLISACFPTRSSLTVGLRFGVELSPVITRFEPDR
FT                   GVAAGYRVGDSVSFIISLARPGYVVLVGIDPDGVAYEFDRVFLNPGTHRLSGPPGFRYE
FT                   VRPPLGLQRVRAIYTDTPHPSGFVFRGTYSLALWDQQTSIYIQRSGSRVRDVAETYFYI
FT                   R"
FT   gene            393643..394725
FT                   /locus_tag="Mrub_0416"
FT   CDS_pept        393643..394725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0416"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   SPTR: A3IP83 Extracellular solute-binding protein; InterPro
FT                   IPR004682:IPR006311; COGs: COG4663 TRAP-type
FT                   mannitol/chloroaromatic compound transport system
FT                   periplasmic component; KEGG: xau:Xaut_3328 TRAP
FT                   dicarboxylate transporter-DctP subunit; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27193"
FT                   /protein_id="ADD27193.1"
FT                   /translation="MKRRDFLKKAGVGAVAASTVFGPVYAQTLPRLRWRMATSWPRSLD
FT                   TLFGAAEIVARRVAEMTDGRFEITPYPAGEIAPGLQVLDVVQAGNVEMGHTANYYYVGK
FT                   SPSLAFDTGVPFGLNPRQQNAWLYFGGGLQAMQRVAADFNVITFPAGNTGVQMGGWFRR
FT                   EIRGPEDLRGLRFRIPGLGGQVMARLGVTVQTLAAGEIFLALDRGAIDAAEFVGPYDDE
FT                   KLGLNKAARFYYYPGWWEPGSTVSTLINLERWRSLPKEYQEIVKAACAEANDRTIAEYD
FT                   AKNAPALARLQRAGTQLRPYPSSVLQAANREATALYEEIAAKDTTYRGIYENWKKFRDE
FT                   SRRWFALNEFRYDDFVRTLR"
FT   gene            394865..395422
FT                   /locus_tag="Mrub_0417"
FT   CDS_pept        394865..395422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0417"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; SPTR: A0YPZ6 Tripartite
FT                   ATP-independent periplasmic transporter, DctQ component;
FT                   InterPro IPR007387; COGs: COG4665 TRAP-type
FT                   mannitol/chloroaromatic compound transport system small
FT                   permease component; KEGG: tbd:Tbd_2150 TRAP transporter,
FT                   small subunit; PFAM: Tripartite ATP-independent periplasmic
FT                   transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27194"
FT                   /protein_id="ADD27194.1"
FT                   /translation="MKALLLIARLIDGLNEWVGRVTLWLVVPMIAIGAYNAIGRSLDKS
FT                   LGTRLASNTYFELQWYLFSLIFLLMVGYVLKHNGHIRVDVIYARLDDRGRAWVNMLGSI
FT                   LFVVPFAVLLFYVSLPLVAFSIQVREVSLDAGGLPRWPLKLMLLPAFVLLALQGLSEFI
FT                   KNLAYLRGALPRPPYEAEGEVA"
FT   gene            395423..396847
FT                   /locus_tag="Mrub_0418"
FT   CDS_pept        395423..396847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0418"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; InterPro IPR010656:IPR004681; KEGG:
FT                   bav:BAV1578 C4 dicarboxylate tripartite ATP-independent
FT                   periplasmic (TRAP) transporter, permease component; COGs:
FT                   COG4664 TRAP-type mannitol/chloroaromatic compound
FT                   transport system large permease component; SPTR: A0ZHL6
FT                   Putative uncharacterized protein; PFAM: DctM-like
FT                   transporters; TIGRFAM: TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27195"
FT                   /protein_id="ADD27195.1"
FT                   /translation="MVLSGGGVELLGGAMFIAALVLIFTGYPVAFALGGVALIFGAIGI
FT                   GLGEFDIRFVGSLPQRIFGIMSNYTLLAIPYFIFLGLILEKSKLAEQLLDTVGQLFGPI
FT                   RGGVAIAVVLVGTLLAATTGVVAATVVAMGLISLPVMLKYGYSRPLATGVIAASGTLGQ
FT                   IIPPSIVLVVLGDQLGISVGDLFLGALIPGLILSGGLVVLVALVALFRPKLAPALPPEA
FT                   RPYQGWELARRALVALVPPVLLIVFVLGSIFFGIATPTEAGAVGSIAALLMAASYRRLT
FT                   WKVFYDAVVETARFTSMVIFILIGATAFSLIFRGLEGDKLVKDILVALPGGEIGFIVFV
FT                   MVMVFILGFFIDFFEICFIVVPLVLPAATAIWTAQAEALQMAGHYDLSTEAFVQQKLLW
FT                   FGIVLAMNLQTSFLTPPFGFALFYLRGVAPPEVKTTEIYKGVIPFIIVQLIVLVIVIAF
FT                   PSLSSWLPSLRGVPGG"
FT   gene            complement(396844..397806)
FT                   /locus_tag="Mrub_0419"
FT   CDS_pept        complement(396844..397806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0419"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; SPTR:
FT                   A3RR72 Quinone oxidoreductase; InterPro
FT                   IPR013154:IPR013149:IPR002364; COGs: COG0604 NADPH:quinone
FT                   reductase and related Zn-dependent oxidoreductase; KEGG:
FT                   sus:Acid_7430 alcohol dehydrogenase; PFAM: Zinc-binding
FT                   dehydrogenase; Alcohol dehydrogenase GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27196"
FT                   /protein_id="ADD27196.1"
FT                   /translation="MKAIRVHQPGGLEALQLEEIPVPTPGEGQALVRLQAIGVNFIDTY
FT                   KRSGLYSVPTPFTVGEEGAGVVEAVGPGVAGVKPGDRVVYSNVQGSYAEYAVVPADKLV
FT                   QIPDGLEAKIAVAGMLQGMTAHYLVYSTYPLKAGETCLVHAGAGGVGLLLIQMAKQIGA
FT                   TVIATASSEGKRALAKEAGADYTLPYEGFDQKAREITGGKGVDVVYDGVGQSTWEGSLN
FT                   SLRIRGMLVLYGQSSGPVPPFNPQVLNQKGGLYLTRPSLWHYTQTREELEWRAGDVMRW
FT                   ALEGRLKIRIGAEFPLAQAAQAHRALQSRETTGKVLLIP"
FT   gene            complement(397809..399344)
FT                   /locus_tag="Mrub_0420"
FT   CDS_pept        complement(397809..399344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0420"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   SPTR: P40406 Uncharacterized lipoprotein ybbD; InterPro
FT                   IPR001764:IPR006162; COGs: COG1472 Beta-glucosidase-related
FT                   glycosidase; KEGG: cvi:CV_0259 glycosy hydrolase family
FT                   protein; PFAM: Glycosyl hydrolase family 3 N terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27197"
FT                   /protein_id="ADD27197.1"
FT                   /translation="MEKLFLATSLMMVDIPGPTLDAATRAHLERYRFGGVCLFRKNIQN
FT                   PEQVRQLVAEIRAVLGPQAWIAIDQEGGAVQRVLEFALAPSPMALGAVGEVKTAEAVGA
FT                   AVGRALISLGINWNFAPSVDVNTNPQNPVIGDRSFGSDPKKVARLSLAWARGLEQAGVM
FT                   AAIKHFPGHGDTFLDSHLELPVVNKTLEELERTELYPFRKAVEAQISSIMSAHIRFPAL
FT                   DKQHPATLSKKILTGFLRKKLGFQGIIVTDALDMKAISKNYPIGEAAVKSLQAGADMIL
FT                   SLGQPEVHIAQATAIQQALENGSLSEEQARQSQLRLLEAALRFPGQAQPYPPAQQKRDQ
FT                   ALMEQVALRSITAYRRPLRPRRSDRILLVSAGSTFEAGPYGETLAVKDFADLLKTRFAG
FT                   VSQFVYDPQQADAFKSGLEQAAATADYLLVVSVGRGRLSEAETRLLKQAFTLGKRAAHI
FT                   ALWNPYHILSLRKPAFVTYGFRAPTLRALVKVLGGARARGSLPFKLRQNRVSL"
FT   gene            399831..400928
FT                   /locus_tag="Mrub_0421"
FT   CDS_pept        399831..400928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0421"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PRIAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase; InterPro
FT                   IPR006680:IPR003764; KEGG: cvi:CV_0556
FT                   N-acetylglucosamine-6-phosphate deacetylase; COGs: COG1820
FT                   N-acetylglucosamine-6-phosphate deacetylase; SPTR: A8CV72
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   Amidohydrolase family; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27198"
FT                   /protein_id="ADD27198.1"
FT                   /translation="MAQLVGTLITPSLSYPGRIAFAERIEALEPLDADQGSPERFILPG
FT                   FIDLHVHGGDGADCMDGEQAVRRMARFHARHGTTALLATTVTAPLEELEAALRGIAAVV
FT                   QNPGPGEARVLGVHLEGPFISPERLGAQPPYALEPSIETMRYLLSLAPIRVVTLAPERP
FT                   GALELIRFLSEQGVRVQQGHTAATYAQALAGFEAGAQGFTHFYNAMTPLHHREPGVVGL
FT                   GLERARWAEIIPDGLHVHPAVIRALARAIPQTYAVTDAVAAAGRPEGEYRLGRHRVYKK
FT                   SQGVFLADGTLAGSALTMDRAAYNLRCWGYTVPEVMQMTSSFAAQYLGIPHGLEIGQPA
FT                   DLVVLDEQARLVEVYVRGQKVEVSG"
FT   gene            400925..401968
FT                   /locus_tag="Mrub_0422"
FT   CDS_pept        400925..401968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0422"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PRIAM: Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing); PFAM: sugar isomerase (SIS); SPTR: A3LEL0
FT                   Putative uncharacterized protein; KEGG: sml:Smlt4021
FT                   putative phosphosugar-binding protein; COGs: COG2222
FT                   phosphosugar isomerase; InterPro IPR001347; PFAM: SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27199"
FT                   /protein_id="ADD27199.1"
FT                   /translation="MRAVETKMFKEAHQAPAVVEQALRENKSEMELLGTFLRRHTPPFA
FT                   LTVARGSSDHAALYGKYLIESLLGLVCSSAIPSVHTVYGQRLALSRALVIAISQSGQSP
FT                   DLIEVTRQARREGALTLALVNQEHSPLAQTAEVVLPLWAGLEEAVAATKSYLAALASLA
FT                   QLVAAWAEDKPLKEALARLPEAMYKAAEANWQAGLEPLVEAENGLVVGRGYAFAVANEL
FT                   ALKLKETSAFHAEAMSGAELLHGPVALVEPDFPLLVLAPKDKPLPGMLSLLENLRSKGG
FT                   HLLVASSESEALELAHTPLPLPGRLHPVLDSILLAQAFYPFAAELSVARGFDPDAPRNL
FT                   SKVTRTR"
FT   gene            401997..402869
FT                   /locus_tag="Mrub_0423"
FT   CDS_pept        401997..402869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0423"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PRIAM: 3-hydroxybutyryl-CoA dehydrogenase; PFAM:
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; InterPro
FT                   IPR006176:IPR006108:IPR006180; KEGG: bcy:Bcer98_3864
FT                   3-hydroxybutyryl-CoA dehydrogenase; COGs: COG1250
FT                   3-hydroxyacyl-CoA dehydrogenase; SPTR: Q9RVG1 Probable
FT                   3-hydroxybutyryl-CoA dehydrogenase; PFAM: 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain; 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27200"
FT                   /protein_id="ADD27200.1"
FT                   /translation="MEIRKIGVIGAGQMGAGIAQVAAQAGYTVVLRDLEQAFLERGLSS
FT                   IKRSIGKLLEKGKLDQQAHDAALARITTTTHLSDLNDCDLVIEAIVEHEPTKLELFREL
FT                   DALLQPAAILASNTSSIPITRLASATRRPERFIGMHFMNPVPLMELVEVIRGHLTDEAT
FT                   TQAVLEVARRMGKTPVEVNDYPGFVSNRILLPMLNEAIQCVMEGVATPEAIDQVMKLGM
FT                   NHPMGPLTLADFIGLDTCLSIMEVLHRGLGDDKYRPSPLLRKMVQAGLLGRKSGRGFYR
FT                   YDEKGNKIG"
FT   gene            402866..403525
FT                   /locus_tag="Mrub_0424"
FT   CDS_pept        402866..403525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet3506 hypothetical protein; SPTR:
FT                   A6FQE3 Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27201"
FT                   /protein_id="ADD27201.1"
FT                   /translation="MTRLDHLVLAAQTLQEGVEYVQDTLEVVLPPAGGRHPLMGTHNRL
FT                   LNLGGGVYLEIIAIDPQAPAPGRPRWFELDRFTGPPRLLTWVARTEALERYAALGLGPV
FT                   TKASRGDLEWHITLPEDGRLHWGGVVPYLIEWGARHPTDTLPDTGCRLLAWKLLHPQPG
FT                   AVAPVLQQLGLVYSLEVSFHPGLWALLQTPAGRKVLFSQAGGSAGRKTGPASPEIG"
FT   gene            complement(403464..404372)
FT                   /locus_tag="Mrub_0425"
FT   CDS_pept        complement(403464..404372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0425"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27202"
FT                   /protein_id="ADD27202.1"
FT                   /translation="MDSEHQAQLEAEALSRRVLVHDILRRLRGQPNDLLPYSAVSSLRP
FT                   RGESYKGLQTIEVDKIIGSVDRYGDFDAEFMPKEPFTLDRWTKLRQAQLEGVEFPPIHV
FT                   YKVGDAYFVKDGNHRTALAKAQGQHYIDAYVIELEVPVDLDPDDTLKDVILKGEYAAFL
FT                   EQTRLPELRPHHEPILFSRPGRYDVLLDHIRTHQYFMGLDQKRSIGWEEAVADWYDNLY
FT                   LPTILEIRENGVLKNFPGRTEADLYLWISDHRYFLSQAIGHDVGPEEAALSVQRSVQKG
FT                   PISRFLDWLGRFFVRQSPQPG"
FT   gene            complement(404595..405203)
FT                   /locus_tag="Mrub_0426"
FT   CDS_pept        complement(404595..405203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0426"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; InterPro
FT                   IPR001808:IPR000595:IPR012318; KEGG: mag:amb2324
FT                   cAMP-binding protein - catabolite gene activator and
FT                   regulatory subunit of cAMP-dependent protein kinase; COGs:
FT                   COG0664 cAMP-binding protein - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinase;
FT                   SPTR: A3ZXR8 Transcriptional regulator; PFAM: Bacterial
FT                   regulatory proteins, crp family; Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27203"
FT                   /protein_id="ADD27203.1"
FT                   /translation="MQTSILDTLTFDPGEIILYPGEPSPKDQLYRVREGLVRLQSVDDE
FT                   GNALTLRFVRPGEYFGEEVISGAERTYFAEAVTETKVDALAPGQLSAQEMHELVQGLVR
FT                   ALSQTYQTIQRISGQRLKNRIAATLLELSRTPVAFMEKNGRIGVRATHDEIASAVGSVR
FT                   ETVTKVIGELTREGYIRSGYGKLVLENPSGLERLSKEAA"
FT   gene            complement(405366..406274)
FT                   /locus_tag="Mrub_0427"
FT   CDS_pept        complement(405366..406274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0427"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   SPTR: A3U9J6 Magnesium and cobalt transport protein;
FT                   InterPro IPR002523; COGs: COG0598 Mg2+ and Co2+
FT                   transporter; KEGG: pca:Pcar_2713 magnesium and cobalt
FT                   transport protein CorA; PFAM: CorA-like Mg2+ transporter
FT                   protein; TIGRFAM: magnesium Mg(2+) and cobalt Co(2+)
FT                   transport protein (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27204"
FT                   /protein_id="ADD27204.1"
FT                   /translation="MVRAKQLSDGAPCGLLETQVWVDVETPTPEELALIGKQYPLNPLA
FT                   LADAQEIGHWSRFEEYPKHLFLIFRTLETPHNAHSRTERVSYFYFPETQVLLTYRNEPV
FT                   DYLEQIWNSFRGGSCLRLWQRLLDQGVQTFFEYTDAITDRVEDLEELALNGDNTPEIPR
FT                   RVFSARREVLRTRRLVSQAREALLHLERLPLWGLEAYLFRDLTDRMGRVYEGLDAARDE
FT                   LSNVLEVYLSAQNNRLNRVVQALTVISVLFLPMTLWAGIYGTNFEAFTEYQWPAGRIYF
FT                   WSGLLLIGGGLALWMKRRGWW"
FT   gene            complement(406367..406678)
FT                   /locus_tag="Mrub_0428"
FT   CDS_pept        complement(406367..406678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0428"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; SPTR:
FT                   Q7SIA8 Divalent-cation tolerance protein cutA; InterPro
FT                   IPR004323; COGs: COG1324 conserved hypothetical protein
FT                   involved in tolerance to divalent cations; KEGG:
FT                   noc:Noc_1056 CutA1 divalent ion tolerance protein; PFAM:
FT                   CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27205"
FT                   /protein_id="ADD27205.1"
FT                   /translation="MYLTVFCTVPDLETARRIAHTVVHEGLAACVNLLPGLTSVYRWQG
FT                   QVEESSELLLIIKTRQERFEALEERIQALHPYQVPEIIALAIERGSASYLDWIAESTR"
FT   gene            complement(406689..407585)
FT                   /locus_tag="Mrub_0429"
FT   CDS_pept        complement(406689..407585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0429"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; SPTR:
FT                   A7CCY5 Ornithine cyclodeaminase/mu-crystallin; InterPro
FT                   IPR003462; COGs: COG2423 ornithine cyclodeaminase
FT                   mu-crystallin homolog; KEGG: rpi:Rpic_3546 ornithine
FT                   cyclodeaminase/mu-crystallin; PFAM: Ornithine
FT                   cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27206"
FT                   /protein_id="ADD27206.1"
FT                   /translation="MRILTAEETAQALPYPALAQAIAGVLEARAQGTVQAPERLVMPLA
FT                   GGATLLLMPATDPRITVTKLVTVHPQERPSVRAEVWVMRTDTGERLALLDGAVVTARRT
FT                   AAISLLAAQTLAPHPTGTLLIIGAGVQARSHLEAFQEGLGTDKVYVYSRHFEHAEALAS
FT                   YARGRGLLAQAVRSLEPVLEEVRLIVTATTSPTPVLLQAPPGAFIAAVGAYRPEMAEVA
FT                   PQVVRQARLYVDTLEGARSEAGDLLQAGVDWGQVQPLEAALHQPRPASGTVLFKSVGHA
FT                   LWDLAAARLAVQSLGIR"
FT   gene            complement(407595..408050)
FT                   /locus_tag="Mrub_0430"
FT   CDS_pept        complement(407595..408050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0430"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; SPTR: A6BK61
FT                   Putative uncharacterized protein; InterPro IPR005302; COGs:
FT                   COG2258 conserved hypothetical protein; KEGG: sun:SUN_0055
FT                   hypothetical protein; PFAM: MOSC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27207"
FT                   /protein_id="ADD27207.1"
FT                   /translation="MPQLLSLHAGLAPSLPKPALLQVRLVEGQGVEGDRHFGRHPDRAV
FT                   LVAGQTSYAKAHQAGIELPWGALGENLLVDFDPHALGPHSRLKIGTAVLELTTVCTVCD
FT                   TLSAFDLRLPKVLYNARGVYARVLQGGLVRVGDPVEVLTPDSLLRMG"
FT   gene            complement(408052..408750)
FT                   /locus_tag="Mrub_0431"
FT   CDS_pept        complement(408052..408750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0431"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; InterPro
FT                   IPR003088:IPR009056; KEGG: bmj:BMULJ_04933 class I
FT                   cytochrome c; SPTR: P04164 Cytochrome c-552 (Fragment);
FT                   PFAM: Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27208"
FT                   /protein_id="ADD27208.1"
FT                   /translation="MKKTFVWPWVGLCAALFLALGQAQLPEGPGKTLLEQKCAVCHGLE
FT                   VVTSQRLNASDWDFIVGQMIGFGAQVSPEERKTIVAYLAENFGPQSSAPTAPQTTSSTA
FT                   SPSQAYAVCQGCHQPNGAGVAGAFPPLAGHVADILNAKGGRAYLPLVIVNGLQGSIRVG
FT                   ATNYNTPMPGFPSLSDAQLADLLNYIATAWGNDRLLKDFKPYTADEVKGLRKQMTPAQV
FT                   YAERAKLELK"
FT   gene            complement(408904..410133)
FT                   /locus_tag="Mrub_0432"
FT   CDS_pept        complement(408904..410133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0432"
FT                   /product="Sulfite oxidase"
FT                   /EC_number="1.8.3.1"
FT                   /note="PRIAM: Sulfite oxidase; PFAM: oxidoreductase
FT                   molybdopterin binding; Mo-co oxidoreductase dimerisation
FT                   domain; InterPro IPR008335:IPR000572:IPR005066:IPR006311;
FT                   KEGG: oca:OCAR_6288 twin-arginine translocation pathway
FT                   signal; COGs: COG2041 Sulfite oxidase; SPTR: A6AZ59
FT                   Twin-arginine translocation pathway signal; PFAM: TAT
FT                   (twin-arginine translocation) pathway signal sequence;
FT                   Oxidoreductase molybdopterin binding domain; Mo-co
FT                   oxidoreductase dimerisation domain; TIGRFAM: Tat
FT                   (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27209"
FT                   /protein_id="ADD27209.1"
FT                   /translation="MKDKDLEQLEMDRRTFLKTTAAVGAAGLMGSSFAQQQPTADALVA
FT                   GKDRGLIVRNTNPIELETPVSLLRQNPITPKSVMYIRNNQPVPAGMTPTTDPPQVSDWT
FT                   VEVTGLVDRPTTLRLSQLRTLPATELEMVLQCSGNGRSFFSRYARASGAQWERGSMANV
FT                   RWKGVKLSSLLEAVGIKAEARFLTAEGADQPANPNAPDIERSIPLSDILANGMLVYEMN
FT                   GEPLPTIHGGPLRLIIPGYYGINNIKWVNKLRLEAAPSNNNTMIPRYRVPNNPIAVGSN
FT                   FQFTLENSRPNWRQNVKSVIFSPTEGEAVSGLIDVTGVAWNDGSAPITSVEVSTNQGRS
FT                   WQAATLERPSSPYGWYRWRIRVLVAAGDSEIWSRATDALGRSQPIDGAIFWNPNGYEWN
FT                   AVDKVKIRVG"
FT   gene            complement(410233..411867)
FT                   /locus_tag="Mrub_0433"
FT   CDS_pept        complement(410233..411867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0433"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   InterProIPR013507:IPR003594:IPR014790:IPR014762:IPR 014763;
FT                   KEGG: acr:Acry_0628 DNA mismatch repair protein MutL; COGs:
FT                   COG0323 DNA mismatch repair enzyme (predicted ATPase);
FT                   SPTR: Q9RA54 DNA mismatch repair protein mutL; PFAM: DNA
FT                   mismatch repair protein, C-terminal domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; MutL C
FT                   terminal dimerisation domain; TIGRFAM: DNA mismatch repair
FT                   protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27210"
FT                   /protein_id="ADD27210.1"
FT                   /translation="MIRKLPPELIREIAAGEVISGPADVVRELLENALDAGATRLYIEL
FT                   WGGGLDKIVVRDNGLGIPREELGLALEHHTTSKLTDLQNIRTLGFRGEGLWAIRQAARV
FT                   RLTSRPPQQLGGATLTAFQDKTELHEHPAPAGTQVEVTALFCHLPARRNALEAPAAEGR
FT                   KVVHLVSRYLLHRPEIALRLVVDGEEKIAHAGGGFAEVIKLLWGSVVANRLLPLEAAEG
FT                   PFTLRGLLSRPELSRPRRDRLLLALNRRPVEWPEPLLQAVLAAYKELLPAGQFPVGVLN
FT                   LEIPTEHLLINTSPDKSRVRLIRPEAILGFVSQAVQGLLSAHPLARALPEPAPLTGPAP
FT                   VQRVRFPRLRYLGSFRELYLLAEAGDELYVVDQHAAHERILYEELSRRYLEEPPLELPH
FT                   PELLSLSLGEEMNLAERLEALEQAGLQIEPFGPGKYRVRTIPAFLAGYPSLVGEVVKGS
FT                   LGASSFAVAWRTVLARLACLPAIKAGHPLSSASAQALLDALAGCELPWVCPHGRPTVLV
FT                   LGEGELARRFGRRGVRAVVDPSPHRSE"
FT   gene            complement(411864..414425)
FT                   /locus_tag="Mrub_0434"
FT   CDS_pept        complement(411864..414425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0434"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS II domain
FT                   protein; MutS IV domain protein; MutS III domain protein;
FT                   SMART: DNA mismatch repair protein MutS domain protein;
FT                   MutS III domain protein;
FT                   InterProIPR007860:IPR000432:IPR007861:IPR007696:IPR
FT                   007695:IPR005748; KEGG: sus:Acid_4760 DNA mismatch repair
FT                   protein MutS; COGs: COG0249 Mismatch repair ATPase (MutS
FT                   family); SPTR: P61671 DNA mismatch repair protein mutS;
FT                   PFAM: MutS domain III; MutS domain V; MutS domain II; MutS
FT                   domain I; TIGRFAM: DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27211"
FT                   /protein_id="ADD27211.1"
FT                   /translation="MGSMTLKGQGPGPLPPLLEQYVELRDAYPDYLLLFQVGDFYEAFG
FT                   EDAERLSRALNLTLTHKTAKDFTTPMAGIPVRSVDVHLEKLLKLGFRVAVADQVELAEE
FT                   ADKLVRREVTQLLTPGTILRENLLKPEANYLAAISTGDGYGLALLDVSTGEFRGSVLYS
FT                   KSALYDELFRFRPAEVLLAPELYHHPAFLQEFQRRFPVMLSEEGFQDEVGKTALHKQFD
FT                   PLPAGLEHPALLRSAGAVLAYALRVQENGLPQVRSFVRYDPGAFMQLSEATLRTLEIFE
FT                   PSFVGDRSEERTLLGVLGLTRTAPGRRLLRAWLRHPLVEEAPLQARLDAVEALVKDGVL
FT                   RAEVRKVLYRMHDLERLAARLLAGRASPRDLAALQRSLALLPELAGLLAGVGPLFSLSE
FT                   RLPQPVAVAEQIAAALVEDPPLKITDGGLIREGFDPELDELRQRAEEGRAWIARLEGEA
FT                   REKTGIPNLKVGYNAVFGYYLEVTRPHYALVPKDWRALQTLKDRMRFSTPELKEQERKI
FT                   LQAETEAIKREYAVFLELREQVAQAADEVRQAAQVLAELDVYAALAEAAVEYGYSRPRF
FT                   SRDGTLQIVAGRHPVVERSSPFIPNDLSMSPAARLLILTGPNMAGKSTYLRQTALIALL
FT                   AQVGSFVPAESATLPLFDRIYTRIGASDDIAGGRSTFMVEMDELAGILQGATSKSLVLL
FT                   DEIGRGTSTYDGLALAWAACEYLHDQVRAYTLFATHYFELTALPLRMAAARNAHVAAKE
FT                   EAGGLVFYHQVLPGPASQSYGLEVARLAGLPQAVLQRARSVLDSLEASQKGLSKEILEE
FT                   LLQLDLARTSPLEALLFLRRLQDQLRGLAPQEAEAERLSQV"
FT   gene            complement(414486..414998)
FT                   /locus_tag="Mrub_0435"
FT   CDS_pept        complement(414486..414998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0435"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; InterPro
FT                   IPR001453:IPR008284; KEGG: afw:Anae109_1304 molybdenum
FT                   cofactor synthesis domain-containing protein; COGs: COG0521
FT                   Molybdopterin biosynthesis protein; SPTR: A3IN20
FT                   Molybdopterin biosynthesis protein; PFAM: Probable
FT                   molybdopterin binding domain; TIGRFAM: molybdenum cofactor
FT                   synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27212"
FT                   /protein_id="ADD27212.1"
FT                   /translation="MSESTAKHKEIARARGPVNLAIVTVSDTRTPETDTNYHYLKPEIE
FT                   ALGHRVVGYRIIKDEPEQVAQALEEMVQAGAQIILFNGGTGIAPRDTTYDVLARKIEKP
FT                   MPGFGELFRMLSYNEVGAAAMLSRATAGTYRRKVVFSTPGSPNAVKVAWEKLIKPELEH
FT                   LAWEVAR"
FT   gene            complement(415028..417448)
FT                   /locus_tag="Mrub_0436"
FT   CDS_pept        complement(415028..417448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0436"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="InterPro IPR002205:IPR006691:IPR005743; TIGRFAM: DNA
FT                   gyrase, A subunit; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); COGs: COG0188 Type IIA topoisomerase
FT                   (DNA gyrase/topo II topoisomerase IV) A subunit; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: P94605 DNA gyrase
FT                   subunit A; KEGG: bha:BH0007 DNA gyrase subunit A; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; PFAM: DNA gyrase/topoisomerase IV, subunit
FT                   A; DNA gyrase C-terminal domain, beta-propeller; TIGRFAM:
FT                   DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27213"
FT                   /protein_id="ADD27213.1"
FT                   /translation="MSQVLPVEITDEVKQSFINYAMSVIVDRALPDVRDGLKPVQRRIL
FT                   YGAYQDGVLPSRKHVKCAKIVGEVMGKFHPHGDAAIYDTLVRLAQPWNLRYPLIDGQGN
FT                   FGSVDGDPPAAQRYTEARLSNIGLELLQDLDKETVPFVPNYDGTQEQPEVLPAALPNLL
FT                   VNGSAGIAVGMATSLPPHNLGEVVDALVLMIDNPEVTLEEVMKVLPGPDFPTGAKLSRR
FT                   GIKEAYATGRGSLKVRARVRNEDKNGRAMLVFTEIPYQVNKADLIAQIASLVRNKVIDE
FT                   IAALRDESDRQGMRIAVELKRGANPQVVLNKLYKHSRLQTSFTVNLLAIVKGEPKVLTL
FT                   LELMRHYLDHRGLVVRKRTEYELRKARERAHVLEGLLIALDHIDEVIALIRGSQDAAEA
FT                   RAGLMGRFSLTEVQAQAILDMRLQRLVGLERDKLQAEYRELMEEIGRLEAILGDEKRLW
FT                   RVVRDELLAIKDKYGDQRRTQITEFEEGFSLEDLIEDEPMVITLTSQGFVKRTPLEAYR
FT                   AQGRGGMGAQAGKTKEEDEAISVFVASMHDTLLIFTNRGRVYGEKVHELPEASRQARGT
FT                   HIVSLLPLQEGEEVAALLNVRDLTQEGYFVFATKNGLIKKTEIKEYQNLSSAGLIAINL
FT                   LENDALVGVAIAQEGDQVMLATQSGQAIRFELSDVRATGRASQGVTGIRFKEGRDDRVV
FT                   SLVILPKGEESEVLAVGSHGYGKRTPISEYPLQGRGGMGVITFNTNEKVGQLAALMRVQ
FT                   GNEDLLVLSRRGNAIRTKVSSIAQYGRATSGVRVMNLSDKDEIASAFVIAPQD"
FT   gene            417621..419183
FT                   /locus_tag="Mrub_0437"
FT   CDS_pept        417621..419183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0437"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; InterPro IPR000577:IPR005999; KEGG: gme:Gmet_1676
FT                   glycerol kinase; COGs: COG0554 Glycerol kinase; SPTR:
FT                   Q9RT38 Glycerol kinase; PFAM: FGGY family of carbohydrate
FT                   kinases, C-terminal domain; FGGY family of carbohydrate
FT                   kinases, N-terminal domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27214"
FT                   /protein_id="ADD27214.1"
FT                   /translation="MPGTALVLAGFGVFAISAIKTEESMPYILALDQGTTSSRAIVFDL
FT                   EGQPQAMAQQEFMQHFPQPGWVEHDPLEIWQTQLQVAQEAIQRAAIQPSEIVALGITNQ
FT                   RETTVLWERATGKPVHRAIVWQDRRTAPICDELRKGGYEGLFRQKTGLVLDAYFSGTKV
FT                   KWLLENVPGFRERAGKGELCFGTIDSWLIYNLTGGRVHATDVSNASRTLLFNLHTQRWD
FT                   EELLGILGLPKALLPEVRPSAGLFGETLPELFGAPIPIAGVAGDQQAALFGQACFTPGM
FT                   AKNTYGTGCFLLMHTGQEQVTSQNGLLTTVAWQLEGGPLEYALEGSVFVAGAVVQWLRD
FT                   GLGIIQNSSEIEHLARQVSSTDGVYLVPAFVGLGAPYWDPYARGTVVGLTRGSSKAHLA
FT                   RAALEAIAYQSRDVLEAMEADAGLQLSELRMDGGATVNDLLMQFQADILGTPVVRPQVT
FT                   ETTALGAAYLAGVGVGLLTQAQIAQRWAVQKRFEPAMGQEERARLYSGWKKAVERAKSW
FT                   VDA"
FT   gene            419237..419575
FT                   /locus_tag="Mrub_0438"
FT   CDS_pept        419237..419575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to protein O-D-mannosyltransferase;
FT                   K00728 dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27215"
FT                   /protein_id="ADD27215.1"
FT                   /translation="MDFKELVNQAREAAENALKQAEAKFNEVKANLDKDGDGVPDQLEG
FT                   VMNQAKQAAEQAKAKFEELKASLDKDGDGVPDQLKSLGEQARQAAEQAKAKAEELARAA
FT                   QERLGKKS"
FT   gene            complement(419618..420376)
FT                   /locus_tag="Mrub_0439"
FT   CDS_pept        complement(419618..420376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27216"
FT                   /protein_id="ADD27216.1"
FT                   /translation="MDGTFELLGPIELLQLLSQARQTGAFKVPGGEVYLERGQPVHAQY
FT                   RGQVGKDGLFQILALKEGKFRFLAGERARQSSLQGTLDNYLLEAIRFMDARLDLSPFDQ
FT                   VQLADAQRTTHLTLSPDEFELLRHMSKPISLFDLAAASGLSSEVVHLNVSRLARLGLVR
FT                   ITTRTPHTVRLVVARLEGAPEARIDTQLLRAWRSHFGAFTQIEVRTEDRTLQMPVAAAS
FT                   SAGPQLLLSSDALFFYNLRVGQEVLVWPSL"
FT   gene            complement(420964..421542)
FT                   /locus_tag="Mrub_0440"
FT   CDS_pept        complement(420964..421542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27217"
FT                   /protein_id="ADD27217.1"
FT                   /translation="MTASVKHRLYSGLVYDDFSTLLDRILETIDEHHATNRELAVVKSA
FT                   LETAINRYASRPNLLEEIDHAYKALERKLNHFAQVGKPIKATAIREEIHELNDLLYFSE
FT                   QASNQIERLASKIIMLEKTRAIIRFKLAKMLELQQLILYISAARDTFAKIASQEQLDLL
FT                   EESLRREILNPLRLELLPLGVTTTRARVH"
FT   gene            421869..426149
FT                   /locus_tag="Mrub_0441"
FT   CDS_pept        421869..426149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0441"
FT                   /product="protein of unknown function DUF450"
FT                   /note="PFAM: protein of unknown function DUF450; InterPro
FT                   IPR002296:IPR007409:IPR002052; KEGG: vei:Veis_1308 putative
FT                   type II DNA modification enzyme; SPTR: O52000 Putative
FT                   uncharacterized protein; PFAM: Type I restriction enzyme R
FT                   protein N terminus (HSDR_N)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27218"
FT                   /protein_id="ADD27218.1"
FT                   /translation="MLNLSEGQTESVPISLRNQEAERLRDFDGLFQIYLVRYKAYPPTK
FT                   QVEAYLAKTGSSALVLFTSDEKSFVLSYVDGDRAINARAQKDWVENLLKDLLELYQETG
FT                   DVLKLSESAQDAIHAQADENINRQKRPYRNQGLFSDHYLDTRLRESSEWLEDSEPLRKR
FT                   LLELYKDKESLLKVANEAQTEDEFIRPVLESLGFAYWVQDTTKATGGPQRPDYVLYPDE
FT                   GTKSRAVVHKANEAKRYAPALAIAEAKYWGRDLDVKRKDGRDRVQSPVSPSFQLSDYLS
FT                   STSLEWGILTNGQEWRLYWGKAADKQKRYFAVDLVQALQDPEAFRFFWLFFRREAFTKG
FT                   AQGSFLGRILEGSEQYGLRVGKRLKGVVFEQVFPLLAEGFLRYHKQVLKQPPDKAMLQE
FT                   TYRATLSLLYRLLFLLYAEDRDLLPVSDTLGYQQYSLSRIRRNVAEWLDQGRAYSEQSY
FT                   SLWERLSTLFTFIDKGDSTLRVPPYNGGLFKPGVYPFLDTHKVADAFLAPALDKLARQE
FT                   DEDGKLRFVDYKYLTVRELGAVYEGLLEFSLKVAEEDLVVVKDDDREVYKPKAKLTAKE
FT                   KPVAEVPKGKPYLVNDKTERHASGSYYTPDYVVEYIVRRALEPVVAKRREALEKVLTEY
FT                   AHWSKKQDKRPTKQNVERLTELRHKALDTLLDVKVVDPAMGSGHFLVGAVDFLSERFAN
FT                   LITELRAEPITDALAGLRDEIKAQMKQYGLELKDEQLSDINLLKRMVMKRCVFGVDLNS
FT                   MAVELAKLSLWLDAFTVGAPLSFLDHHLRHGNSVLGVSRSEFVRWVERENPVWLSELER
FT                   EVEEATRKAQELLSVRDLTPAEVELSQSLYAHWEFEFPEVFFGPERKYNPGFDAVIGNP
FT                   PYVRQEQLGPNKPFFEKAYESIYAGAADLYTYFFARGLGVLREGGRLGFISSRQFTRAA
FT                   YGEGLRKLLTAHTLLEITDFGENPVFEGVGTFPAIFILEKGQPAYPIRYKAVSKAEFSA
FT                   LMEKPSEARAEELAQLVEGGQNLGPEAFRPEGWTLGSADENAILRKMEENGVPLGAYVE
FT                   GIYYGIKTGFNEAFFIDEPTRNRLIKEDSRSAELIKPLLVGDDVRHYYARWPKTYLILI
FT                   PSSSHFDEGSWADSQIQEEAEQIFKETYPAIYKHLVSWRDKLKARSDQGRWWWELRPCA
FT                   YYQLLEAPKIVYPEIAKEPRFYLDYRGFYINKKLFFIPRADWYLLAVLNSRVAFGILKL
FT                   RLSALGDADEGGRLELRAVHLQHLPIPKVPHTTQASELEIALEEARKHYAQGEVSAALT
FT                   WAEKELVAGCRDTVAAFLGFLAQEMQRMQAERLSLEGGWRGWVEHAFQGTGKLGKEWLA
FT                   EDWAREGLGVGVEAITERFKVKRVKTTPQTLAQLKMHTQETLDQLRPLYQRLEATDRLI
FT                   DRLVARLYGLTDEEAERLWATPSS"
FT   gene            426128..426679
FT                   /locus_tag="Mrub_0442"
FT   CDS_pept        426128..426679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27219"
FT                   /protein_id="ADD27219.1"
FT                   /translation="MGYPIVIGRFRGEVLLDLEGLFLLVSLNSSCSEEEILSDLNSLHL
FT                   VGVLLLQQKALFVGSSRVLSTDWNQPWLEGLLRMVEGADPLQAERIAERVFLRRIFAKG
FT                   LQGLLELERHMQRLKKHAKQAEEDCLHAGAYAEGNEWKAWLQEIEDIEPRLRNLELTLG
FT                   RFAVRLGNRWLWGSEDDQST"
FT   gene            426746..427621
FT                   /locus_tag="Mrub_0443"
FT   CDS_pept        426746..427621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8203 putative 5-methylcytosine-specific
FT                   restriction enzyme B"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27220"
FT                   /protein_id="ADD27220.1"
FT                   /translation="MSQPYSIGPYKGEVLLSLTGLFHVIRLIPPYPPRAVLEQILKERA
FT                   MPTLVQWDNQVGLVGPEQTLWVEAEQSWMEGLIRQLEPLDPLSAPEIAEQALLEKLVEN
FT                   AGSRLWAFLDDVNMLLTHGEMALETAQASRRYDRVATLAQWLERLLKVQQSGEALAELW
FT                   GAFSGKKRSMPAKHPSKKAPVPDKTRKRTKGAALPQKEYRLPILRALAELGGRGKTAEV
FT                   LDRVYLQLKHLFTDGDLERAYDDPRRDEPIWRNRARWEIAALKEEKLVQSGGYGVLILT
FT                   DKGAAYLHGA"
FT   gene            427690..428787
FT                   /locus_tag="Mrub_0444"
FT   CDS_pept        427690..428787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0444"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   SPTR: A6DG29 Filamentation induced by cAMP protein Fic;
FT                   InterPro IPR003812; COGs: COG3177 conserved hypothetical
FT                   protein; KEGG: bur:Bcep18194_B2094 filamentation induced by
FT                   cAMP protein Fic; PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27221"
FT                   /protein_id="ADD27221.1"
FT                   /translation="MADSGFGPSDIVAERKALLERLGGLPATLLSVRNEEWLYMLQEDT
FT                   HHSLAIEGHFATEQQLKAVLQGRRSGPEIVNYFRTAQSLYDLALQYHLEGQTHLDLALI
FT                   RHIHSELWRDLAPDRGRFALNGEARVIQGAQVRPPVYDVEAYMRAFVRVTLELLRQYPI
FT                   LEALARSHTLFEAIHPFKDGNGRAGRILLSYLAINQGYVPIVIKGLHPEERNAYYQALE
FT                   AADRGFHQGFPPPKPPLLLERLEEGNFAPLVGLLLEGMLPRLDQTIALSLAARVPLLGL
FT                   EEVARALGVPRGTLYQWRKRGRLIVLKPQGRRAGLLSHPWLFLGTQDTPAQTPANFPPI
FT                   RENQAGQTMSLFEAVLQNPTDTRLE"
FT   gene            428790..431840
FT                   /locus_tag="Mrub_0445"
FT   CDS_pept        428790..431840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0445"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SMART: helicase
FT                   domain protein; DEAD-like helicase; InterPro
FT                   IPR001650:IPR014001; KEGG: sfu:Sfum_0411 helicase domain
FT                   protein; SPTR: A5YS53 Helicase, C-terminal; PFAM: Helicase
FT                   conserved C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27222"
FT                   /protein_id="ADD27222.1"
FT                   /translation="MSANLQLPDFIDNDHLKLSEALNFLLRSQPQADIASGYFNLGGYA
FT                   LVKDALAEIPRLRILLSKEGGIAAGELYPAGFQKDLASAKFATRNRELAKELVQLLLRP
FT                   EIEVRLYTKGFFHGKAYIFGDVAIIGSSNFTHAGLTANTELNSVHKQGYAAQAAREWFE
FT                   RFWEQSQDYKLELVRLLEESKLISSGYSPYLIFLKSLYEYFKDELTVDLEKGRNIGKSL
FT                   VDLADFQQKAFERALKILEKYDGVFIADSVGLGKTWIGKKLLEHFGYFQRKKCLVIAPA
FT                   QLSQMWEDELRSIQVAAHVVSMESMGRSNFDASSYFDAEVVLVDESHNFRNSNQRYAAL
FT                   SRIMNAGRRKKAIMLTATPINNSVFDLYNQIMLFARGERYFARAGIPYLRGYFIRALED
FT                   GDLLNLLEEVMVRRTRQFVKQEFPEAVINGEPVRFPRRELHTERYDLEAIYPDLYKQVA
FT                   VRFEELILAAYNPEAFLERPTDKEELERQRNEALIGLIKSLLLKRFESSVEAFRISLRR
FT                   QIAFHERFIEELMHGHLLSSADYRRLIALENEEEVSSSVQSLPTVDASAYRVLELAQVA
FT                   AADLEHLREMLRMVEPVAVENDPKIAKLIELIRERPGKKIVVFSYFQDTIRYLEQAFRE
FT                   TYAESLQAVRWAVVDGSVRTKDRTDILRRFAPKSQKTQVAPEDELDLLLATDVFSEGQN
FT                   LQDADTLINFDLHWNPTRMIQRAGRIDRLGSPFEVIHIHNFFPEDGLEEMLGLLERLME
FT                   KIVQIDKNVGLDASILGEVINPKTFNALRRIEQEDARIADELEAEAEISSEFMRALLST
FT                   YLQKSGAERLEAIPYGVHSGMAGRGRRGIFFHFKVGDEHIWRFYDVDKREILDSKYRIY
FT                   NLIQCEEQTPRVDADYNVDDILAEVSRHLLEDLNIQNAVQVDTLPKAQREVLTALRGLA
FT                   RHPQIDRQELIELLKNLNQPLSRVLVRELESIHKAYEAQPMELVKALRAFVEHYYLTQT
FT                   DQSAQANRRFSEEDLELVVYLTLSATQ"
FT   gene            431926..432990
FT                   /locus_tag="Mrub_0446"
FT   CDS_pept        431926..432990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0446"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; InterPro
FT                   IPR002559; KEGG: lpp:lpp2895 hypothetical protein; SPTR:
FT                   A4VBY8 Putative uncharacterized protein; PFAM: Transposase
FT                   DDE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27223"
FT                   /protein_id="ADD27223.1"
FT                   /translation="MHHHSELIEVLRPHLKWHRARLDFLSAFVLALIRVRSVNLAQIAL
FT                   ALNPWVHIASNYRRCQRFLAEFRLQQEVIGRLILKLLPQDPAHKLVLSLDRTEWTLGQA
FT                   SINLLFIGVAHQGVAYPLVWCFLGKAGSSNLQERLGLLRRLLTFLPKERIQSLCADREF
FT                   ACTGFLRYLRWQQLPYTLRIKAGNRVTYKGRSRPVQQLFRHLDYGAWEALPKPVKLWGQ
FT                   PTYLMGSRLRKGEYLLLITEAEPERAPARYARRWEIETLFKACKSQGFDFESTHLTRAE
FT                   RIESLVALMSIALVWAHRVGEWRLQTQPIPIKNHARKLYSTFRYGLDYLRQLLFAPEAR
FT                   KAELYACVRLLSCT"
FT   gene            complement(433172..433248)
FT                   /locus_tag="Mrub_R0008"
FT   tRNA            complement(433172..433248)
FT                   /locus_tag="Mrub_R0008"
FT                   /product="tRNA-Pro"
FT   gene            433368..433444
FT                   /locus_tag="Mrub_R0009"
FT   tRNA            433368..433444
FT                   /locus_tag="Mrub_R0009"
FT                   /product="tRNA-Ile"
FT   gene            complement(433509..434837)
FT                   /locus_tag="Mrub_0447"
FT   CDS_pept        complement(433509..434837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0447"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; SPTR: A4NPF1 Predicted
FT                   membrane-bound metallopeptidase; InterPro IPR016047; COGs:
FT                   COG4942 Membrane-bound metallopeptidase; KEGG:
FT                   bcr:BCAH187_A1592 peptidase, M23/M37 family; PFAM:
FT                   Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27224"
FT                   /protein_id="ADD27224.1"
FT                   /translation="MRQAQRPYPTRLPALCFRYGAGGIATLLWLTGILLILPPWALGQS
FT                   SLNQLQQQAEQNRRLLQLQQQRIEQLNRDLANLDAATKQQIQELRRLEAEMTRLERERA
FT                   ELTRQITLLESQKQQAETRIASLQKELEGLRERLSALLQSLHRERAGRYLPLLRAESFT
FT                   DLSVRSRWVGVLGQHQTDLMERIKTTVRQLDEERVRLELLVNTLSERRAERQQRITALA
FT                   QNRQTVQLTLANLRRQQAGRQIILRETLQAQAQLRAELQVLQGRIAAELRRLAEERRRA
FT                   EEERRRREAEERRRRELQAQREREAALVLPSVPREVVGALQFPVRGGRVAEPYGFQGND
FT                   WQTLQGSQASSPIVAAADGVVIDSLFIANLGYTLTIRHSDQMATQYVNVLEPRVSVGQR
FT                   VAQGQVIGFTGGGVLIPSNQMWFRVIVIDNDGSFHYVDPSRYY"
FT   gene            complement(434834..435700)
FT                   /locus_tag="Mrub_0448"
FT   CDS_pept        complement(434834..435700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0448"
FT                   /product="cell division protein FtsX"
FT                   /note="PFAM: protein of unknown function DUF214; SPTR:
FT                   A1HT00 Putative uncharacterized protein; InterPro
FT                   IPR003838; COGs: COG2177 Cell division protein; KEGG:
FT                   pag:PLES_03721 cell division protein FtsX; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27225"
FT                   /protein_id="ADD27225.1"
FT                   /translation="MVVYALSQALRSLRQHLTSTLATFFTALVSFSLLFLLGLLLWNLD
FT                   RVVASLERELEVAAFLKPEARVDALLEQIKTWPEVSEARLQTKEEALATLQLDYPYLAQ
FT                   AREFIQNPLPDTIRIKLNNAQAVREVGRRVARLEGVDSVEYGGALTEQLVRVLAGLRVA
FT                   VNILVVLLLLDTLFSVMGTIRLSIENRREELRVMQLVGATRRFIQGPFVAEGTLLTLAA
FT                   GLVALGLGTVSYRFLAEALQNLLPFVPVLADSDLARAALAMLVLAVLLGATGAYLASRA
FT                   HLRETDL"
FT   gene            435862..436647
FT                   /locus_tag="Mrub_0449"
FT   CDS_pept        435862..436647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5052 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27226"
FT                   /protein_id="ADD27226.1"
FT                   /translation="MLSGDLAEFPLLRLLETLMGAARGGVLRIEHPSFVGSIYLEGGHP
FT                   VHAEAGRLRGLEALELLAGLKSAPFCFDSEQNTRERSIEPGLETHQLIVHQFEAWNEVS
FT                   LPDNWTLTLQACSIQGPTQLSPLEASVLAQVQGKSLAQALMNERLSPLEAAQVLSKLLR
FT                   LGLLEARNHLVIEPEPLVVLTLYGGGQGVAAIDEELFARWQGLVGEGFVLRLRTKNQEA
FT                   TLRPQPRINMQGRVGLFERDLRQLRLSRGVLVEVWPEAR"
FT   gene            436662..438038
FT                   /locus_tag="Mrub_0450"
FT   CDS_pept        436662..438038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0450"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; InterPro IPR001463:IPR001734;
FT                   KEGG: cps:CPS_3842 amino acid/cation symporter; COGs:
FT                   COG1115 Na+/alanine symporter; SPTR: A3JAY1 Putative
FT                   sodium/alanine symporter; PFAM: Sodium:alanine symporter
FT                   family; TIGRFAM: amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27227"
FT                   /protein_id="ADD27227.1"
FT                   /translation="MDILTLNDYVNRAVYGEWMMLVFILVGLYLSLRTGFPQLLRLGVA
FT                   LRETLGAIRERFLSFGGQITPFQAAMVAMSATIGTGHIIGMVGAVVLGGPGAVLWMWVA
FT                   YLVGMATKFSEAVLAVHFRRQYTDGSVLGGPMVYIRYGLGRRMAWLAALFALFTAIAAF
FT                   GIGNLSQSGAVGAALAQEFNVPPAVTGLLVALLVGILLAGGIRSVARFAQMIVPLKLVL
FT                   FLLAILPLIVIHLESLPAALALVFSSALSFQAAAGGAAGAAVSLGLAEILKAGVGRGIF
FT                   ANEAGLGSAAIAHAQAQVDHPVRQGFWGLTEMLLSLTVTTLMALTFIASGLWQRFLGGD
FT                   RVEAARALFAEHPLGVAMLGLMLAVFALGTMVSWGFYGEEGAAYLFGEGIRWPYRLTFV
FT                   TFAFVGPMGGLAALTSVADTLNGLMAIPNLVALLALGGLVGRLVREFFSGMPWQPPEED
FT                   "
FT   gene            438130..438720
FT                   /locus_tag="Mrub_0451"
FT   CDS_pept        438130..438720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0451"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; InterPro
FT                   IPR003382:IPR004507; KEGG: dde:Dde_0150
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase; COGs: COG0163
FT                   3-polyprenyl-4-hydroxybenzoate decarboxylase; SPTR: Q9RR91
FT                   Probable aromatic acid decarboxylase; PFAM: Flavoprotein;
FT                   TIGRFAM: polyprenyl P-hydroxybenzoate and phenylacrylic
FT                   acid decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27228"
FT                   /protein_id="ADD27228.1"
FT                   /translation="MSVPKRLVVGLSGASGMPYALDLLQTLRRVGGLEVHLVMSQGAKR
FT                   VLAEEAGLSLEAVEALAHVVHRSSDLGAPIASGSFRTLGMVIVPCSATTLAKVAYGLAD
FT                   NLLTRAAYVTLKERRPLVLVPREAPLPLPSLEAMVKATLAGATILPAAPGFYHKPQTIE
FT                   DLLAFMTQRILDLLGLEYSRAPRWGELQELELD"
FT   gene            complement(438717..439493)
FT                   /locus_tag="Mrub_0452"
FT   CDS_pept        complement(438717..439493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0452"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: undecaprenol kinase; PRIAM:
FT                   Undecaprenyl-diphosphatase; PFAM: Bacitracin resistance
FT                   protein BacA; InterPro IPR003824; KEGG: wsu:WS1290 putative
FT                   undecaprenol kinase bacitracin resistance protein; COGs:
FT                   COG1968 Uncharacterized bacitracin resistance protein;
FT                   SPTR: O67939 Undecaprenyl-diphosphatase; PFAM: Bacitracin
FT                   resistance protein BacA; TIGRFAM:
FT                   undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27229"
FT                   /protein_id="ADD27229.1"
FT                   /translation="MTIFEALILGILEGLTEFLPISSTGHLTLAAHLLQLDIENDPFIK
FT                   SFIVVIQLGAILAVLALYFQRFLRDIEVWKRIIVAFIPTGILGFLLADVIENVFLGNDL
FT                   IVVINLVGVGILLLFVDRWLQHHKRYDDVNQMPVPHAVLIGLSQALAMMPGVSRSGATI
FT                   VGGMALGLSRRAAAEFSFILAVPTMLSATGFSLVRHMDQFRADSWGLLVVGFLAAFISA
FT                   LLTVRWLLDFVSRNSFVPFAIYRILIGVVYGVFFLR"
FT   gene            439569..440201
FT                   /locus_tag="Mrub_0453"
FT   CDS_pept        439569..440201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0453"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="InterPro IPR001228; TIGRFAM: 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; COGs: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; SPTR:
FT                   Q5SLX2 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; KEGG: bha:BH0107
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   PFAM: Uncharacterized protein family UPF0007; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27230"
FT                   /protein_id="ADD27230.1"
FT                   /translation="MKVSVLLPAAGSGERIGRGPKAFLRVGGKTLLEWALEGFAWADEV
FT                   VVALPPGFRMDGLKTVPGGQTRQQSVFNLVQAATGEVVLVHDVARPFVVRSAVERLLEA
FT                   VRATGAASLVVSVPDTLVREEAGRYGEVIAREHHRLVQTPQGFRRELLWQAHQQARAAG
FT                   IEFTDDAQLVRWLGHPVVLVEGDRRMFKVTYPEDLILAEGLAQVWNC"
FT   gene            440189..441016
FT                   /locus_tag="Mrub_0454"
FT   CDS_pept        440189..441016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0454"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PRIAM: 4-(cytidine
FT                   5'-diphospho)-2-C-methyl-D-erythritol kinase; PFAM: GHMP
FT                   kinase; GHMP kinase domain protein; InterPro
FT                   IPR013750:IPR006204:IPR004424; KEGG: glo:Glov_2596
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; COGs:
FT                   COG1947 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase; SPTR: P83700
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases N terminal domain; GHMP kinases C terminal;
FT                   TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27231"
FT                   /protein_id="ADD27231.1"
FT                   /translation="MELLAPAKVNLGLSVLGRRPDGYHELHTLFAALRVGDRLWVEAIP
FT                   EGIELEVWGRGLPADTNNLVYKAAQAYLTAAGWPGGVRVVLEKNLPLAAGLGGGSSDAA
FT                   AVLRALSQLYPSALELPGLALGLGADVPFFLGPGLAEGRGVGERLTPLPPIRAALVLVN
FT                   PGIAVSAAEAYKGLTPEMWQPELDVAGVVEAIQVGEEPPYWNTLERSVFRLHPYLEALK
FT                   QELYRLGLRGVLMSGSGSTLFGLARDGAEAGYLAGVLRDKHPGFWVVATETVS"
FT   gene            441173..442255
FT                   /locus_tag="Mrub_0455"
FT   CDS_pept        441173..442255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0455"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein family 1; InterPro IPR006059:IPR005948; KEGG:
FT                   nmn:NMCC_0042 thiamin-binding periplasmic protein; COGs:
FT                   COG4143 ABC-type thiamine transport system periplasmic
FT                   component; SPTR: A6ZIJ2 ABC transporter; PFAM: Bacterial
FT                   extracellular solute-binding protein; TIGRFAM: ABC
FT                   transporter periplasmic binding protein, thiB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27232"
FT                   /protein_id="ADD27232.1"
FT                   /translation="MYRTPKAGWLVGLGALLLLTFGLWPARAQQTTLTVLTHDSWSLDK
FT                   NLVARFERESGIRVRFLKGGDAGEMLNKAILSKGAPIADVIYGFDNTMLSRALEADILQ
FT                   PYRSPELANLRPELRIDQTFRATPVDFGYVALNYDRDFFKDKPLPQRFADLALPEFAGL
FT                   LVVQNPATSSPGLAFLLATVAAFGEDGYLDFWENLRKNGVRVVSGWSEAYYTHFTRAGG
FT                   DRPLVVSYSTSPAAELYYSEAQPKPTEPPTANLFLPRSSFFQVEYVGILKGTRNLRAAQ
FT                   RFVDWLVSKPVQENIPTQMWVYPARQDARLPEVFRFAQVPPEPARLTPQQIANNRERWI
FT                   REWTQVVVQGQTAQAVKARR"
FT   gene            442269..443798
FT                   /locus_tag="Mrub_0456"
FT   CDS_pept        442269..443798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0456"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A6ZIJ1 ABC transporter
FT                   permease protein; InterPro IPR000515; COGs: COG1178
FT                   ABC-type Fe3+ transport system permease component; KEGG:
FT                   cvi:CV_3162 thiamine transport system permease protein;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27233"
FT                   /protein_id="ADD27233.1"
FT                   /translation="MAKASRAASWLALPVLVFLALALLYPLGRIVALGLTEGFIATLGD
FT                   PYYRSRLLWSLAYGLGSSLLCIGMALPLAYAFRYRFPGRDFWLAFSVVPFVLPTLVVAM
FT                   GFLSLVGPRGLLGINLYDTPWILFWASLLYNLGLVLRPLVALLPMLSTPLQAARTLGAS
FT                   PIRAYLRVGIPLLTPALLSGGSLVFLFSFTSFGVPLLLGGPGWATLEVATYQALAQRLA
FT                   FPEASALVLMQLVVTGLVLWLYLRLQTGWVVGLEGAEAPLPLMRGRALALAIGVAGVFL
FT                   LLYSPLLALVWRALERPGAWLSVWRNPDFTPGLLALQNTLAFAGVALLGVLPVGFLYAY
FT                   AVWRGARWLDGLGLLPLMVSPVALGLGYLLVYPGLRGSIWLLIGAYILLSYPLLTRTLL
FT                   PALQGLPQGVLEAARVLGASPWRRFIGVEWPLVRPSTTAGLALALAAILGEFGATLTLQ
FT                   RPEWATLSLAIYERLGRPGATPFYEAVVLAVALMALCTVLLLGLQKGTWER"
FT   gene            complement(443834..444808)
FT                   /locus_tag="Mrub_0457"
FT   CDS_pept        complement(443834..444808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0457"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; SPTR: A7LSG1 Putative
FT                   uncharacterized protein; InterPro IPR013525; COGs: COG1277
FT                   ABC-type transport system involved in multi-copper enzyme
FT                   maturation permease component; KEGG: bpt:Bpet0290 putative
FT                   ABC-2 type transport system permease protein; PFAM: ABC-2
FT                   type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27234"
FT                   /protein_id="ADD27234.1"
FT                   /translation="MQHSSTSRRREGSPWTGLWAVFFKEMADHLSSTRMRILEVLILLS
FT                   AVGAVYAGAQTLRQTISEDPFLLLRVFTAAQDPLPSFVAFLSFFLPLAAIALGFDAING
FT                   EYSRNTLSRILAQPIYRDALLWGKFLAGLATIALILLALFLLVVGLSLIFLGVPPSSEE
FT                   VARALLFLLATLAYTGVWLGIALVTSVLFRSAATSALAAIAVWLFFALFWGIIAQLLAQ
FT                   AVAPFDPFNPESELRQTEALLAFSRLSPNTLYAEAIQALLNPGVRSLGPVLISQLEGAL
FT                   LGSPLPLGQSFLLAWPQLTGLIALTIGLFAVAYVLFQRREVRA"
FT   gene            complement(444798..445727)
FT                   /locus_tag="Mrub_0458"
FT   CDS_pept        complement(444798..445727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0458"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: A8S3F5 Putative uncharacterized protein; KEGG:
FT                   mes:Meso_3123 ABC transporter related; COGs: COG1131
FT                   ABC-type multidrug transport system ATPase component;
FT                   InterPro IPR003439:IPR003593; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27235"
FT                   /protein_id="ADD27235.1"
FT                   /translation="MVIETQGLTKRYGRVVAVEGLELRIEAGEVYGLLGPNGSGKTTTI
FT                   LMLLGLTEPSAGQVRVLGLDPAREPLSLKRQVGYLPDSVGFYGEMSAWENLSYIARLNG
FT                   LPPALAKARMERVLERMGLTEVAHRPVGAFSRGMRQRLGLAEVLLKEPKVVILDEPTLG
FT                   LDPEAAQEFLQIIRSLKSEGITVLLSSHLLHQVQAICDRVGLFHKGKLVLEGRVEELAQ
FT                   RVLGGAYRIRLEATPLNGLAERLQALPEVSRVQAEGQGLRLEATQDIRPQVAKAVLEAG
FT                   AALQSLVLEQPSLDEVYARYFQEVRHAA"
FT   gene            complement(445736..446875)
FT                   /locus_tag="Mrub_0459"
FT   CDS_pept        complement(445736..446875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A8S3F6 Putative uncharacterized protein; COGs:
FT                   COG1470 membrane protein; KEGG: mes:Meso_3122 hypothetical
FT                   protein; PFAM: NPCBM-associated, NEW3 domain of
FT                   alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27236"
FT                   /protein_id="ADD27236.1"
FT                   /translation="MPRLLALLLLMMSLGLAQGFRGLALYTPYPSQSVRLGETISLPIT
FT                   LKGYNLPPQTVQVRVAELAPGWKASLLGGGRVVGAVYVLPDGEQSLSLRLEPPQNVRAG
FT                   TYRFRLVAEGSGVRAELPIALTLGQVLPKRLSLETELPVLKGTPTASFRYRVTLRNESD
FT                   QDLLVNLEADAPENFRVSFSTAFGGQEINSLPLKAGESRDLEVQVTPPRQVEAKVYAVT
FT                   LRALAGEAKAELAVNLDITGQVELSLSTPEERLSGRAYAGRENPIKLVVKNNGSAPAEN
FT                   LELSASEPSGWEVRFEPDKIERLAPGAESEVTARIKPSSRAVAGDYMLTLRASAEGAQA
FT                   SADYRVTVQTSTLWGLIGVALIAVAVGAVGFAVSRFGRR"
FT   gene            447034..447501
FT                   /locus_tag="Mrub_0460"
FT   CDS_pept        447034..447501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0460"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; CS; SPTR: P46729 18
FT                   kDa antigen 1; InterPro IPR017447:IPR002068; COGs: COG0071
FT                   Molecular chaperone (small heat shock protein); KEGG:
FT                   wpi:WPa_0614 heat shock protein, HSP20 family; PFAM: CS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27237"
FT                   /protein_id="ADD27237.1"
FT                   /translation="MLDIVRNVPVQTMPLRSWNLSSVNDFFHEFDRLWNEVTTSLGSAW
FT                   PAGVYPYDLYETGDSLVLEMAVPGLRKDDLEVRLEGNRLTIRGTYPEAQGSDERRYWSR
FT                   GLPRGSFVQSLTLPASVEVDKIQATITDGLLRLTLPKVEQARVRKIAISAA"
FT   gene            complement(447550..448695)
FT                   /locus_tag="Mrub_0461"
FT   CDS_pept        complement(447550..448695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0461"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; InterPro
FT                   IPR011701:IPR007114; KEGG: scl:sce4003 major facilitator
FT                   superfamily permease; SPTR: A3K6C0 Putative integral
FT                   membrane transport protein; PFAM: Major Facilitator
FT                   Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27238"
FT                   /protein_id="ADD27238.1"
FT                   /translation="MSTAAPNQLAPARKAIYVTFFICGLVLAAWVSRIPAIKQQLGLNA
FT                   GELGLVLMGGPIGLVLAMPLTGWLIARWGSRPVLAWAAMSNCAALPLLALAPNGWALGL
FT                   ALFVFGFANAAMDIAMNAQAVEVEKRYTRPIMSSFHALFSLGGLVGAALGGAAAAGGLA
FT                   PLPFFAWTALVTGLLMLAATRYLLEVRPAASGPRFVWPRGVLLGLGLIVFCTGLGEGAV
FT                   ADWSAVFMKHEMGTSEAVAALAFSAFSVAMVVGRLSGDALIHRFGPVAMARAGGLLAAS
FT                   GFITTLVTNRPEVAMLGFVLIGLGYCTLFPLVFSAAGRVPGVQPGVALASVATLGYLGF
FT                   LSGPPLIGLVAQVTSLRVSFMAVAGLAVLISLLAGLLQVKK"
FT   gene            complement(448725..449225)
FT                   /locus_tag="Mrub_0462"
FT   CDS_pept        complement(448725..449225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0462"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; SPTR:
FT                   A1ZGG0 Putative uncharacterized protein; InterPro
FT                   IPR009327; COGs: COG3542 conserved hypothetical protein;
FT                   KEGG: sfu:Sfum_2769 protein of unknown function DUF985;
FT                   PFAM: Cupin superfamily (DUF985)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27239"
FT                   /protein_id="ADD27239.1"
FT                   /translation="MYSAKFWVEHLGLQPHLEGGFYRQTYVSSELIAQPHLPPRFDGPR
FT                   TFSTAIYFLLEHPDFSAFHRLKSDEVWHFYSGAPLTLWLISPQGTLSSLSLGPDPSKGH
FT                   RFQATVPAGCWLAASLDTPGSYALVGCTMAPGFEFADLELAQRGALVQQFPQHRPLIER
FT                   LTR"
FT   gene            complement(449240..449761)
FT                   /locus_tag="Mrub_0463"
FT   CDS_pept        complement(449240..449761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: Q12Y60 Putative uncharacterized protein; COGs:
FT                   COG2389 Uncharacterized metal-binding protein; KEGG:
FT                   bcy:Bcer98_3764 hypothetical protein; PFAM: Uncharacterized
FT                   metal-binding protein (DUF2227)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27240"
FT                   /protein_id="ADD27240.1"
FT                   /translation="MPSGRVHEAINLSVLGLATAAYWVYRQDLEVPQPVAVAFMGSYLL
FT                   GTFLITPDLDLAEQQVRAKGRWGWMGWLWVPYGWMFTHRGLSHTWVVGPLTRILYLGAM
FT                   GVLVYWFFTTLSSYLGLNIHLQPHFKAPPQEVIWALVLGYYASQWLHLIADGIWPDSGR
FT                   IFANRRRRQR"
FT   gene            449921..450568
FT                   /locus_tag="Mrub_0464"
FT   CDS_pept        449921..450568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0464"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; SPTR: A3ICN9 YsiA;
FT                   InterPro IPR001647; COGs: COG1309 Transcriptional
FT                   regulator; KEGG: ppr:PBPRA0090 TetR family transcriptional
FT                   regulator; PFAM: Bacterial regulatory proteins, tetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27241"
FT                   /protein_id="ADD27241.1"
FT                   /translation="MNRFKNTNGCLEKPVSSLAFGVLVDFVAVTVEARTAPKREAILEA
FT                   TIRVLRDRGLSGLKVEEVAREAEVGKGTVYLYFQDKQDLLKALVEHHTFTYYRKVEEVV
FT                   SRGGPFRERLAEVLRLRVDWVEEWRGLWAAVAREAQPEDTTGWLRGMHEHYQRLLERLV
FT                   QEGKARGEVRSELDTCLTAASIAALACNPQLEFPREAYLEHLLEVLLKGVAL"
FT   gene            450565..451059
FT                   /locus_tag="Mrub_0465"
FT   CDS_pept        450565..451059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0465"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; SPTR: A6NUQ9
FT                   Putative uncharacterized protein; InterPro IPR003711; COGs:
FT                   COG1329 Transcriptional regulators similar to M. xanthus
FT                   CarD; KEGG: dps:DP2731 transcription factor; PFAM:
FT                   CarD-like/TRCF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27242"
FT                   /protein_id="ADD27242.1"
FT                   /translation="MSEYRPGDKVVLPPYGVGVVAGIAQRSVAGSDRAYYQVDFPGTRS
FT                   KAYVPVEAPQTTRLRRALSPDQVNEILALLQEGRLPLPRQWAARHRKTTEILADGDPFR
FT                   IATLAGQLRAWELEKGLPDLDRQALRRAMHLLAEEISQVLEITLDEARKLFEEAVGESL
FT                   N"
FT   gene            complement(451120..452349)
FT                   /locus_tag="Mrub_0466"
FT   CDS_pept        complement(451120..452349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0466"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: sat:SYN_02641 cofactor-independent
FT                   phosphoglycerate mutase; COGs: COG3635 phosphoglycerate
FT                   mutase AP superfamily; InterPro IPR006124:IPR004456; SPTR:
FT                   Q5SM27 Probable 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase; PRIAM: Phosphoglycerate mutase;
FT                   PFAM: metalloenzyme domain protein; TIGRFAM:
FT                   phosphonopyruvate decarboxylase-related protein; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; Metalloenzyme superfamily; TIGRFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase, archaeal form"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27243"
FT                   /protein_id="ADD27243.1"
FT                   /translation="MDMLPILTELSQKTPTKILLVVLDGVGGLPQTPGGPTELAAAHTP
FT                   NLDALAQKSALGLLTPVYPGLAPGSGPGHLSLFGYDPFKYLVGRGALSAIGIGADFKDG
FT                   DVAVRGNFATLDAAGLVKDRRAGRPSDAENVRVVNRLKTAIREINGVQVTFYTESEHRF
FT                   VVILRGEGLGDKVSDTDPQKTGVAPLQAQALEAGDTASAKTASVLNTLTTRIQEVLRDE
FT                   PQINGALFRGISEKPRFPGMAQVYKLNAACVASYPMYKGVASLVGMEVLPVEGVEDAPE
FT                   GKVKALQENWAKYDFFYLHFKKTDSTGEDGNFEEKVHKVELFDHLLPELLALKPDVLAI
FT                   TGDHSTPSVLKAHSWHPVPLLLYGPYLRNDAAQRFTEDEAARGSLGHLRGVELMPLLLA
FT                   HAGKLQKYGA"
FT   gene            complement(452418..452948)
FT                   /locus_tag="Mrub_0467"
FT   CDS_pept        complement(452418..452948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0467"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; SPTR: A2XMU9
FT                   Putative uncharacterized protein; InterPro IPR000182; COGs:
FT                   COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: bca:BCE_1891 acetyltransferase;
FT                   PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27244"
FT                   /protein_id="ADD27244.1"
FT                   /translation="MELRGPRLLLRPPRLEDTEALFALMSDPEMAPFVYWNPHQSPDET
FT                   YQYLGHLQTKEGFFIIEAEGRPAGVIGLHLDWPNKLGETETWLGRPYWGCGINTEAKVV
FT                   LFDFAFGPWDLRRIQAIAHVHNPRSQRALEKLGFQREGLLRRWRWIRGEPWDFYMYSLL
FT                   PEEWMSSRPPIFY"
FT   gene            complement(453008..455590)
FT                   /locus_tag="Mrub_0468"
FT   CDS_pept        complement(453008..455590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0468"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; protease-associated PA domain protein; SPTR:
FT                   Q6H8Q3 Subtilisin-like protease (Fragment); InterPro
FT                   IPR000209:IPR003137; COGs: COG1404 Subtilisin-like serine
FT                   protease; KEGG: scl:sce3689 subtilisin like protease; PFAM:
FT                   Subtilase family; Domain of Unknown Function (DUF1034)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27245"
FT                   /protein_id="ADD27245.1"
FT                   /translation="MRKLLLLVGMSALLAACGGPRSSKPSLEVIASLPPAPASPMVDET
FT                   PTRWFVELSGGAVSDGISLQSIQAQHAAFRQAAQAAGVKILFAYTQLFNGFSVEVPGNN
FT                   RKLLYTLPGVEGVYPIGTYKLPPREAANPDLASAITQTGADIAQNDLGLTGRGVKVGII
FT                   DSGIDLEHPAFAGRIVDGYDFVGDAYDASDPAKSTPVPDPNPDDCDGHGTHVAGIVGGK
FT                   DSQITGVAPGVQFGAYKVFGCEGSTGDDVILAALERAETAGMDVVNMSLGSPFGWSVLG
FT                   KSITKMVKRGTVVVASAGNNGNLGLFATGDPAATEGVLSVASFDNIAVNAQKAVVNATG
FT                   APLGYLVLGGAEAPPTSGTSAEVVWVGRGCNADALLADPNGKVALMERGACTFNEKYQK
FT                   AVAAGAVGVIIHNNAPGLFAGGGVAGVAGKFGISISQADGLALRGLTSPTTLTWTPDTT
FT                   QVSNPTGNLISSFSSWGLSQDLKLKPDLGAPGGLIRSAVPLEQGSYAILSGTSMSAPHV
FT                   AGAVALLLEGNPAFWGPQKPSEVRKYLQNTAMPKLFALAPSSGLPETSYREGAGMIDIV
FT                   AAVQNRVTVTPSAISFAEKAGTHTERLVLKNRSNVPLIYRPVHLPGPSAFGSIYSPSFA
FT                   IAPATVSFSHTQVTVPARGEAVLTVTITPPAGLPNKGLFGGYILLQPVGAGLMMNVPYV
FT                   GMQGGYQAVQILTPASAGFPLLGKLNAAGTGYDLLPSGGTFTLQGNDLPVVLAHFEHGA
FT                   QVYEMVILNAATNAPIHPKYSRADYGEYIPRNSSANGFFAIPWDGTRITRYAKEDVYGN
FT                   KIPVPSEFQAVPDGQYKLQLRVLKPTGRMSNPADWESWISPVITIDRP"
FT   gene            455853..457286
FT                   /locus_tag="Mrub_0469"
FT   CDS_pept        455853..457286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0469"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM:
FT                   Anticodon-binding domain protein; Prolyl-tRNA synthetase,
FT                   class II-like; tRNA synthetase class II (G H P and S);
FT                   InterProIPR002316:IPR002314:IPR016061:IPR004154:IPR
FT                   006195:IPR004499; KEGG: mxa:MXAN_6655 prolyl-tRNA
FT                   synthetase; COGs: COG0442 Prolyl-tRNA synthetase; SPTR:
FT                   Q72GF9 Prolyl-tRNA synthetase; PFAM: Anticodon binding
FT                   domain; tRNA synthetase class II core domain (G, H, P, S
FT                   and T); Prolyl-tRNA synthetase, C-terminal; TIGRFAM:
FT                   prolyl-tRNA synthetase, family I"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27246"
FT                   /protein_id="ADD27246.1"
FT                   /translation="MAKDKGLTPQSQDFNEWYNEVVLKADLVDYGPVRGTMVVKPYGYA
FT                   IWENIQRELDRMFKETGHQNAYFPLFIPISFLQKEAEHVEGFAPELAVVTQAGGETLEE
FT                   PLAVRPTSETIIGHMWAKWIRTYRDLPQLLNQWNSVVRWELRTKLFLRTTEFLWQEGHT
FT                   AHATQEEAEEEARRMAGVYATVLRDWCAIPGWEGPKTESEKFAGAVYSISYEAMMRDGK
FT                   ALQSCTSHYLGQNFARAFDIQFQDKDQQNKYVHTTSWGFTTRVVGALVMTHGDDKGLIL
FT                   PPRLAPIQVVIVPIYKAETREAVLPAAERLYQELKAAGIRVHLDDRDQYSPGYKFNEWE
FT                   LKGVPLRLELGPRDVEAGTAVLASRLGGKETLQISELLGLLPARLEQFQRDLYQRALEF
FT                   RDAHTWAVDSYEAFKEKVEQGFVKAFHCGDKECEKQIKAETTATTRCIPYDEPEAQGSC
FT                   VRCGKPSAYGKRILFAKAY"
FT   gene            457290..457997
FT                   /locus_tag="Mrub_0470"
FT   CDS_pept        457290..457997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0470"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: endonuclease III; PRIAM: DNA-(apurinic or
FT                   apyrimidinic site) lyase; PFAM: HhH-GPD family protein;
FT                   InterPro IPR003265:IPR004036:IPR005759; SPTR: A2UA93
FT                   Endonuclease III; KEGG: sfu:Sfum_1062 endonuclease III;
FT                   COGs: COG0177 EndoIII-related endonuclease; SMART: HhH-GPD
FT                   family protein; PFAM: Iron-sulfur binding domain of
FT                   endonuclease III; HhH-GPD superfamily base excision DNA
FT                   repair protein; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27247"
FT                   /protein_id="ADD27247.1"
FT                   /translation="MPKVPKATSPKPKDKAQGSSGRESLKAKKQRAQRILAVMEQLYPQ
FT                   AATELQHKNPFELLIATVLSAQATDASVNKATPALFQRYPDAFALAQATPEEVEPYIKT
FT                   IGLYRSKARNIVLLARRLVEQHGGEVPVDKAKLRALPGVGWKTATVVLGAAFGVPGIAV
FT                   DTHLTRLAARLGLSAQKDPEKIGGDLERLFPKEKWVFVHHALILFGRYRCTARKPQCPG
FT                   CPLYDDCLSQGAW"
FT   gene            complement(458004..458237)
FT                   /locus_tag="Mrub_0471"
FT   CDS_pept        complement(458004..458237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27248"
FT                   /protein_id="ADD27248.1"
FT                   /translation="MRQFQFRLPQGPLGVLILLLAGTVGLFLVLWLITTLWVLAVGAGL
FT                   VGALAYGWRRLEARFRPRRWRRLPQKVRRWED"
FT   gene            458380..459342
FT                   /locus_tag="Mrub_0472"
FT   CDS_pept        458380..459342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0472"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PRIAM: Phosphoprotein phosphatase; PFAM: Protein
FT                   phosphatase 2C-like; SMART: protein phosphatase 2C domain
FT                   protein; InterPro IPR014045:IPR001932:IPR000585; KEGG:
FT                   ank:AnaeK_0770 protein serine/threonine phosphatase; COGs:
FT                   COG0631 Serine/threonine protein phosphatase; SPTR: A5ZMI4
FT                   Putative uncharacterized protein; PFAM: Protein phosphatase
FT                   2C"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27249"
FT                   /protein_id="ADD27249.1"
FT                   /translation="MPGSDSLPMVFTAALTDPGRKRALNEDAVTQLVTPYGGIFIVADG
FT                   MGGHRTGEVASQMAVSQILEILRHKEPSPQGLLEAYEAANEAIYLAGQKPESRGMGTTC
FT                   TTLWLDLPYALIAHVGDSRAYLLRDGELMQLTQDHSWVADRVRQGLLSEEEARNHRWRN
FT                   VITNALGSFSSARVDLVGLKVRPGDVFLLCSDGLSGVLEDRVLAEMILTNPPEPAVVKL
FT                   VKLANDWGGPDNISAVVVTIGSQVAENPRPYALPLEASEGRPVRLQSGSDPEVLTTQIV
FT                   EPERKVTFWQRWGSLILLLLWFGLLGFVLFNQFGTGSTP"
FT   gene            459392..459796
FT                   /locus_tag="Mrub_0473"
FT   CDS_pept        459392..459796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0473"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   SPTR: A4BBW7 Putative uncharacterized protein; InterPro
FT                   IPR012312:IPR012827; COGs: COG2703 Hemerythrin; KEGG:
FT                   ank:AnaeK_3116 hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain; TIGRFAM:
FT                   hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27250"
FT                   /protein_id="ADD27250.1"
FT                   /translation="MPIQWSQQYEVGDPRTDRQHQNLFEYVNRIEQLIEQGRAGRLNSQ
FT                   EVEHLFIFLDAYVNTHFAYEELCMTLRGCKMAQKNKEAHDRFLKFWAEFSRAHTPQNIT
FT                   VAALETLRTTLAGWLTQHICKIDVALRQTT"
FT   gene            complement(459793..460713)
FT                   /locus_tag="Mrub_0474"
FT   CDS_pept        complement(459793..460713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0474"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="PRIAM: tRNA (guanine-N(7)-)-methyltransferase; PFAM:
FT                   putative methyltransferase; Methyltransferase type 12;
FT                   InterPro IPR013217:IPR003358; KEGG: lch:Lcho_1911 tRNA
FT                   (guanine-N(7)-)-methyltransferase; COGs: COG0220
FT                   S-adenosylmethionine-dependent methyltransferase; SPTR:
FT                   Q5SHW1 tRNA (guanine-N(7)-)-methyltransferase; PFAM:
FT                   Putative methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27251"
FT                   /protein_id="ADD27251.1"
FT                   /translation="MLIRLGETEFPLPAAPQVLEVGFGDGRFTAQVARLHPQWRILGVE
FT                   ISAGSVARALKRLRREGITNVQVYHGTAGFALRNLIAPQSLQRVYVNFPDPWPKSKHQE
FT                   NRLLQQSFFRRLSTRLAAGGELLLTTDHEEYWRFAQAEGRASGLFEIETPPPPEHHLTT
FT                   KYALKWKAQGRQFYHAVFRKVAEDPTPWPPLPRYPMPHALMSGTLPELESFEKTVVRFE
FT                   GGTAVLLEAARALGPEGGYYFHAHLEEEDLIQDVLLEVRPSAHGLYVGIGRFGAPLSTA
FT                   GVKAAVEWLVGWLEGQGLRVVQRSY"
FT   gene            460757..461431
FT                   /locus_tag="Mrub_0475"
FT   CDS_pept        460757..461431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27252"
FT                   /protein_id="ADD27252.1"
FT                   /translation="MVDVGLEQAFAKVRAFLEGDFEHPGLTLYDLQNLVGYNSRLKTDG
FT                   PLSYTMPPEPALSGVAAVRLYYYPKDPEVNLIVEIEDKTRKRHLRHFKWNGVSWTAARG
FT                   LKADLTATREVLPSIEEVGGDFFLGYASEEAKELAEAIRRGEAAGAKYMLCTRDNTRIF
FT                   YAPTSSPPAVPCPRCGNTNMIFKTLTLATPEDRIEAILREQRALRTALEDLLLYLKRKL
FT                   GP"
FT   gene            461643..464366
FT                   /locus_tag="Mrub_0476"
FT   CDS_pept        461643..464366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0476"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; SPTR: A3LJB1 Pyruvate dehydrogenase;
FT                   InterPro IPR004660; COGs: COG2609 Pyruvate dehydrogenase
FT                   complex dehydrogenase (E1) component; KEGG:
FT                   aba:Acid345_2792 pyruvate dehydrogenase subunit E1;
FT                   TIGRFAM: pyruvate dehydrogenase E1 component, homodimeric
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27253"
FT                   /protein_id="ADD27253.1"
FT                   /translation="MVEDRELIAARAELSAEEQVKLEDLENQEWRESLEYVLRTAGRDR
FT                   VAQLMEMLENYAYRNGVVIHDKVNTPYVNTISLEHQPPYPGDLELEQRIANILRWNTIA
FT                   IVQQANKKSDGIGGHIATYASIAELMEMGFNHFFRGHDAPDRDLVFYQGHMSPGVYARS
FT                   YLEGRLTEDDLGKFRRELLGGPGRGLSSYPHPWLMPDYWEFPTVSMGLGPIQAIYQARF
FT                   MRYLEDRGLKPKTNAKVWAFLGDGEQDEVETLGALRVAASEELDNLIFVINANLQRLDG
FT                   PVRGNSKVIQELESVYRGNGWNVIKVVWGSAWDELFAKDTEGVLLERMEQLVDGESQRY
FT                   AAYGGKELREKFFNTPALKKLIEGLSDEDLDRLTLSRGGHDNRKIYAAYKAAVEHRGSP
FT                   TVIIARTVKGYCLGPTAQAKNVAHQVKKLTLEDLREARDHLGIPIPDEDLEKTPFYHPG
FT                   KDSPEVRYMLERRKALGGLIPERRVREYRLKTPDLAFFEEFLAGSGGREISTTMAFVRM
FT                   LTKLVRHPEVGKYIVPIVPDEARTFGMEGVISSVGIYSPKGQLYTPVDAGTVTVYRESE
FT                   TGQLLQEGINEAGAMSSFIAAGTAYAHHGIPTIPFYIYYSMFGLQRVGDLVWAAADQRT
FT                   KGFLLGATAGRTTLNGEGLQHEDGHSHVLALPVPNMPAYDPAFAYELAVILQDGMKRMY
FT                   QDGEDIFYYITLMNENYVQPAMPEPREETRQGILKGLYLFKKSELKKPKARVQLLGSGT
FT                   ILNEVIKAAEMLERDYGIAADIWSATSYKTLYYEALETARTNRLNPSSKPRLSYVAQCL
FT                   NPTEGPIVAASDYMKALPDLLSGYLNRPIHSLGTDGFGRSETREALRDFFEVDAKHVVI
FT                   TALSALRGEGKVSASTFTEAIKKLGIDPKREHPHKR"
FT   gene            464402..465697
FT                   /locus_tag="Mrub_0477"
FT   CDS_pept        464402..465697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0477"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; SPTR:
FT                   A4LDI0 Pyruvate dehydrogenase complex E2 component,
FT                   dihydrolipoamide acetyltransferase; InterPro
FT                   IPR004167:IPR000089:IPR001078; COGs: COG0508
FT                   Pyruvate/2-oxoglutarate dehydrogenase complex
FT                   dihydrolipoamide acyltransferase (E2) protein; KEGG:
FT                   noc:Noc_1255 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2; PFAM: e3 binding domain; 2-oxoacid
FT                   dehydrogenases acyltransferase (catalytic domain);
FT                   Biotin-requiring enzyme; TIGRFAM: pyruvate dehydrogenase
FT                   complex dihydrolipoamide acetyltransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27254"
FT                   /protein_id="ADD27254.1"
FT                   /translation="MAELKLPDLGDNVTSAVVVGVLIKEGDTIAAGQPVLELETDKAVM
FT                   EAPASEGGTVSKVLVKPGDEVKSGQVIAVLGDAAPSAEKQEPKEKQEPKEEKAAPAPAP
FT                   TPAPAATPSAPAAAPRPPASAAPAGQRRLIPAAPSVRRLAREMGINLMEVVGSGPAYRI
FT                   SENDLKRFAAGEAPTTAAPQPSSAPALPDFSKFGPVRREAMSGVRRATVRSMAQAWSTI
FT                   PMVTHFDRADITEMEALRKRMAPRAEQRGAKVTMTAILLKIAAAALKQFPKFNASIDTA
FT                   SNEIIYKDYIHIGVAVDTPTGLLVPVVRDVDKKGVIALAKELGEIAAKARERKLTPEEM
FT                   QGATFTISNLGGIGGTGFTPIVNWPEVAIMGVSRSSMEPVWSAEKGVFEPRNIMPFSLS
FT                   YDHRLIDGADAARFCRFVAELLEDPFLLGFEG"
FT   gene            complement(465747..466370)
FT                   /locus_tag="Mrub_0478"
FT   CDS_pept        complement(465747..466370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0478"
FT                   /product="cytidylate kinase"
FT                   /note="TIGRFAM: cytidylate kinase; PFAM: cytidylate kinase
FT                   region; InterPro IPR011994:IPR003136; KEGG: dds:Ddes_0760
FT                   cytidylate kinase; COGs: COG0283 Cytidylate kinase; SPTR:
FT                   Q5SL35 Cytidylate kinase; PFAM: Cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27255"
FT                   /protein_id="ADD27255.1"
FT                   /translation="MTEIITIDGPSASGKTSVAQRVAQHLGIPYISSGLLYRAVALMCL
FT                   LENVSAEEVETRLAKHRLELQPTPTQNLVFLDGREVSKALHSLEVDQIVSAVAVRPAIR
FT                   EYVNQVLRQIPPPFVVDGRDMGSAVFPQARYKFYLTASPEVRAQRRVPERGAAFDTVLT
FT                   EIIRRDEADKRQSDPARDAIILDTSHLDLDGVVQRVLEHIHPLS"
FT   gene            complement(466418..467698)
FT                   /locus_tag="Mrub_0479"
FT   CDS_pept        complement(466418..467698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0479"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="SPTR: Q72LH1 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; KEGG: ppd:Ppro_1347
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; COGs: COG0128
FT                   5-enolpyruvylshikimate-3-phosphate synthase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase);
FT                   TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase;
FT                   PRIAM: 3-phosphoshikimate 1-carboxyvinyltransferase;
FT                   InterPro IPR001986:IPR006264; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27256"
FT                   /protein_id="ADD27256.1"
FT                   /translation="MERLIPPTPSLKGTLRVPGDKSVTHRGLMLGALAQGESTLYYPLK
FT                   AGDTLSTAQVMRQLGAEITEQGQHFHIKGVGLRLKEPGDVLDCGNAGTLMRLVAGLLSG
FT                   QETFAVLTGDASLRRRPMGRVTLPLRQMGARIEGRENGQLAPLAIRGGGLRGIHYELPV
FT                   ASAQVKSALLLAGLFAEEDTEVVEPAPTRDHTERVFRHYGLPIEVEGRLIRTRRAEPFA
FT                   AKDLTVPGDFSSAAFFIVAALITPDSEVTLEGVGLNPTRTGLLTVLKEMGADLSWEVTE
FT                   GQDGEPVGWIRARSSQLRGVVVDPQLIPLMVDEVPILAAAAAWAAGETYIPGLEELRVK
FT                   ESDRVAAIAKNLQNLGVPVEAGPDWLRIRGGHVAGGGLVEPFHDHRIAMAFAVCGLPKG
FT                   VTVQDAEWASISFPSFWEDLERLAGKK"
FT   gene            467834..468811
FT                   /locus_tag="Mrub_0480"
FT   CDS_pept        467834..468811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0480"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; SPTR: A6DBB0
FT                   Exopolyphosphatase-related protein; InterPro
FT                   IPR003156:IPR001667; COGs: COG0618
FT                   Exopolyphosphatase-related protein; KEGG: phosphoesterase
FT                   RecJ domain protein ; K06881; PFAM: DHHA1 domain; DHH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27257"
FT                   /protein_id="ADD27257.1"
FT                   /translation="MDDAHNAPEPRYWEKIRTVADTLRELEGPIIVVSHVDPDGDAIGS
FT                   SLGLFRALQALDKKVTWIADPPRFLRFLVREDEYSDPIQHVPEGATLVVLDSAEPSRVA
FT                   GAPVEGFVINIDHHGTNPRFGYLSVVDPSKAATAQIVKDLIDALGVTWTPEIATPVLTG
FT                   LITDTGNFRFANTTPEVLHTAAELVGYGVRLAELTDRLQWRPVSYFKVMGAVLSTVGFH
FT                   FGGLLVTAHMPSGINVEDSDDFVGIIRYAEGSQIAVFLREREEGVKISIRSRGGVSAQA
FT                   VAVKLGGGGHVPAAGATLRGLTLEEAYPRVLAAVEEELRRAGYL"
FT   gene            469172..470440
FT                   /locus_tag="Mrub_0481"
FT   CDS_pept        469172..470440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0481"
FT                   /product="O-acetylhomoserineaminocarboxypropyltransferase"
FT                   /EC_number="2.5.1.49"
FT                   /note="PRIAM: O-acetylhomoserine
FT                   aminocarboxypropyltransferase; PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aminotransferase class-III; InterPro
FT                   IPR005814:IPR000653:IPR000277:IPR002155; KEGG: hypothetical
FT                   protein ; K01740 O-acetylhomoserine (thiol)-lyase; COGs:
FT                   COG2873 O-acetylhomoserine sulfhydrylase; SPTR: A4CV58
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27258"
FT                   /protein_id="ADD27258.1"
FT                   /translation="MDFSSLAVLSGLPQQDPHNAVGVPIYATAAYGFADLEDGAHKFAT
FT                   NQGYTYTRLQNPTVAALEARLTALEGALGAVCLASGQAASFAGLLALVRAGDEVVASPG
FT                   LFGGTVGLLNQVFGLMGVRVHFVAPEVAAVQAALNEKTRAVFVEVLGNPSLELPDLQGL
FT                   AELCEAHRVALVVDNTFGAVGALARPLEHGAHVVVHSLTKWASGHGSILGGAVLSRETA
FT                   LWQHYPQFTSPDAQGKIPWEQFGARCFLERVRQLGLSLGGMVLSPFNAYLLFQGLETVA
FT                   LRIERASQTALTLARWLESQPQVAWVRYPGLPTDPAHPRATQYLRGGFGSILTFGIRGG
FT                   LEGASRFLANLKIIQAPNVGDARTLAVHPWTTTHSRIPEAARRAAGVGPETIRLSVGLE
FT                   SPQDIQQMLLEALASVEQVGHEG"
FT   gene            470430..471305
FT                   /locus_tag="Mrub_0482"
FT   CDS_pept        470430..471305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0482"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   PRIAM: Methylenetetrahydrofolate reductase (NAD(P)H); PFAM:
FT                   methylenetetrahydrofolate reductase; InterPro
FT                   IPR003171:IPR004620; KEGG: mxa:MXAN_3039
FT                   5,10-methylenetetrahydrofolate reductase; COGs: COG0685 5
FT                   10-methylenetetrahydrofolate reductase; SPTR: O67422
FT                   5,10-methylenetetrahydrofolate reductase; PFAM:
FT                   Methylenetetrahydrofolate reductase; TIGRFAM:
FT                   5,10-methylenetetrahydrofolate reductase, prokaryotic form"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27259"
FT                   /protein_id="ADD27259.1"
FT                   /translation="MKVSTLLQSGKPLFSFEFFPPKTPRGEAALFRTLHELKPLKPAFV
FT                   SITYGAGGSERNKTAEWAARIQNEVGLPAMAHLTCVGSTREELLARLHEYARAGVENIM
FT                   ALRGDPPQGAREFQPVAGGFRYAAELVALIRAEFGDRFTVAGGAYPEGHIEAVSLEADL
FT                   RHLKQKVEAGLDFVVTQLFFNNALYFGFVERARRIGIQVPIVPGLMPITDLAQVRRFMD
FT                   LCGASIPGPLLSRLERAQSPEEVLEIGVEHATRQAQELLEAGAPGLHLYTLNKSPATRR
FT                   VMQNLQMVLR"
FT   gene            471414..472565
FT                   /locus_tag="Mrub_0483"
FT   CDS_pept        471414..472565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0483"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; SPTR:
FT                   O28179 Alcohol dehydrogenase, zinc-dependent; InterPro
FT                   IPR013154:IPR013149; COGs: COG1063 Threonine dehydrogenase
FT                   and related Zn-dependent dehydrogenase; KEGG: sfu:Sfum_2251
FT                   alcohol dehydrogenase GroES domain protein; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27260"
FT                   /protein_id="ADD27260.1"
FT                   /translation="MRGLLFTPSVPRYVAARLLGKRYPSRALSLQLVTLPEPERPAGFE
FT                   RLKVRLSGICGSDLALLYGKQAPTLSGMFSFPAILGHEILAELGGVRVVVNPVLACLER
FT                   GLPDCPACARGDDHLCFNVAEGNFGPGMLGFCKDLGGGWAQRMVAHRERIFPIAESVPD
FT                   ERAVLAEPAAVVLHGLRQAWGEGKPWPNPAVHRMHWPAQILVIGAGTIGLLAVKMLRVL
FT                   GFEGPLWAVARHPRQAELARQLGASQVFPSAQAAQQAAGARRYRGILGSTAWRGGFEGV
FT                   VEASGSPRGLQEASWAVQEGGRVLLLGAPATALHDFSPYWFREVGLVGSYAYSWDDFAQ
FT                   AVKLLPELEGVEAMVTHKFGLEAWPEAIKTAATRRGIKVVFKP"
FT   gene            472719..473117
FT                   /locus_tag="Mrub_0484"
FT   CDS_pept        472719..473117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27261"
FT                   /protein_id="ADD27261.1"
FT                   /translation="MTGDKSVRDWAAIALGAVVLLGFAALVVYMLGLLTADETTWGRAL
FT                   YLFAGVEAIAFAAAGYLFGREVHRARAEQAEARAHHAEEQWQRWSRRALEAEAKGQSLS
FT                   TTIALWAQQHPELAPAAQMAQRLFPDRP"
FT   gene            473161..473571
FT                   /locus_tag="Mrub_0485"
FT   CDS_pept        473161..473571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0485"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; SPTR: B2YI78
FT                   Putative acetyltransferase; InterPro IPR000182; COGs:
FT                   COG0456 Acetyltransferase; KEGG: csa:Csal_2683 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27262"
FT                   /protein_id="ADD27262.1"
FT                   /translation="MPIREFRMADYTSVLALWQGAGLELNPSDSFEGLQKKLERDPDLF
FT                   LVVEEDGQILGALLAGYDGRRGWLYHMAIHPFGQGQGWGKRMMEELEARLKAKGCQKLN
FT                   LLVEPSYTGAQDFFERLGYRRDDLIFMEKWLD"
FT   gene            473619..474695
FT                   /locus_tag="Mrub_0486"
FT   CDS_pept        473619..474695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0486"
FT                   /product="calcium/proton antiporter, CaCA family"
FT                   /note="TIGRFAM: calcium/proton antiporter, CaCA family;
FT                   calcium/proton exchanger; PFAM: sodium/calcium exchanger
FT                   membrane region; InterPro IPR004837:IPR004713:IPR004798;
FT                   KEGG: mca:MCA0142 calcium/proton exchanger; COGs: COG0387
FT                   Ca2+/H+ antiporter; SPTR: A3INU4 Calcium/proton exchanger;
FT                   PFAM: Sodium/calcium exchanger protein; TIGRFAM:
FT                   calcium/proton exchanger (cax); calcium/proton exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27263"
FT                   /protein_id="ADD27263.1"
FT                   /translation="MAPMWNYILLGFVPLAVALEVLHAPAVWIFLVSALALLPLAGLMG
FT                   RATEELAARAGSTVGGLLNATFGNAAELIIAIVALLAGKIEVVKASITGSILSNLLLVL
FT                   GLSIFMGGLRHSTQRFNAQAAGVMTSLLTLTLIAFLLPAFFDLAERGFFKVLDPALPDQ
FT                   MFSLATAGVLILIYLANIYFSLRTHKDMVSGLSDEAHHEAHWSLPVAVGVLAAATVGVA
FT                   VMAEFLVGSLEEATQALGLSEFFVGIILIPLVGNAAEHFAAVVFAMKNKMDLAVQIAVG
FT                   SSLQIALLVAPILVIVGYLAGRPMDLVFQNPLELAALAASILATNAVVRDGESHWLEGV
FT                   MLLGVYALLGFAFFFTPK"
FT   gene            complement(474705..475094)
FT                   /locus_tag="Mrub_0487"
FT   CDS_pept        complement(474705..475094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27264"
FT                   /protein_id="ADD27264.1"
FT                   /translation="MLVLVGYGLWANTHLRGLWFVGLGLFCNALVIFANRGHMPVSSEA
FT                   LYRVGLESYIPKLQQQYDAVHTLMDGSTQLWFLADIIPVRVLGYTNVISLGDVYLMVGI
FT                   ALTIVGGALESKRKAQEPINIDLRF"
FT   gene            complement(475184..476572)
FT                   /locus_tag="Mrub_0488"
FT   CDS_pept        complement(475184..476572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0488"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   InterPro IPR006674:IPR003607; KEGG: gme:Gmet_2559 metal
FT                   dependent phosphohydrolase; COGs: COG3437 Response
FT                   regulator containing a CheY-like receiver domain and an
FT                   HD-GYP domain; SPTR: A1HRL7 Metal dependent
FT                   phosphohydrolase; PFAM: HD domain; TIGRFAM: uncharacterized
FT                   domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27265"
FT                   /protein_id="ADD27265.1"
FT                   /translation="MPPLRVLLFLLVLLAAFAGLLYLLLPFGPYAPNPLDLVFWAALIV
FT                   IARRAHVALPFSASMSHAFVVALAAVTLFPPWLAAGLVFVFSFNRDFGRPGYTWYKDLF
FT                   NRTQSGLATSLAGLAWGWAQAHLGAHPYLQEAAGILVASLVYFFVNVGSVTYVIHLASG
FT                   ASLRKVWFENYSWLWVSYLLQAPIGLLLAKAYQTPLIWGWGGFTVLFMMLLLYFSRFYW
FT                   DEKVKIEAAFDDTIEVLVAALDAKDPFTRLHSERVAAIAGSIAKRMGFDEQDVKRITYA
FT                   ARIHDIGKVAIPDSILLKPGKLTPEEFELIRSHPKKGLEVLHPMRSRLPQEVQNVIVHH
FT                   HERWDGSGYPSRLREEQIPLWARIVALADAYEAMTAGRAYSPAKTPQEALNEIIMQAGR
FT                   QFDPQLVRHFEALWLESPIWKDRGEFLRRYTLPAHLSAWPSPSHSGPASATSPTSSSDR
FT                   PGPS"
FT   gene            complement(477005..477349)
FT                   /locus_tag="Mrub_0489"
FT   CDS_pept        complement(477005..477349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27266"
FT                   /protein_id="ADD27266.1"
FT                   /translation="MKQAAILIMTSERNPSGLRTTTGTGWSKLYLAADYYLDLSYKQNG
FT                   QQAFLVGQVLHEDGVSFSTGTATLLNPQGVPLQTTELTPKAGFRLAVGDLTAHRLELTL
FT                   DQTTFDIALS"
FT   gene            477485..478153
FT                   /locus_tag="Mrub_0490"
FT   CDS_pept        477485..478153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0490"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; InterPro
FT                   IPR007630; KEGG: nar:Saro_3770 regulatory protein, LuxR;
FT                   PFAM: Sigma-70, region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27267"
FT                   /protein_id="ADD27267.1"
FT                   /translation="MPKKTPGQYFLSKGISPSQLADRLEQLYPLEREVLLARASGETLR
FT                   AIGGRLDLTPEGVRQVEIRALKKLREEDDTAQIQGRRFRLAVEQRLGVPLEKAVEGLPE
FT                   PQPMLVLAYARGEPLADLAPTLGLSITEATALRDQAVACLLGEDRGSRAGKWAELKAAV
FT                   AAALIESPLTYDDLEARFPMSRRRLMKLMQELVNEGRAELSDEYPFRFLGVKPPQRALD
FT                   "
FT   gene            complement(478227..478303)
FT                   /locus_tag="Mrub_R0010"
FT   tRNA            complement(478227..478303)
FT                   /locus_tag="Mrub_R0010"
FT                   /product="tRNA-Val"
FT   gene            complement(478352..478426)
FT                   /locus_tag="Mrub_R0011"
FT   tRNA            complement(478352..478426)
FT                   /locus_tag="Mrub_R0011"
FT                   /product="tRNA-Cys"
FT   gene            478591..479946
FT                   /locus_tag="Mrub_0491"
FT   CDS_pept        478591..479946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0491"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; SPTR: Q8TGY9
FT                   2-phosphoglycerate kinase; InterPro IPR005144; COGs:
FT                   COG2074 2-phosphoglycerate kinase; KEGG: hypothetical
FT                   protein; PFAM: ATP cone domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27268"
FT                   /protein_id="ADD27268.1"
FT                   /translation="MMAGLKMEPAMSVAHTIEEQLRSRKKPEVTALALKKMLIQEVEKN
FT                   FGPEMAERLRGQTQAFEDIVVREGYRRRPFSKGVLVRSLEDAGFSMREAQTIARSLENR
FT                   LRRSGVRSIDADELERRIAAEIEELFGPAARNRYAGRQALAGEIFVEEGEGEPRVPFSK
FT                   GVLAQSVMAVGLSPDAAYRLARDVERRLRDSGSTVVKRDYLRKAVSEELMEEAGEEVAR
FT                   RYHLLRSIRRAVKPVHLLIGGVAGVGKSVLASALAYRLGITRMISTDAVREILRATIPK
FT                   DLLPTLHTSSFESWRVLATPQKAEPSAALVMQGFRDQVSRVAVGLRAIQERSAREKTSL
FT                   VVEGVHVVPGYMTHQYQHEVIQIPIMLVLEDEALHRDRFALRERETGGSRTSGAYAQYF
FT                   SEIRLIQQHLIELARGAGVPLIPAENLDRAIDKGLEVIVDRLQEAYFDVVQG"
FT   gene            479999..480934
FT                   /locus_tag="Mrub_0492"
FT   CDS_pept        479999..480934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0492"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; SPTR: A0ZD71 Putative
FT                   uncharacterized protein; InterPro IPR001395; COGs: COG0667
FT                   oxidoreductase (related to aryl-alcohol dehydrogenase);
FT                   KEGG: hypothetical protein; PFAM: Aldo/keto reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27269"
FT                   /protein_id="ADD27269.1"
FT                   /translation="MSEQIQIKGLPAIPPLGIGTWQWGDRLVWGYGNGYQAGDTEAAYR
FT                   AALQGGVRLFDTAEFYGFGLSERLIGRYRQAYEPKPLVVSKLFPYPWRFSRKTLFAALK
FT                   KSLQRLQMQQLDLYLLHWPWKPVPLEQWALSLAEAYEQGLTRAVGVSNHNLQQLERVAK
FT                   VLDQHRVPLAVNQVEYHLLERKPERTGLLRAMQAEGIVLMAYSPLAMGWLTGKYGLDNP
FT                   PPGRYRAQRYVTRKAQIPALLQALNEIAESLGATPAQVALRWCIQKGTLPIPGAKNACQ
FT                   AEGNAGALRICLSEAQMARLDALSGGEGPG"
FT   gene            complement(480931..481833)
FT                   /locus_tag="Mrub_0493"
FT   CDS_pept        complement(480931..481833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0493"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; SPTR: A6N7U0 Probable
FT                   glucokinase; InterPro IPR000600; COGs: COG1940
FT                   Transcriptional regulator/sugar kinase; KEGG: mlo:mlr7234
FT                   glucose kinase; PFAM: ROK family; TIGRFAM: ROK family
FT                   protein (putative glucokinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27270"
FT                   /protein_id="ADD27270.1"
FT                   /translation="MSVVGIDLGGTKIMAGVFSEGVIKTKVTVPTPEEGGQAVIEAMAQ
FT                   AAKAAIEASGVAVQAIGLGTPGPLDFKRGRIKFAPNIANFTDFPIVERLEQATGYKVYM
FT                   ENDANAAALAEHKLGAAQGAESTLYMTVSTGVGGGFVWGNKVLRGVNGQGGEIGHITMQ
FT                   PGGPSCGCGLDGCLEALATGPAMERMALASFKREMNTRELFALFQQGDPRASRIVLQAA
FT                   SWVGIALASLVKCYDPEVVVLGGGVALNAGPAYLEEVQRSYQRYMENWITPPLHLAKLG
FT                   SEAGLLGAALTAAIEVGEL"
FT   gene            complement(481830..482099)
FT                   /locus_tag="Mrub_0494"
FT   CDS_pept        complement(481830..482099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27271"
FT                   /protein_id="ADD27271.1"
FT                   /translation="MNDAVDPSLPRRRIGEVSYVLFLSAPRVVAEGLKARLEVHQIPVH
FT                   LETPFSLPEAYMGTYTGDVSLWVPEALYHEATLILERDHQGEAS"
FT   gene            482249..483238
FT                   /pseudo
FT                   /locus_tag="Mrub_0495"
FT   gene            complement(483240..484778)
FT                   /pseudo
FT                   /locus_tag="Mrub_0496"
FT   gene            complement(484775..485491)
FT                   /locus_tag="Mrub_0497"
FT   CDS_pept        complement(484775..485491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0497"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; InterPro
FT                   IPR001387; KEGG: oca:OCAR_4515 transcriptional regulator of
FT                   XRE family; SMART: helix-turn-helix domain protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27272"
FT                   /protein_id="ADD27272.1"
FT                   /translation="MPKKSFRTASLTPENVTPDWGRLLQTRREKLGLSREALALAAGVS
FT                   PSLIAKLEQGNHDLRDVSVGRLHALLRTLHLPSIDFLLGEGPTEEFTPSAPGITPLPYY
FT                   SSLTLACAGEEASTRSHFDTRLLPTRPSYTNFFLAILEQDVLRSEDLSLVEGSVLVVER
FT                   KPARERGIALLGFVEEIRRPLLYRLPPEPRLVRPVSGMGAVYWLLPDGSLQPPSGKKAA
FT                   MYPVPVGVIHGEFRHV"
FT   gene            485554..485808
FT                   /locus_tag="Mrub_0498"
FT   CDS_pept        485554..485808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0498"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; InterPro
FT                   IPR001387; KEGG: plu:plu3715 hypothetical protein; SMART:
FT                   helix-turn-helix domain protein; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27273"
FT                   /protein_id="ADD27273.1"
FT                   /translation="MERPNIIRRLRKQAGLSQEALAVEAGITVSLLTKYERGEVRRPSL
FT                   VCSRKLARALALRLGVSEERLLMRIAEEFECQPSDDASA"
FT   gene            485893..486333
FT                   /locus_tag="Mrub_0499"
FT   CDS_pept        485893..486333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27274"
FT                   /protein_id="ADD27274.1"
FT                   /translation="MRRAHQNTMQMERDLFLLIPRHKGLALSLPAGRITELLRFAQGML
FT                   ARLPDTRPAPDIAVELEGMGMMLHPLALLPDPIRELLEMTGRARCVCQALGIEMGGRLL
FT                   VSVGLAWLEVQVWRGESLEVLCHELEEETDDEGRPDPVHRGR"
FT   gene            486347..487234
FT                   /locus_tag="Mrub_0500"
FT   CDS_pept        486347..487234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV1_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27275"
FT                   /protein_id="ADD27275.1"
FT                   /translation="MAELWPESGARPGKAGICRAVWRGDTHPSLSLFQARGVWFWKDHA
FT                   TGESGNAFHLLLKAGMSKEAAAALLKARAGSGGGAVTHEASIKCRASPRPVRGLTPTER
FT                   RALEAAQQRLDEEAIRGRGITLEQARRVGLGKSRQGDLVIPILGPTGEVQAIKARLREP
FT                   REGFRYRYLTPERGAPAWYSPGFGQDAGRPVIVMEGELNAITSWFALEGRADLLGIPGV
FT                   EGRVPWEGLTGRRVYLYADGDPGGRRAIERWKEEGQAGGVAMFVLEPLEGGLDACEYAA
FT                   RWGQQGLAGQLLQE"
FT   gene            487279..489222
FT                   /locus_tag="Mrub_0501"
FT   CDS_pept        487279..489222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_3672 superfamily II helicase; SPTR:
FT                   A3V916 DNA primase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27276"
FT                   /protein_id="ADD27276.1"
FT                   /translation="MVKSIPPVHQDFISPVELEEVLPGHPRYRIQQGRIEMARLEGRGE
FT                   HRTVVYVPLCNFACRIRREVRYTDGVQDELLFELEGSTAAGPLPSARVRSSEFAAMHWP
FT                   VREWGARAIVTPGHGVKDHLRAAIQHLSTPEQATVYAHTGWVRQGGDWVYLHAGGGIGP
FT                   EGSVEGLEVDLPPELSGFALPQPPTGEAEPEAHRRLLAMLEAGPRRVTWPLLLYALGAP
FT                   INHPLGSLYVAGLTGARKTSLALLVQALWGHTAPHPPTNWEGTANALEALAFAAKDALL
FT                   LIDDYAPTGHEGKQKELQGKAARILRNQGNATGRARMRSDGRMQPDRAPRGSLLVTGED
FT                   LPPGHSVRARCLILELTPGEVNLEALTRLQNQAAGFPLALAAWVRWLAGRLEGVRQQVR
FT                   LRTGELRSCYPAAHGRTTDALARLQAVWEIVRAYWLEVGVISPAEAERFTREVEAVLHE
FT                   VGEAQQGYQSDMNPVERFIPLVLGLLSSGRAHLGNRHDAQTPPAEPERWGWQARADGWV
FT                   PQGPLVGWVDAQGIYLEPTAAYAALNRLAAESGEPLPTPRTLWKRLGERGVIRSQQRGG
FT                   RVRYGVGVRIQGTTRDVVQIPGGVLAKTPNSPNMGQNTVLDDTKDVGRKPAVGSSVCPN
FT                   GEGEVGAYEVEL"
FT   gene            489515..489871
FT                   /locus_tag="Mrub_0502"
FT   CDS_pept        489515..489871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27277"
FT                   /protein_id="ADD27277.1"
FT                   /translation="MSPWGVLLRMVPEVTAKLKGLGCRRLRWLVDGEVVYWALLVPEEA
FT                   DLEAHARFPGMPQQSLEGWLRELLERFEAGWPQARVVEILGVWPDRLERVVRVFPKGPG
FT                   VSLSEECYADPSSG"
FT   gene            489849..490205
FT                   /locus_tag="Mrub_0503"
FT   CDS_pept        489849..490205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27278"
FT                   /protein_id="ADD27278.1"
FT                   /translation="MLIRPRAKIVALSLRMPPGAIVVRACHDAELFLSRPVEAGGEVWR
FT                   EVRVREREGFRTLYELVAEGRFEERLLKSRVQFEKIQEGSRVYYVWRLGRPRGVSDKEV
FT                   DGLDLEAERDDWRA"
FT   gene            490168..490416
FT                   /locus_tag="Mrub_0504"
FT   CDS_pept        490168..490416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27279"
FT                   /protein_id="ADD27279.1"
FT                   /translation="MILKLNGMIGEREVFRSYRGLGEWFVRQPNIHTFQAVHRAEDGRE
FT                   TVIGSYASFDEAFWAADRAADEAHQEFVGEAEDGLPF"
FT   gene            490539..491357
FT                   /locus_tag="Mrub_0505"
FT   CDS_pept        490539..491357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_0183 2-oxoglutarate dehydrogenase, E2
FT                   subunit, dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27280"
FT                   /protein_id="ADD27280.1"
FT                   /translation="MKVISYCKQLALVFMLLTPLAMGQSVLKTYYADDLTRVPGVIEVS
FT                   PGFTTVLDFWDTVSTLASAKGELLRVESAGPRILVSATQKAGQTDLVVEVAGRTLLFTL
FT                   KIGPGVGPRRYVIELSRRSSVSAPASAYVPPASPAPSSPAPQAAQPPQSAPLNPEAVRF
FT                   TTTAQVPSDGKGTVTIFFTLENRGNRTLAADPGRLVITQGGNRLSYSLKREPLKTLVNP
FT                   GEALSGLITLEGARAGEIGLEWGLVEIGSGRQFALKRSVMAGTRIELEGR"
FT   gene            491411..491920
FT                   /locus_tag="Mrub_0506"
FT   CDS_pept        491411..491920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27281"
FT                   /protein_id="ADD27281.1"
FT                   /translation="MLVEEVLERIPRATFYDLVKRKYLVIVPTVIGRAVVVGPRGRVEV
FT                   LSMTRFYRPRATAVADAVLLRRAIRIAEREGWRFVGRNPRGRIAFMGRNGERLMLIASL
FT                   RAYSTRSLRNTLKRMGWYSRRKQGEAEGVRVYHPYPRRFDRMVKEGGLEVRALSEILPP
FT                   DVDAEE"
FT   gene            complement(491995..492252)
FT                   /locus_tag="Mrub_0507"
FT   CDS_pept        complement(491995..492252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27282"
FT                   /protein_id="ADD27282.1"
FT                   /translation="MYKVTTFRLLNARGVKVIRFTDLSDSAGRKLLDRGAIFDRSTADL
FT                   AEEVSVSAIEPVIVEEHEFLPGDEILIPTARGWFLGRVAE"
FT   gene            492439..492729
FT                   /locus_tag="Mrub_0508"
FT   CDS_pept        492439..492729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27283"
FT                   /protein_id="ADD27283.1"
FT                   /translation="MQVADKVVLVTLYPDRPMSGAEAEEWAAGRLQAQLPLEAFEDGKP
FT                   LPPVAVVQEGQTVGFLEGARLLTDTHAGLRLVGVAGRWEGQNVSGMINLDG"
FT   gene            492722..493393
FT                   /locus_tag="Mrub_0509"
FT   CDS_pept        492722..493393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27284"
FT                   /protein_id="ADD27284.1"
FT                   /translation="MARGELDQLHNHALNEGVKMMGERYGLEAADGAIIRPTLEAAMEV
FT                   LPLPHQRFVQEHLDYYRRRFSVMEKEGAEAVLVVWSLEEPLVRMMGLGQMPDLVRLPWV
FT                   GSRPLRKDFRDAPVLTRQEALRQIAHILQAEGFTPQEEPVLLPPESDQLAVEVAARLRL
FT                   VAEGRSLEDTARLLVERNRARWEQEGEAPQAVAVVDVGGPLPVMLAFDDPRPLVWGGAV
FT                   A"
FT   gene            493561..494199
FT                   /locus_tag="Mrub_0510"
FT   CDS_pept        493561..494199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27285"
FT                   /protein_id="ADD27285.1"
FT                   /translation="MRVAVFPSFLTGDQIEAWLARGVTAELDRATVSDPSPRPVRLPVY
FT                   KGEEAGGVLEGRLVGLEEGVLVVEGTYEGLPVRVAVSREEIARQFDLEDTPLYLWRPLQ
FT                   LPEAAWAAWQADLARLGLLDRAGLLGAAKDGGPLCRAEPTPENAWVFWLAAWRFGSRVG
FT                   LDLGMRQEPFERAFAALKERLPELPEALLERSREALGWGKEELRELRAK"
FT   gene            494216..494455
FT                   /locus_tag="Mrub_0511"
FT   CDS_pept        494216..494455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27286"
FT                   /protein_id="ADD27286.1"
FT                   /translation="MRRDGERLILITSLRAYSTRSLKNTLKRMGWYSRSKQGEAEWVRV
FT                   YHPYPKRFDRMEREGGLEVRPVSEILPPEVNGEE"
FT   gene            complement(494528..494791)
FT                   /locus_tag="Mrub_0512"
FT   CDS_pept        complement(494528..494791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27287"
FT                   /protein_id="ADD27287.1"
FT                   /translation="MRLVILAEEPPAELRAQLTFFEVCTEEKLLSLTSLYPVKAAPRVL
FT                   PFLRLCGIEASEVGKSVRSGDLVAWPLPERPGRNSRWMLMLA"
FT   gene            494934..495611
FT                   /locus_tag="Mrub_0513"
FT   CDS_pept        494934..495611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27288"
FT                   /protein_id="ADD27288.1"
FT                   /translation="MRAELTDLFDRSLSSGVRMVAERYGLEAEAADGALTRPTLEAALE
FT                   AVPPPHQRFMQEHLDYYRRRLSVLEKERAEAALVVWSLEEPLVWLTGIVDMLEVERLPW
FT                   VRGRPLKEGFRDAPPLLTPGETLRQVVHILKAEGYTPREEPRLLPPEPHRLVEVVTPRL
FT                   RVIAQGRTLEESARLVVERTMTRWKEEGECPQAVAVVDVGGPIPVMLAFDDPRPLVWAE
FT                   AGA"
FT   gene            complement(495660..496244)
FT                   /locus_tag="Mrub_0514"
FT   CDS_pept        complement(495660..496244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27289"
FT                   /protein_id="ADD27289.1"
FT                   /translation="MFQVKTPLRGSERREILERIRTTIRCDLALSEGQLLRHYGVVPSE
FT                   KEAHEMGLFVVRAVLNPSHHANRLMEVRFYTPYLWVSRLGPPLLRHLAGVGEMRHILGA
FT                   AVGDWRTDTHRIHYREQPDAYWYSRLGPFAIEYDAGSYSLGLLQRKVQTFALRFVGQYW
FT                   GAPTERKAASLRERLAPFGLDGRFVLAAPWW"
FT   gene            complement(496210..497958)
FT                   /locus_tag="Mrub_0515"
FT   CDS_pept        complement(496210..497958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr0521 hypothetical protein; SPTR: Q4FX85
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27290"
FT                   /protein_id="ADD27290.1"
FT                   /translation="MRLDPEVKKQVEAALKNPVPPPTDPAFDELLLRLRKENPELADLL
FT                   ESGVLFDDLPTPEEETARAVARRSFFLSLKHRLLDRYDELTGEWVPSRPKQIAVGFLGL
FT                   VVATSLWFALSTRETKAAQGGLPLPVATAPKPTPAPEAPSAPETTQTQAGSTAAQDSPT
FT                   APGSEPGNAQGNAQSSASDSSSVPPPPSGYSEVPPPPSGYPASTPPTGTSTTGGVTQPA
FT                   PPQPLTLYAASPGAVQPASGGSTTAPTTGSNTNTATPASSQPLTLYTGGGSQGAQPLTL
FT                   SRPAAPSASGPSSRPITGSVAEDVAASLQGQPVPSASASASNAPGGGLTLKKETQSTFA
FT                   VRSVEGQGGQGGSFYLVGGPQAQAPVGTPPSAAAPSSVPGFPAQAPAFPPAQPSAPAAA
FT                   ATPPAAPYTLGTRLKGRLGVGVLIAEGTPGAVAIDAEDGSTWVGEVTLDETRRLKGKLT
FT                   RVIKDGREYAVSATLLDAEGTLGVAAKVREEAPSIAADLIRGSLRGVSDYVTAASQAKS
FT                   VTVLPGGGVAQSSQTPPLELFMAGSLANLFALQQDKKAVVRVAQAEKGTEVVILVVPGQ
FT                   DAATGK"
FT   gene            498013..498354
FT                   /locus_tag="Mrub_0516"
FT   CDS_pept        498013..498354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0516"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="InterPro IPR007039; PFAM: Conjugal transfer protein
FT                   TrbC; PFAM: TrbC/VIRB2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27291"
FT                   /protein_id="ADD27291.1"
FT                   /translation="MHKAAILAKRLAALPEVRGLLMGLVLVGMGNVAHAQAEQAFNNLT
FT                   IAICNIYNALRGPFGLALVVIMFAIGGISLMIGGKKAVPIMIGAAIGGVILAAAPSFAR
FT                   IFVSGTGCA"
FT   gene            498354..498662
FT                   /locus_tag="Mrub_0517"
FT   CDS_pept        498354..498662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27292"
FT                   /protein_id="ADD27292.1"
FT                   /translation="MRRRVYRLYQPITIVGLELWQLPVIGLGFVIGLRLMEGVHPAAGL
FT                   LSGALTGYLALTAAEKLRERYPGASLLHEALWLTQSDRYTPGKDQETTPLLIRNDHE"
FT   gene            498649..501186
FT                   /locus_tag="Mrub_0518"
FT   CDS_pept        498649..501186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0518"
FT                   /product="Type IV secretory pathway VirB4 protein"
FT                   /note="SPTR: A3EW83 Putative uncharacterized protein; KEGG:
FT                   ppd:Ppro_0253 sex pilus assembly protein; COGs: COG3451
FT                   Type IV secretory pathway VirB4 protein; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27293"
FT                   /protein_id="ADD27293.1"
FT                   /translation="MTTNSPTSLLNRPRERSLTEEFPYWEIHDGAMFLEDGRCEVGVEL
FT                   LLRPTLLLSQNELEGLLYMVRSVLRNGVPQGARARLVVEAAPAPQETVEAYGRAFDPSH
FT                   PTARFLQNERYRFWSDLWARGQVMTRRAFLTVLYGNKRPRRLPFGKAELAERVKEGGKI
FT                   RERIRMIAKGRGVAVQEMDSQEVFGLAYRYLNPGMRQAGVPRYRPTWQRYPRSAVEKIP
FT                   GLRPPTLRTQLVRSEVDNSHRDALYIGGKWASMFTLYTIPDETYTEMGDVLALAGGGEF
FT                   YLVVDVYHEPYEKALKALKARARRFYAASANTETYVDPNILVGQRETEGAIQHISQTGD
FT                   HVYRVGVALILIEKEREALERRASQVVGRLSEIPGNPFRQLKNGLFEPWKSRAPFSGGM
FT                   SDEVVSLLESNAADLIPLTGAWKGHEKPVALFHNRFLSLTRIDPFTPTTNNWNGIIAGG
FT                   SGSGKTFFTQYILSELLRRNEVDVVILDRGRNYEALVEAFEGAFIDIRPGGETAVNMFD
FT                   LDEGEHTPSPEKLQDVLRFLRAILPAGDDRTEEAVENAILEAAIEQTYKRASPDLPQPD
FT                   GTYRKVYQGARLSDLVQTLVLLDEVGSRPASPSEKEVARKLALRLQSWVGDSPKGQFLD
FT                   RPTSVPLARARVVCYELEGLKDDLEVIGTLLIADLVWKRAKKGQGRRVLVVLDEAWKVF
FT                   QSPYASQLIEELYRRFRFLGGGIWSITQSLADFAGEGPKALLQNTSFHFLLRLSGSDAE
FT                   HAVMRDVLGMPDRAIAVHARLTGVKGVYSEGLAWIRTGEGREGEVIVVRPNPVDYWMFT
FT                   TDKGEVARRRAAVQRYGDVIRAVRALAYGEEKT"
FT   gene            501183..502553
FT                   /locus_tag="Mrub_0519"
FT   CDS_pept        501183..502553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0519"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: aba:Acid345_1066
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27294"
FT                   /protein_id="ADD27294.1"
FT                   /translation="MRRLFLNLLFLLPGMGLAQNYYIDLSPTPVSVAPGKSAKSTLAVL
FT                   SEGFTGTLAIGITGLPAGVTYSPTSITVSDPRKNATVEVVFTAAANTPSGSSPARLTVG
FT                   AKTIFFSVVVDPAAEPPSQNPPALEALWNQVQQWGSTACATVNAFSLESVRWVCTLYRT
FT                   LDRAVGMWDEVRQDFDMLKREGFITGVSYLVNGLGAEMGLARGNVEADQLEQDFLAIRR
FT                   SYRQMVAKVSNWMTRVREKQVDAIRNNPYPNGSPSWWAVEAIKLNPNLLMAELGSLQRK
FT                   EQLLQLRTKVEANNAAAEKQVEAATNQTQDDLAKALQVTNPLPSQEGEAEQVVRRAREA
FT                   NSTREVLEILVDAQAKIMRQNLTNTQDVVGAVRQSAAQQAYTTRQIANLIEIELERRAD
FT                   EIESWKAEVERTMAQVSEEAESQTANLRMLATLSRTVACPDGVLGPGADGNITCLRP"
FT   gene            502564..504021
FT                   /locus_tag="Mrub_0520"
FT   CDS_pept        502564..504021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27295"
FT                   /protein_id="ADD27295.1"
FT                   /translation="MRWIPVLLTLVLLLVSGPALAEQPQVPPPSGTAQQQNLLQTVFDI
FT                   SRWLNSISRDIARLERGISALALALVMLGFVYGIVQGILGGGLEAIKGAFVRLAVAGLM
FT                   LSLWTSGFVGNTLDAAMTAARERGTDSVAATLSDAGDSLDALAMRVVPFMGAVGAVKVM
FT                   TAKTAENAAKNATTRSVASGTSAGSSKVLQYLNWATLLLIPLMLFFFILIVVASFTVEV
FT                   GVALFPLAAALLVFPKGSAADWFGKWVAAMMGALLIVVLLPVGFKAAVEIGINRPVNQV
FT                   NAYVDQAVDRLEAVKEKSEDALEQAKQSQKCLIVDPFCALEAKFDAVRTDLSLALQALQ
FT                   TVITAWLLGIILLLAGMAAAAYILFNVERVAMSFVGGFVATGVRQMLGTSSLGGRIYAG
FT                   RAGGGGGAGTERTVVLPGERALPAGGSPGALPAGGGSLPRPAAYEMQPYSSSIQRYGDD
FT                   VIEGEWRPVRELPNPSPRGLPPASSDS"
FT   gene            504034..504258
FT                   /locus_tag="Mrub_0521"
FT   CDS_pept        504034..504258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27296"
FT                   /protein_id="ADD27296.1"
FT                   /translation="MLNVSDLIEGKQLVGRWFTHQNHDCVVRAVEAVLESPGRAGKEVG
FT                   LWQLEVDGRVLERVYGTLDAATRRLAERL"
FT   gene            504255..506540
FT                   /locus_tag="Mrub_0522"
FT   CDS_pept        504255..506540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0522"
FT                   /product="Type IV secretory pathway VirD4 protein"
FT                   /note="SPTR: A4F5I0 Putative uncharacterized protein; COGs:
FT                   COG3505 Type IV secretory pathway VirD4 protein; KEGG:
FT                   sit:TM1040_3794 TraG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27297"
FT                   /protein_id="ADD27297.1"
FT                   /translation="MSVTRRQSLLEVPTSQKLLRFLGGLVMLSTLALAFGVGWQAALEV
FT                   AQGMLRAGWGAALKASSPAELILRCYGDLTGNCTEVMNGLWQKALPLDTLRMVVAGGFV
FT                   LGMIPFLIRPHRPRKLPGQGRWASASDLKGYLGEGTGWYGLFEGKPLRVPSMERRTGTL
FT                   VVGKPGGGKTTGYYQPNLLLDARDGWSAIVFDLKWPDEGGLMEAIRYYSHFGRAVYAYT
FT                   PFAPGSARIALLEGAENPQEASNIADIIVPRLADGGAEFYANLERMLLAGLIWVEGQEG
FT                   RYSLRHILELLRQGKEEIKAYAEVRPHLKDRIGAVMQTREDIIAGVVAGLAGRLALFEN
FT                   DHLDRSSLPGAGAVPWPRLFSEPSLLYIGIPQEHLEGGKATALLWLVKRILDREIHRAA
FT                   ARNGGTLKALTSVYLDEFTAFGKLPGIEDNLKTMRSRGAAFHVSVQNLANGRSVYGRDV
FT                   WESIQGTFGQQVYLLERLSEEDRKWLARTLGYETVVGYSRSASKMGFLSGSEGEGEREE
FT                   ARFLLSAEEMREVKKGETVVILDGKPPVRTYLGGMWEKKHPLHGLYEKARKAVPAVRAG
FT                   AARDRAYAEPQPRPASSSVEERQPEPERQPVELQPEERSLVQEASDPRSLEAYIRRLAS
FT                   TLPVFQRYYHKKTTTGIRFVLPAGFPPPETAWVREGWIEVRGKEELSVNLTSKGLETLE
FT                   KTFVAALVRWCRVREWARRQNQERQSLLYMSEEEAETVLREYAKQLPTEGGRVRVEISL
FT                   EALGDARA"
FT   gene            506527..506739
FT                   /locus_tag="Mrub_0523"
FT   CDS_pept        506527..506739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27298"
FT                   /protein_id="ADD27298.1"
FT                   /translation="MQGLEAQAFWQMLEHATWVVWDRQRRHCFVWLPGEGGRVFRYEGA
FT                   RAVQVAEGEEAVRMGRAMGVEDVAA"
FT   gene            506726..507217
FT                   /locus_tag="Mrub_0524"
FT   CDS_pept        506726..507217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27299"
FT                   /protein_id="ADD27299.1"
FT                   /translation="MLRLSLTVLFLLSSLAVAETSLSEAEVTRLIAAARSEVLLEMAVF
FT                   DDRSIAEGYRVAVAERGARGYILTRGDTAEIGASYLPWASILQGTGARLIAYTRGDYAV
FT                   VDRRVALIREVRMGLPVYRLEENPAQVAALVRQFVDAYAVGRPYRIDGLVQRLGARFLR
FT                   "
FT   gene            507220..507546
FT                   /locus_tag="Mrub_0525"
FT   CDS_pept        507220..507546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27300"
FT                   /protein_id="ADD27300.1"
FT                   /translation="MERFVRIAGWVGVIVGLSGVVPGAFLLRGSMIEFGMVLLLLGVLV
FT                   LWQAAALEELRATRAALSRMVLLMQRMSSNDATQISGYRMVPGDVTGSYGIVAEEENDA
FT                   AANR"
FT   gene            507527..508078
FT                   /locus_tag="Mrub_0526"
FT   CDS_pept        507527..508078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0526"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SPTR: A7VF24 Putative uncharacterized protein;
FT                   InterPro IPR006674; COGs: COG2206 HD-GYP domain; KEGG:
FT                   met:M446_0838 response regulator receiver modulated metal
FT                   dependent phosphohydrolase; PFAM: HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27301"
FT                   /protein_id="ADD27301.1"
FT                   /translation="MLLQTGRGYIIPQGEITLENCGHSERLLWLASWAATRFGLWGEFV
FT                   DAAQIHDAGKLYLPRYDLLRRPLKASELEVLRSHVALSWQHASKNGYSRTAQDVALMHH
FT                   ERWDGKGYILGRGKEEIPLSARVMAVLDAYDAMRSGRPYREALSPVEARREIRQGAGTQ
FT                   FDPQIAGLFLEYLEVEWPDC"
FT   gene            508063..508530
FT                   /locus_tag="Mrub_0527"
FT   CDS_pept        508063..508530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0527"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; SPTR: A3K1S2
FT                   Transglycosylase SLT domain protein; InterPro IPR008258;
FT                   COGs: COG0741 Soluble lytic murein transglycosylase and
FT                   related regulatory protein (some contain LysM/invasin
FT                   domains); KEGG: aav:Aave_2727 lytic transglycosylase,
FT                   catalytic; PFAM: Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27302"
FT                   /protein_id="ADD27302.1"
FT                   /translation="MARLLALLVLASCSWGLACGRIPPDLAGWAAYYARGYGLDPDLLV
FT                   ALVWVESRFCPDAVSPDGAVGLGQIMPATGRAIGISRERLSHPQWNLWGAARHLRQLWD
FT                   SFRDWRLALAAYNAGSGAVRRYRGIPPYPETQKYVRDVLWVYRWLKQNRKA"
FT   gene            508503..509459
FT                   /locus_tag="Mrub_0528"
FT   CDS_pept        508503..509459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0528"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; SPTR: Q5VMB3 Os06g0155600
FT                   protein; InterPro IPR003593; COGs: COG3854 conserved
FT                   hypothetical protein; KEGG: Os06g0155600; hypothetical
FT                   protein; TIGRFAM: stage III sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27303"
FT                   /protein_id="ADD27303.1"
FT                   /translation="MVEAEQKSLVRVHERFPEEFARLMERLPPWVRVEVEGHRDSLDEI
FT                   VLDLGKPLIYTAADQVYVLEGRTVSKDDLSYLTHRLGGFKENNRAGLEGTLHRISRIQD
FT                   AYGETVGVTIRIGRFVMGVAEALRPWLEQTGSLLVVGPPRTGKTTLLRDIVRILAGRYG
FT                   PRVAVVDTSNEIGGDGKLTHPGISPARRLQVPDPPSKNQGWVIYQAIANHSPEVVVADE
FT                   IGYNEDVFQCLTASRRGVRVVATAHGETILDLLENPVLLPILGDPVEGKRRSRPSFAMC
FT                   LEVRGKGKFVLYPDFAEALDTLLAGGEPEGLRLGRWD"
FT   gene            509459..511087
FT                   /locus_tag="Mrub_0529"
FT   CDS_pept        509459..511087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27304"
FT                   /protein_id="ADD27304.1"
FT                   /translation="MRWMLAVFILLGLGSALAQDPRYPETTRYLVSAPDYRLDRLTLLK
FT                   WPFIEVIRADRWKEHQAAKEGGKPAVAHEWRLPMSDLATTQEVARDLRRAWQRFEERYY
FT                   WHAITRLNNPALYAVYCWAGLKGPDLNPPLPEVRVDTPSGIVPQGFDPGLGWPQPAAQG
FT                   QHMLDAYWPIPQLDNEEFCDDLSLQILPLMYVPGFCIDIDAIGFSWCTPGYEGGEPLWF
FT                   NDAEAQKRVSDGIAHAVSAYYPDYQKDVLTALRPRVPTDLSNPTKLRVFAPMPWQAHVL
FT                   EGGAVVTPVMRTLDGLTPQNLVSEAQGIVSTLRQALPRLPEAERLAGTAYYYQAVRGLA
FT                   RLPFLAPVSNQLSGLIGGMDEQVMERALLALAAADEGSKLVGRDLFINSKNAPGAWRLE
FT                   ELKRWFPPSNPYIYERFGYLSFFQVWNRAEVSTVPDFRADRNPLGVAASLGMRALFYWW
FT                   VPVRIKVSLLPTPPFISLSGALDWPRPIPVAPYVLPFAGERTYWGWVSVPEGYEIPRVR
FT                   GTPGLGVSGVSIPGFGPEVYNILLR"
FT   gene            511091..511681
FT                   /locus_tag="Mrub_0530"
FT   CDS_pept        511091..511681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27305"
FT                   /protein_id="ADD27305.1"
FT                   /translation="MRWIYLPVLCLFLGGGSLAIDAKDFKTAYDLLRNGLCSLKITCLL
FT                   PKDMIYPADWQNDVEARLSRSREVLLIGDVQSLQPVIGYLDGWLRTSDPTRKQNRPQIF
FT                   AVVPQEQMVWFRGWTTNPELASFVKVVASSNENEPLGVVGRTGLPLVILDNQAVYMPTW
FT                   WQLEGPTLRQVLTWGRLLVDQIRSANQRRGEVK"
FT   gene            511678..512079
FT                   /locus_tag="Mrub_0531"
FT   CDS_pept        511678..512079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27306"
FT                   /protein_id="ADD27306.1"
FT                   /translation="MRLLALLLLLGMGLAQQQQQILFQTPSLAQAVGWVGSVGGQDALV
FT                   IGDLPDPAFARVLPSRTRVLVSGSLPGWVRTGMEVRYLKGLRGRGMLLIDRRYFVVNSK
FT                   GLWTVLASPEIGMQVAYYLEQLWNLGGRT"
FT   gene            512076..512951
FT                   /locus_tag="Mrub_0532"
FT   CDS_pept        512076..512951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27307"
FT                   /protein_id="ADD27307.1"
FT                   /translation="MRRLALAAVAFWGLGWACTLSIETNPQGGVTGPTTVTITVRAGAT
FT                   AERLTLSLKQEGRWGDWVTSWQWSQTSTGSVSLPVNFSMNGQYILTASADLCGQPAIAQ
FT                   SRFTVMIPWTIGGGALGWLLWREAEATNYIKGLANDVNGGQPMFIEGLVTGLAEPVRAI
FT                   LRDYLVKGYLNRDQRYPPACSGLCYAIAPVQMRLYAVQGVGGLFQQGWAGLGLYGGLRD
FT                   SRSYELGTKGVAGVLIVRGYRHDYILLSARGDFSDAEITVVEMPKGGSELFRKALSLNA
FT                   LQQGAREVMP"
FT   gene            512948..514162
FT                   /locus_tag="Mrub_0533"
FT   CDS_pept        512948..514162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27308"
FT                   /protein_id="ADD27308.1"
FT                   /translation="MRGWWLIPLLGVGLAQTTGGSLNDLAGLRGVLNAPGELHLVVPQI
FT                   TPWALRLREWRTAGATTFYIPQEEARKYCGSANVPIRVLPGSVKQPVGFIVGQGGSLEG
FT                   IALRGLGLIYDPGWAENDHIALWMGLSGPRTGRTWVEGSWTGSLSARVEFQVTERYLGD
FT                   PQSGSYLFNHVWNGQVQDVRAQGYDPYRIYNGETLSLVEGSGTVRGDCTLRSITTTVEV
FT                   GVDTSRTGRYTGTLGNNHTFSFDPGTGTETFRSVEYAATCGWFGCGWRGYYIYDLQGRY
FT                   RGSGSGTQCGWNWCTEASISPRLFEIRKTGEEVTARIRPWLERTVWQPQGTFPVEPGGF
FT                   VRVNGTAYQIPGLEGYGRRPQGVGIEWMRGEPYVSYLAQASGIMGGEVYRGQVVDLQEY
FT                   CTKMR"
FT   gene            514175..515575
FT                   /locus_tag="Mrub_0534"
FT   CDS_pept        514175..515575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0534"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; InterPro IPR001119;
FT                   KEGG: rce:RC1_0507 SMC family protein; SPTR: P35830 S-layer
FT                   protein; PFAM: S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27309"
FT                   /protein_id="ADD27309.1"
FT                   /translation="MPLREKRWLLAKTAVSVWSASLGLALAQQAPFKDVPPTLEDIRFL
FT                   YQKGIVQGYPDGTFRGREYMTRYQVAAMLYRTYLAFADDVARRVREALNQDAQARLEEA
FT                   LAAIEDLREGLRIVQEAMGDYPEVKANLEETRKNVEGLAEELAQVSSQMVTREEIGEII
FT                   GSVGALENLIKRGEDGLRALTARVNALEQVVRDLEQRSQAAQGELNKKVFDLGGRVDAL
FT                   EKQGKSRPKLTVGGSVGLSNGEPDGEVFVRGEANGVRLDGRLTSDGVQVRAEQGGLTLE
FT                   HRAQGGLSESRAGYRLFEGVALGLELGYGDSAFGVVRIVHEPDGGLIPGVVAEAGVGAG
FT                   FHEGNLSRNLLFVRAGYRFGAVTPSVGYYRYQGEEPYSLLEGRLDWGADFGSLGGYYRL
FT                   VAFPGSGNRGSEWGVRFTSSSNPFVELGVRGTEGLVAGEPGSFSFRYQNATASRTDFTV
FT                   RVGYRLEF"
FT   gene            515585..516211
FT                   /locus_tag="Mrub_0535"
FT   CDS_pept        515585..516211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27310"
FT                   /protein_id="ADD27310.1"
FT                   /translation="MKKSVLLGGALLALLVSGCDVISGVAGEFQPAALVEVTGALEGAC
FT                   VRLEAIKDNRTAGSWTGCTEPYSFRVDLPDGAIILVGQAGRDGLVYQEGRTEASLKKGG
FT                   RTALALSRKRVSVEVTAAWLDPAKGGLAEAWMLPQEAVGVPTYADPPPASLEGRVLVAR
FT                   EVVAQGWATLSVPTGRDVAFRLVQGEAQGITRVSRLEADGKVVVL"
FT   gene            516208..516603
FT                   /locus_tag="Mrub_0536"
FT   CDS_pept        516208..516603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpn:KPN_00940 recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27311"
FT                   /protein_id="ADD27311.1"
FT                   /translation="MKEEQERIEAGKRVPVLVVRTSEWTLWVLAGLVYLGYVVMAAMEA
FT                   PTLPVTVGLALLPALRLLPDRMLIGVGIGVGWFLGGLALTLSAYTLVGLLLASQLLALA
FT                   AGRSERWGWIIGMVVGYVAGIWWGVSR"
FT   gene            516768..518222
FT                   /locus_tag="Mrub_0537"
FT   CDS_pept        516768..518222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CROCC; ciliary rootlet coiled-coil, rootletin;
FT                   SPTR: Q2QY30 Retrotransposon protein, putative,
FT                   unclassified"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27312"
FT                   /protein_id="ADD27312.1"
FT                   /translation="MSSEDSEKDVQAREKGAEPPVMDRVEGQDGHPLDTPPVLSVDTPE
FT                   GQGGQGRDRVEGQGGTPPKDRVDTPLSGKTRTRWKEAYRKVFGGVDGLFEARVRRAMGL
FT                   MERGEARSRVEALEAVRPWNPDHEFDPPVLGPGGRPVEAGRILPPSPDEEGEPGGKTAP
FT                   MSEGEAQPDRPASSSEDTRANRVRIETEETQNRSRAKWHEAYRTVFGEEPDGPLAEARI
FT                   RAALNFYDPGRSVGRRKALEAVRASEEEAAGRTREAGRVLGPNARVGTLDGLDEADSLR
FT                   DGGAVRPARPEDGSLGDEEPEPSLEAASLRERQMPVRREDALTLGAALMKIGRLEAEVE
FT                   ELRRAVARLEEGLHRTETRLGGLRPGLKAFRDSLREVREAVLRLGSRVDGLAAPLASEE
FT                   KSLPPGKKVDSLRGRQTPVHLRELRELRARMDEERGRILLEVENRLEEAEELMRRSTES
FT                   RIAALESWVRRVSRYLGMGKKGGLFR"
FT   gene            518219..518371
FT                   /locus_tag="Mrub_0538"
FT   CDS_pept        518219..518371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27313"
FT                   /protein_id="ADD27313.1"
FT                   /translation="MTLEHVALVWQNGVGFGFKAGVGVGIAVGLLLAWLWLAWLWRWVR
FT                   SQAGR"
FT   gene            complement(518573..519073)
FT                   /locus_tag="Mrub_0539"
FT   CDS_pept        complement(518573..519073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27314"
FT                   /protein_id="ADD27314.1"
FT                   /translation="MQRSQVYTGNMQPMSDPDLELLRGSLLEAAEALSRLAREPGPGGL
FT                   ELAAAVTQAVSELNGQVNALLLGLAARPVEPMDEAYLRYLKDLVRLRAGVMELEQLLLD
FT                   RAAFERAREEWLGLTVLLDRTLEPLIDLMTFADPSQPEADLSRGYSFDSETLGFTRVRF
FT                   KPR"
FT   gene            519133..520635
FT                   /locus_tag="Mrub_0540"
FT   CDS_pept        519133..520635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo1484 putative extracellular nuclease;
FT                   SPTR: Q8TU27 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27315"
FT                   /protein_id="ADD27315.1"
FT                   /translation="MNKVRFLLALTALLSACSVSPSKVNLGQERPDPDAVTVQFDPIGG
FT                   TAGGVSAQGIDISLCVFTLNYPHQSGYNPTEVKADAIGRCPPSSEPFLLTAFLELERNQ
FT                   GGVWTKVATGPRVRKEVGAAGATWRQYELVVVATCRDGVYRSKLNIEAVNPDGGVIAIP
FT                   LARRYSNERNVQCRPRAVSLVVDDTGSMGSVIGAVKASLAGYINSIPEDEYTLWNLITF
FT                   KDDVRVLGTTTDRNAILGWVNGLYAWGGDDCPENVLGGISSGILALWPYVDHTRDLVVI
FT                   TDASAQPGDVSGILAVAKLNNVRVNVLLSGDCGLPPASVSSRAGIGVQSVSTTALSSQV
FT                   VLKRIAEETGGKYFYLPGGSQSDFEYALGEIFNNIRDTDPSTVDREPPSVTVSVTPSTL
FT                   WPPNHKLVEVKPAVSASDNLDPTPRVELVGVKVSEPDDGQGDGNTADDVQITTNGRIFV
FT                   RAERSAQGNRRVYTVTYRATDASGNTGYGSADVVVPHDRSGK"
FT   gene            520987..521706
FT                   /locus_tag="Mrub_0541"
FT   CDS_pept        520987..521706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0541"
FT                   /product="putative RNA polymerase, sigma 28 subunit,
FT                   FliA/WhiG subfamily"
FT                   /note="KEGG: sigma subunit for chloroplast RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27316"
FT                   /protein_id="ADD27316.1"
FT                   /translation="MYDSIRLMVGGLGLLSREMVMRNYIAYKHGDGQAFEALVAHYGYL
FT                   AFEKAFRLFHRLGDEARDLAQELLCEVVEVLSKPLPSGSKNLTFWVNVALDRKVRERLT
FT                   QDGVGTYRENRLLKKLVAVRLELEGEKGRAPTHPELAQALGVDEETLERLLAVEEANRI
FT                   LSLSAPHPETGTRLEEMVASTEEEDVLEELEEALEKARLGLKAEELSTLDRFLAGEEVS
FT                   QANLDALAATLKARMVA"
FT   gene            complement(521773..522033)
FT                   /locus_tag="Mrub_0542"
FT   CDS_pept        complement(521773..522033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27317"
FT                   /protein_id="ADD27317.1"
FT                   /translation="MPKAIHEGTRVRFVDTDHPEDLACFLRHMAASLGEEPLLDVSGDT
FT                   VVIECQTAPRMLEFLEGCLNGRLVPVWDSNGAYFRERGPMN"
FT   gene            522182..522397
FT                   /locus_tag="Mrub_0543"
FT   CDS_pept        522182..522397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27318"
FT                   /protein_id="ADD27318.1"
FT                   /translation="MEKVFVCPDLRTGEKLAELLYLGFKTGGLVEWEGDQGWLKPAYRI
FT                   TFRSEALQRGFVEFVRALFPSVVILD"
FT   gene            complement(522458..522958)
FT                   /locus_tag="Mrub_0544"
FT   CDS_pept        complement(522458..522958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0544"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; SPTR: A3JA09 Putative
FT                   uncharacterized protein; InterPro IPR014914; COGs: COG5654
FT                   conserved hypothetical protein; KEGG: ajs:Ajs_0567
FT                   hypothetical protein; PFAM: RES domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27319"
FT                   /protein_id="ADD27319.1"
FT                   /translation="MRAWRIASRSYAHTAFTGEGAAKSPGRWNRLGVPLGVRSQSVPKG
FT                   IVPVVYLAEHLSTGILEVLVHVDDRAHLAAFVAIEVEIPDPHVEELSELPPDWRQLPEP
FT                   YPESTQRLGSEWALSLRSLALRVPSAVVPSEFNLLLNPRHPAMPEVRVGQPQPLFLDPR
FT                   LLR"
FT   gene            complement(522955..523362)
FT                   /locus_tag="Mrub_0545"
FT   CDS_pept        complement(522955..523362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A3YY85 Putative uncharacterized protein;
FT                   InterPro IPR011979; COGs: COG5642 conserved hypothetical
FT                   protein; KEGG: nmu:Nmul_A0917 hypothetical protein; PFAM:
FT                   Protein of unknown function (DUF2384); TIGRFAM: conserved
FT                   hypothetical protein TIGR02293"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27320"
FT                   /protein_id="ADD27320.1"
FT                   /translation="MSHMGTVLPLRFDGSPTDVASVREGLPVELITEVARHYGLSQHDV
FT                   LEAAGIPRSSVHRYKGLGRLNREQSNRLYRVIYLLRRAEELFGSPQLAASWMNSPKVFL
FT                   HGSSPLAYLDTEPGFQAVEHLLGRLEDGLVT"
FT   gene            complement(523386..523619)
FT                   /locus_tag="Mrub_0546"
FT   CDS_pept        complement(523386..523619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27321"
FT                   /protein_id="ADD27321.1"
FT                   /translation="MGSTTCLCAAQSGLTGWLSFDGEAATAFLHFSADYFRVLAKRYGE
FT                   DARFRRGRDYLEADLSQAPRTLRAARRLGLER"
FT   gene            524043..525443
FT                   /locus_tag="Mrub_0547"
FT   CDS_pept        524043..525443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0547"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; InterPro
FT                   IPR013027:IPR006076; KEGG: hypothetical protein; SPTR:
FT                   A6FXV9 Putative uncharacterized protein; PFAM: FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27322"
FT                   /protein_id="ADD27322.1"
FT                   /translation="MLEVNRRCNSIEELRHDPELLDSPVGRVFPGVNHSLRAVRPDLPP
FT                   TSADIVIIGGGIIGSGIACHLWHVPSLRRRMILLEKHSFLAGQFFQAMNATGQRVMRSP
FT                   YEHHIAPDGDMQMLDFARLHLDQLTSLEREQVWLGLSGQRAVVPLDVFIGHSTHMIGVH
FT                   QLRKIAYRARVISVRPDPGRDGYLIATAEGPVIRAKTVILAAGNREAVWPQVFSEAARR
FT                   YPAQVCSVYAKPALNPGQTIAVVGSGLSAAHTILRALEAGARPVWILRREERYRCADFD
FT                   TAYFRTEGIARFRRLPSLARKVGTLLEESRGSIMLEFLPRLGSLEEAGVLRVHRHATVL
FT                   AVRASASGRLELNLSSGADEHVDLVILATGLSPDTQLLPDEVELLADRYPVLEDGTLEV
FT                   SGHPGLFAAGPLASLTLGPAAKNVDGARLAAQVIIPALIEKFSGSRPASFTVRGNFAVS
FT                   FPLKAGVR"
FT   gene            525440..525901
FT                   /locus_tag="Mrub_0548"
FT   CDS_pept        525440..525901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27323"
FT                   /protein_id="ADD27323.1"
FT                   /translation="MTQHRSGAYYLPEEELERAMVLMRYGTSELHAVFGLCHVAQDLTA
FT                   QLCWIERASHSERAAELLEDLEAEGQREADSLIQLLKSAICEEWGYCRRRVTDGLGDPR
FT                   RLVQELFRLIYNYLCLDEKGVRAVDRSWVLLAAVVLARSDLGKLCRCAG"
FT   gene            525948..526604
FT                   /locus_tag="Mrub_0549"
FT   CDS_pept        525948..526604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27324"
FT                   /protein_id="ADD27324.1"
FT                   /translation="MLRSKDLHMAATIDMESRTIMVSGAIDVNRVTIVMRVPIPEPGEY
FT                   TLVKAETNLTDEPWLCWQITLGEGVSLPLQNPTNLLLSRQFRKAKYLADRGAILFWDGE
FT                   VRPGDAIFKMARLNISGNYMILSHNRGGLTDGIFDEDEDESDDTGLEQDTPRIDLPGAL
FT                   DRYYEHITRHGFGDDLPKIEVETPVRIVQPGEIDILSFTNLPQAHSGGIRPRERA"
FT   gene            526668..527654
FT                   /locus_tag="Mrub_0550"
FT   CDS_pept        526668..527654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0550"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593; KEGG: scl:sce6750 ABC
FT                   transporter, ATP-binding protein; COGs: COG4586 ABC-type
FT                   uncharacterized transport system ATPase component; SPTR:
FT                   A8S3S6 Putative uncharacterized protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27325"
FT                   /protein_id="ADD27325.1"
FT                   /translation="MIVLEGVSKRYRVLEPGRGLGGFVRSLVKPRYREITALDNISLTV
FT                   PQGQVVGYIGPNGAGKSTTIKIIAGIVRPSAGRVVVAGRDPFRQRTAHQLELGVVMGHR
FT                   TRLFWDLPVLESLRYHAKVYRLSQSGLDQRIGAMARQFGIEGLLSQPVRQLSLGQRVRC
FT                   DLALAFLHHPRVLLLDEPTIGLDFDSKALLRSAIRQVASDLQTTVILTSHDLDDVEALS
FT                   DRIVLLDEGRVLYDGTLRQLRAQHGVLPELRLRLEAGADQVRAWLEGLGGVREVYTHDG
FT                   WVCVAHEGGGAPAAVLARLLPQTPVREMTTHEPSIEEVLRRVYRGAR"
FT   gene            527657..528448
FT                   /locus_tag="Mrub_0551"
FT   CDS_pept        527657..528448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0551"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; SPTR:
FT                   A5MVQ4 Putative uncharacterized protein; InterPro
FT                   IPR010390; COGs: COG4587 ABC-type uncharacterized transport
FT                   system permease component; KEGG: mxa:MXAN_6002 putative ABC
FT                   transporter, permease protein; PFAM: Protein of unknown
FT                   function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27326"
FT                   /protein_id="ADD27326.1"
FT                   /translation="MIPYTANLRVGFQLALAYRRAAAVWVVGELALLVAFYFLWRAVFL
FT                   SVPAGSFADRDFAAFYLYLLTARLAARFTGGPAWGFFAQRVRVGTVVYDLVQPVELEYA
FT                   LLARWLGQKAGQLVMALPAYATAAFVSGAWSAGEWRLGWFFLSLVVGFACAYFFEFLMS
FT                   LSAFYTSAQQGINEAKALVVALLSGAFFPIDLLPDRYALLASLLPFQAFIYLPARMLQP
FT                   SMPESEIFRGLAVQLFWLLVLAASSRFLLGRVRQRFNVQGG"
FT   gene            528449..529246
FT                   /locus_tag="Mrub_0552"
FT   CDS_pept        528449..529246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0552"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; SPTR:
FT                   A5MVQ5 Putative uncharacterized protein; InterPro
FT                   IPR010390; COGs: COG3694 ABC-type uncharacterized transport
FT                   system permease component; KEGG: scl:sce6748 hypothetical
FT                   protein; PFAM: Protein of unknown function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27327"
FT                   /protein_id="ADD27327.1"
FT                   /translation="MTHYLALALAALRLQFATWKQYRVDYTAGVLTVLLEQALTLVLFS
FT                   VIFTHVPQVRGWTFPEMLVLYGLNRMALGLADTLGESLWWVGSYAQDGSLLLYKLRPLG
FT                   VLFQLLTERIHFERISGCLTGLILVLHGASAAGVEWTAGKVATVLLFVLLGAFIYLGLM
FT                   ILGAAVAMRVIGSLDAITTLWSLTEFAKYPLPIFGRTGAFLLTFVVPLALTGYVPAALL
FT                   LDEHTRTAGTIALAEALVAAGAFFGLCLLAWSWALRAYEGTGN"
FT   gene            529282..530256
FT                   /locus_tag="Mrub_0553"
FT   CDS_pept        529282..530256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0553"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395:IPR005399;
FT                   KEGG: bba:Bd3502 potassium voltage-gated channel beta
FT                   subunit; SPTR: A4BF68 Voltage-gated potassium channel beta
FT                   subunit; PFAM: aldo/keto reductase; PFAM: Aldo/keto
FT                   reductase family; TIGRFAM: voltage-dependent potassium
FT                   channel beta subunit, animal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27328"
FT                   /protein_id="ADD27328.1"
FT                   /translation="MGMRYRKVGKWGLQVSEIALGAWASFGDCVKDVGEVKKIVCLAYE
FT                   SGVNFFDNADTYANGCAEELMGSVLAEYPRSTLVLASKAGWPVSGCPNSQGLSRKHLRA
FT                   SLQASLQRLRTDYLDIYFAHRHDPDVPLEEIVTTMSAFVDQGLILYWGTSEWPVARLAG
FT                   ACEFARANGLHPPICEQVDYSILYRKRWENTLAPEAEPLGLGLMATSPLAMGVLTGKYD
FT                   DGIPPGSRLARHKVLKEALLTPHNLARVRELAAVAAEHGMTRAQLALAWVLRRKELSCA
FT                   IVGATGIGQLQENLGAAGVVLAPEAVAQIERIIGGKSSTASTT"
FT   gene            530290..531117
FT                   /locus_tag="Mrub_0554"
FT   CDS_pept        530290..531117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0554"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: P05057 Kanamycin nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27329"
FT                   /protein_id="ADD27329.1"
FT                   /translation="MHARDKPLPILRATTRRERLERARHIADWILGHYSDAVVAIGIYG
FT                   STARGSDEPYSDLEMSVLMRSSPTPGRDERYVQGLKISVEFHTVGSVYRRLQRVDLTWP
FT                   LCVDQFVSVLSLYDPEGHWPKLKLLVDQLPSGSFVQAIREGIVGELLENFAKLENARKR
FT                   DDAPAMRWIAWNLAWDVAMISALMNRAYFTSWSRTPDEILRLPSLLPAVKSLVEKFRNG
FT                   DLRSAKGLHRCCEAAVRGVVQHVATLGVHVQVEPSLAGPPREQIGGGGPGSKR"
FT   gene            531136..531630
FT                   /locus_tag="Mrub_0555"
FT   CDS_pept        531136..531630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_4764 2-octaprenylphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27330"
FT                   /protein_id="ADD27330.1"
FT                   /translation="MANKDTRTLEERIEELQAVVTKLFVQMDAQRIGGPGNAGAADGGE
FT                   LPDFGPWMDTTCCYARVIALRTDLQGRFQFATLKLLHDCSDERRPAWREGAIFDLRNPA
FT                   WEAELKRAQNYDLLVGVRVLPDGRVVGIELARPNKKPRASTPGVSQLRAERAPKVDKEA
FT                   P"
FT   gene            531658..532881
FT                   /locus_tag="Mrub_0556"
FT   CDS_pept        531658..532881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0556"
FT                   /product="cytochrome P450 enzyme"
FT                   /note="SPTR: P53554 Biotin biosynthesis cytochrome
FT                   P450-like enzyme; InterPro IPR002397:IPR001128; COGs:
FT                   COG2124 Cytochrome P450; KEGG: bsu:BSU30190 cytochrome P450
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27331"
FT                   /protein_id="ADD27331.1"
FT                   /translation="MPPTAPVPPFDPLSPEVLADPYPAYARLRMSDPVHWGIPHTRAGA
FT                   WYVFRHADIASLLRDPRLSRRRPATGRGVPSGRPISEPYRGFLRMMAQQVGFQNTVGHA
FT                   RLRAVMGPLLSPRAVAGVVPRVEWVARKLLQDIEDQHSMDVLNEYALPLVLRVLAELQG
FT                   VPESSFEELRAWIGVISSVSSSSPKEELLRANRAVAEYGQLVEGLAGEAGGSPQGTVLA
FT                   GMLAARELGQVSQTEFVANLLALLDAGTQTTADFITNSVLVLLSHQDQLKLLREDPQLL
FT                   GYAVQELLRFESPVQIVGRWATESFVFQGKGIERGQVVYLVLGSANRDPSWVSDPDRLD
FT                   LKRKLDRTAAFGGGTHYCLGAPLARLIGGKALEILLQWKGSLSLQTSRLIWRPAFGFRG
FT                   LTELRVSW"
FT   gene            533007..534060
FT                   /pseudo
FT                   /locus_tag="Mrub_0557"
FT   gene            534107..535214
FT                   /pseudo
FT                   /locus_tag="Mrub_0558"
FT   gene            complement(535182..535409)
FT                   /locus_tag="Mrub_0559"
FT   CDS_pept        complement(535182..535409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27332"
FT                   /protein_id="ADD27332.1"
FT                   /translation="MGRNWIEVRFGVLVRSFRLRQVESKSFGGLVARINLLILAHNLVR
FT                   SHVLLRMAGVGLCGSKRRYTLRGQLSFDLL"
FT   gene            535533..536060
FT                   /locus_tag="Mrub_0560"
FT   CDS_pept        535533..536060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0302 hypothetical protein; SPTR:
FT                   Q6U9Q3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27333"
FT                   /protein_id="ADD27333.1"
FT                   /translation="MKTYAGVGSRRAPEDVLKLMGKIARRLAERGWALRTGGAEGADRA
FT                   FERGARAGGGAVEVFLPWPGYNGYREGALKAPSPEAVRLAAALHPAWGRLSPAVQRLMA
FT                   RNSHQILGLDLNDPVAFVLCWTPDGAESEQECGPETGGTGQAIRLASRWGVPVVNLKRE
FT                   DALEKIARLVKG"
FT   gene            536098..536319
FT                   /locus_tag="Mrub_0561"
FT   CDS_pept        536098..536319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27334"
FT                   /protein_id="ADD27334.1"
FT                   /translation="MKTLAITIGVFRNQVYAYRLRQGEVGQVHLELGLKQGQKVWEWRP
FT                   WKEGSLDEMRTLYQTLQSHDRGRWLKVE"
FT   gene            536342..536563
FT                   /locus_tag="Mrub_0562"
FT   CDS_pept        536342..536563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27335"
FT                   /protein_id="ADD27335.1"
FT                   /translation="MRTTIYLPDDLARVVEAYLKEHPQTNLSALVQEALEARLRRNPAA
FT                   LLELAGVVEKASVNAGEGAEDRLYRQER"
FT   gene            536560..536973
FT                   /locus_tag="Mrub_0563"
FT   CDS_pept        536560..536973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0563"
FT                   /product="PilT protein domain protein"
FT                   /note="InterPro IPR002716; PFAM: PilT protein domain
FT                   protein; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27336"
FT                   /protein_id="ADD27336.1"
FT                   /translation="MTPQRLVLDAGPLIALFHAADPDHEAAVRGFRALAEGNSRLITPL
FT                   PVVFEVYKWLLFEGGAAVARRALERMVEALEVVPLGLEDLEAIRVLLASRPEWRGTLED
FT                   AGVVLLALRSKAQVWTLNYRDLGVFRELQFWAG"
FT   gene            537149..538732
FT                   /locus_tag="Mrub_0564"
FT   CDS_pept        537149..538732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0564"
FT                   /product="transposase"
FT                   /note="TIGRFAM: transposase ; transposase, IS605 OrfB
FT                   family; SPTR: A6ZIJ8 Putative uncharacterized protein;
FT                   KEGG: bcb:BCB4264_A5164 transposase, IS605 family, OrfA;
FT                   InterPro IPR010094:IPR010095; TIGRFAM: transposase,
FT                   putative, N-terminal domain; transposase, IS605 OrfB
FT                   family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27337"
FT                   /protein_id="ADD27337.1"
FT                   /translation="MKARPEVARKCSSQRAKAFTGVQALLVFPSEEDRKAVLDLMRRFS
FT                   AGVRYAYNRLLEGKDRDKLKRQNSPLSVLFGLNTRYADDAILKAQAVLDSARELGEDPR
FT                   KVVFGGRKAFEQLKRRHLSGKPLEELQREWKERRQGLLYSRGDQTKGGNLNLRLLVKDG
FT                   ALRLRINLADGSYAHALVRTRHPNLNALVERVYASLPYNVELSLREGKVYAHFTWQEKL
FT                   PALLHTRKSGVLAIDINADPYHLALAVVSPDGNLRKHLALSLEEVDRAENRGTKELLLW
FT                   KVAHEVVSLAEEHRVAVATERLKYLPKGRRGDGSGRAFRRKAHRFAYASLLRKIHSLAR
FT                   KRGVEVVEVNPQDTSTIGMLKYAPLLSLSKDTSAAYVIGRRALGFEEKIPGGYEKLLQD
FT                   EGFRAHVENFYASRAHELRAKKAAEPNPYLKRRLSRQIGKTERHRSLFSSFQGSSGSRE
FT                   GSTGGRNPHGAHPWRVLRAGTFLPLLGREVPRDLSPLKPILFGGSWKGWKGSRGPHPGG
FT                   GPECANVHFG"
FT   gene            538793..539962
FT                   /locus_tag="Mrub_0565"
FT   CDS_pept        538793..539962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27338"
FT                   /protein_id="ADD27338.1"
FT                   /translation="MISTAIWSSRIQAALGREPRSVQEALEGLRVVLKGDEVSKEEFFQ
FT                   AAREGERFERFSRDDQVALIVWAALKEALEKTRKRLDQETPSTLVVRKDDSVKEEVRGV
FT                   KPVGTWKGPDRVYDVYLWDLKDTLRKGVQVRHPQYGSGYVQAVEGHTTTVRFACGTKKL
FT                   HTRAVRSMVVRRDWEDRRVADAKGWLERFLASAEEVRGMSRLEREDELAGNPHFSEGII
FT                   SEEVRGYLERAGYRVDPHNLEELASLVDSLPAREEKFKEGVLGITILRTRDGKAVGFRK
FT                   PGLWETKVAPDAEQESFAALIEAQGAHTVLAEMLQGEGWSVSEVRAHLSKLAKALSPAD
FT                   AKRLFGLLQEIAALRRLKVELHRAGFSPVRAVAYRDSSGEVVYTAPVYG"
FT   gene            540032..540478
FT                   /locus_tag="Mrub_0566"
FT   CDS_pept        540032..540478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27339"
FT                   /protein_id="ADD27339.1"
FT                   /translation="MKVVSCPRLPYPNFWNGYAWCDVDVYQLGLHVLVVLRDQNDHGGT
FT                   SVTNAIEIVARRVREQILAPEGLEGLEVHWVEWSRTDRIASTVVFRNPERLEGPTWQYL
FT                   SAKEFEKILSAFEAPGQLAAWIREGALDLEGWEESRGEPRSRGN"
FT   gene            540555..541361
FT                   /locus_tag="Mrub_0567"
FT   CDS_pept        540555..541361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0567"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; InterPro
FT                   IPR010359; KEGG: baa:BXB0111 hypothetical protein; SPTR:
FT                   A8CQU1 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27340"
FT                   /protein_id="ADD27340.1"
FT                   /translation="MKGDTLVEGIKNQIKQLAAELKEGRSQGFLAFLEKAGRFHRYSAR
FT                   NVMLILMQRPEATLVAGIKRWNELGRRVKKGEKGIAILAPTLKRVDVVDEATGEVREER
FT                   NLVGFHTTYVFDIAQTEGEPLEPQGEEIPQGAALYARLRAACPVVVEEGLLPGGALGKA
FT                   DGKRIVLAADQGHTRKAETLLHEWAHVLLHFGGINLPREVEELEAEAVAYAVGKEVGLP
FT                   MSGSRDYILHWRGTVEGLEASLERIQRAAREILEGLEREERVLAAA"
FT   gene            541596..541775
FT                   /locus_tag="Mrub_0568"
FT   CDS_pept        541596..541775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27341"
FT                   /protein_id="ADD27341.1"
FT                   /translation="MQIELSEKEVKALLELLKEHLYYGWIEQDGEFGVVASGRASATLR
FT                   ELYRRLKGGQAKAA"
FT   gene            541799..542194
FT                   /locus_tag="Mrub_0569"
FT   CDS_pept        541799..542194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27342"
FT                   /protein_id="ADD27342.1"
FT                   /translation="MGLDLGQERARAVRALDNLLALIEEAERDLEQAQARLEGLLPLRV
FT                   VWKKKTCGNDKCRCTRGALHGPYPYLIEHREGKKIEHYLGKGWTPPEGAIAPERYNALM
FT                   QDFKSKRTRLERLMGYLDEAVEVMRRY"
FT   gene            542256..542540
FT                   /locus_tag="Mrub_0570"
FT   CDS_pept        542256..542540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27343"
FT                   /protein_id="ADD27343.1"
FT                   /translation="MRRINDPVILRDCLSRLASGPLTPAQARLLLASRGIRAQHKAVEA
FT                   ALQDFGRVSLPVPKQSKQHKPRLKSLDDLPLTPREREIMERLRRERERL"
FT   gene            542592..542786
FT                   /locus_tag="Mrub_0571"
FT   CDS_pept        542592..542786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27344"
FT                   /protein_id="ADD27344.1"
FT                   /translation="MREELCPECQGNGYVEYIAGSYYSESFGNYLPLEDVAPCRTCSGT
FT                   GYVEVDDESEAVFEESWSA"
FT   gene            542942..543637
FT                   /locus_tag="Mrub_0572"
FT   CDS_pept        542942..543637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27345"
FT                   /protein_id="ADD27345.1"
FT                   /translation="MPRKRSRYRLEAHRLWEVLERLSLKDGLLLWEALGEDPRDFPLGK
FT                   AEALKKAKQRIRGDRMSPGITRNEGTKCPAPLRAGERRPLAKKEKRGDRVSPGKRGNQG
FT                   TERPRYPDPAGALAQELGGWRAGLLYRARKEQNGLIQKLAHQHRESLLELLNLAEGLPL
FT                   PRRIPTTLAWLEEFARELERLGDAEVLKALLEVRKRGAENPLSYAARVLAARGVQKKEE
FT                   VWTPTGEQF"
FT   gene            543610..544434
FT                   /locus_tag="Mrub_0573"
FT   CDS_pept        543610..544434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0573"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; SPTR: B5LPM0 DNA replication
FT                   protein DnaC; InterPro IPR003593; COGs: COG1484 DNA
FT                   replication protein; KEGG: bcr:BCAH187_A4023 putative
FT                   prophage LambdaBa02, DNA replication protein DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27346"
FT                   /protein_id="ADD27346.1"
FT                   /translation="MDTDRRAVLNLAPWLEGLRVKGGQEVPTDPGLPPCPLCGAAALAG
FT                   YIFERPGQIEHDCDCHYLEPERYQTALLKSWRRYTAPKLLAKDLEGYPRYRDYLEKPLD
FT                   VHAGNRAAIEAARAYRGGLLYLWGPPGVGKTHLALRLAGRLVGEGRFVRFHSELDFLAE
FT                   ERLAAAGEGALPQYERLILDDGGKARISPFSAERLYALVERASAGGCDLILTSNLSPEA
FT                   FAARLGEVGEAVLSRIKGSEVVEVKGQDRRDPGAAGAAPHSTGERRKDEDEH"
FT   gene            544731..545159
FT                   /locus_tag="Mrub_0574"
FT   CDS_pept        544731..545159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27347"
FT                   /protein_id="ADD27347.1"
FT                   /translation="MSILGRATARVPEARALLEARVAQGKTTYGTTLDENQAPLETRLQ
FT                   HALEEALDLLQYLEWALEKAPEPGRAQLQMLAGLAALTVRGLLHPGERPLLCGVNVFNE
FT                   AYEVSTHVLDLSQEEAARLEGFDDLMNRLRHRLVEVIN"
FT   gene            545206..545481
FT                   /locus_tag="Mrub_0575"
FT   CDS_pept        545206..545481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0575"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="InterPro IPR007527:IPR013032; PFAM: zinc finger SWIM
FT                   domain protein; PFAM: SWIM zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27348"
FT                   /protein_id="ADD27348.1"
FT                   /translation="MKNIRERVEGFLNRLERAEGLLLEGRIHRVEGLPHTYVVRGSENY
FT                   LVNLERETCTCPDHARGHTCKHLLAAVLLERGEKKGLVRTLNEAAA"
FT   gene            545579..546091
FT                   /locus_tag="Mrub_0576"
FT   CDS_pept        545579..546091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="SPTR: A7VY45 Putative uncharacterized protein; COGs:
FT                   COG4712 conserved hypothetical protein; KEGG: sec:SC0333
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27349"
FT                   /protein_id="ADD27349.1"
FT                   /translation="MDRISILTQPLTTDEIEWKIISAKNGQTTLAPYIDARAVMSRLDK
FT                   AFGPFGWQVRYTPAQVGSEHGVIASITIKNPETGEWVEKQDGSGASDMEPFKGGISGAL
FT                   KRAATTWGIGRELYSYPRVVVEGEHRFIPFKVLERLKGLPKAVAEGKPLPEVIRLNTEG
FT                   ESVRKGG"
FT   gene            546233..546817
FT                   /locus_tag="Mrub_0577"
FT   CDS_pept        546233..546817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27350"
FT                   /protein_id="ADD27350.1"
FT                   /translation="MIDQAHTLTLNWEGPFAWPGFESVAGLPSLPQKPGVYLQTFEYQN
FT                   GYLIYLAGITRRPVSARFKDHTRKYLNGEYNVLDIDAARRGVRKEVWHGWGYARAHREE
FT                   FEARKPEILEAVHRQLAGFCIFVADVGTGPRVLERIEAAVMNHLYRQPPPFCDIPDKGM
FT                   YLAPRRPSEDPIRAENVCRALLHGLPDFVEV"
FT   gene            546844..547107
FT                   /pseudo
FT                   /locus_tag="Mrub_0578"
FT   gene            complement(547190..549865)
FT                   /locus_tag="Mrub_0579"
FT   CDS_pept        complement(547190..549865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0579"
FT                   /product="Type III site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.5"
FT                   /note="PRIAM: Type III site-specific deoxyribonuclease;
FT                   PFAM: type III restriction protein res subunit; InterPro
FT                   IPR006935; KEGG: asu:Asuc_0674 type III restriction protein
FT                   res subunit; COGs: COG3587 Restriction endonuclease; SPTR:
FT                   A5KSS2 Type III restriction enzyme, res subunit; PFAM: Type
FT                   III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27351"
FT                   /protein_id="ADD27351.1"
FT                   /translation="MKIKFESNQEYQLEAIQAVTGVFEGQPLSEGLYTLGMESDELYGI
FT                   AAYANGLLLSPEALLENVRRVQEANGLEPSDRLEAIEIPDSGIALNFSVEMETGTGKTY
FT                   VYLRTIYELHRLYGFKKFIVAVPSVAIREGVLSNLRLTKEHFDTLYGNVPVDYWVYDSK
FT                   QVSRLRSFATENTLQILIINIDAFNKPSNNVIFLPNDRLSGFCPIEFIRAAHPIVIVDE
FT                   PQNFESNLAKRALASLNPLCTLRYSATHRNPYNLLYRLDPVRAYDLGLVKQIEVTSVLE
FT                   EENFNVPYLKLKEVKATKSSISAKVELDVWDGSAAKRKSVTLKQGSDLYELSGGRELYR
FT                   GYVVDEIDAGFKYVSFANGVRLEEGQEQGVNADELMRAQIRETVREHLNKELAVARLPE
FT                   GQRLKVLSLFFIDRVANYRGEDAKFRRWFEEAYHELSSLPVYASLNLPPVEQVHGGYFA
FT                   EDKTGWKDTSGNTQADEEAYEKIMRDKERLLSLEEPLRFIFSHSALREGWDNPNVFQIC
FT                   TLNETRSEVKKRQEIGRGLRLPVRENGERSFDARINRLTVIANESYKDFAKALQTEIEE
FT                   ETGLDFGQERIKNSRERRTLKLKKGWELNEDFRALWERIKHHTRYRVEFDTEDLVQRAA
FT                   KAIREMPKVERPRYRIEKGRIVRLGEDLETALVRVNTEDLDFRPAVPDLLAYLQRETEL
FT                   TRGTLARILKESGRLADAKENPQQFIDLALAAIRNTLGELMVEGIKYERLEGQAYDMML
FT                   FESKELIGYLDKIVEVSNSIYDGVIFQSEVERGFAEALDKREDVKLFVKLPDWFEVDTP
FT                   LGKYRPDWAVVMVDGEQEKLYFICETKGSKDMTKLRVSERLKIESGRAHFQALEVPYVV
FT                   ETSAAELSPERVRSSFKSSE"
FT   gene            complement(549868..551757)
FT                   /locus_tag="Mrub_0580"
FT   CDS_pept        complement(549868..551757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0580"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PRIAM: Site-specific DNA-methyltransferase
FT                   (adenine-specific); PFAM: DNA methylase N-4/N-6 domain
FT                   protein; InterPro IPR001091:IPR002295:IPR002941:IPR002052;
FT                   KEGG: msl:Msil_1946 site-specific DNA-methyltransferase
FT                   (adenine-specific); COGs: COG2189 Adenine specific DNA
FT                   methylase Mod; SPTR: A0ZFK1 Site-specific
FT                   DNA-methyltransferase (Adenine-specific); PFAM: DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27352"
FT                   /protein_id="ADD27352.1"
FT                   /translation="MVPDKLLLTTPNPIEERLETLRELFPEAFTEGRLDLETFQKLLGM
FT                   KVETGRERYGLSWAGKAEAIRAVQIPSRGTLRPKRDQSVDFDTTENVIIEGDNLEVLKL
FT                   LQQAYHGKVKMIYIDPPYNTGNDFVYPDDFREGIRQYLRFTGQLSEDGVRLTTTPEEGG
FT                   RIHSRWLSMMYPRLQLARSLLRDDGVIFVSIDDHELHNLRAIMDEIFGEENFLATILWQ
FT                   KKYAPSNDTTDFSYTHDYLLSYVKSRRFNELGKAVATLKRMERTEEQNRLYKNPDNDPR
FT                   GPWMSDNYTCNKTSEQRPNLYYPIIHPKTGKEIWPSPTRVWAYSREVHERNVSENRVWW
FT                   GLNQENETPRYKRFLSEVAGVVADTWWEHTDVGHTDEAKKEFKSLFGEDADAFDTPKPV
FT                   RLLKRLLQLATEPDAGDIVLDFFAGSGTLGQAVLEMNQEDGGDRRFVLVQLPEPTPNPN
FT                   YPTISSVTRGRVQKAAERIRSGDEKSAVQLLEPDGQDLGFRAFSLDTSNFKLWDGEAED
FT                   IQGALEGLVDNLVEGRSQEDVLFELLLKAGLPLSSKIREQEIHGQKVYSVAEGQLLVCL
FT                   ERPIRAETLRAMTALEPKPLQVVCLDVAFSGNDALKTNIVLEMRDRGIRFRTA"
FT   gene            551941..552753
FT                   /locus_tag="Mrub_0581"
FT   CDS_pept        551941..552753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0652 hypothetical protein; SPTR:
FT                   A1HR69 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27353"
FT                   /protein_id="ADD27353.1"
FT                   /translation="MNYPKAIAHKGPVGYGATLPQIFSVEGLGDCLVKFAQSDHGPKAL
FT                   ANELIGFQVADVLGLEHPECGVVEIEAEVLPDDGKLEVTSPSGDRFTFLPGLAFYSRWL
FT                   PSAQHPTPDDLNTLELANPRMLAGVVVLDLLLGNWDRTAANPNLLLERRGQRRLVVIDL
FT                   GLAFGGGLWELGNLRDTSFPPLYDPLPYGEDLDRLLRTVNPATDFSSYLGKMSELSRPR
FT                   LESIVGTIPLEWGISSREREALVDYVCTKARNLPAYLEQRLQKQEWWR"
FT   gene            552750..553601
FT                   /locus_tag="Mrub_0582"
FT   CDS_pept        552750..553601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27354"
FT                   /protein_id="ADD27354.1"
FT                   /translation="MKRMQATYMVIRYLPDVPREEFVNVGVVLTCPDAGFQNIRILDHF
FT                   SEGSRAKALGGDGLFVRHALTKLHNIIAQRRVDDLLGKEASPDGQLTREGMALLQEVFC
FT                   NNIRFSPLRTAVTSDPAATLAQLFRDYVGDQQPRPEPRTVTRTLIRKRVHEVFVQFRLF
FT                   SLGLKEDWRLPLLTEPTVDLAYKNDAWHFFQAISFAGHERAVKTAVNAYRQTARDAWES
FT                   DTEVRDAQFVALVYRPSQPTSQIRNLEEALKHDNIQLRDYRDAPEIAKDIKRDLEAHLL
FT                   IR"
FT   gene            553702..554385
FT                   /pseudo
FT                   /locus_tag="Mrub_0583"
FT   gene            complement(554386..555177)
FT                   /locus_tag="Mrub_0584"
FT   CDS_pept        complement(554386..555177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0584"
FT                   /product="Gp37Gp68 family protein"
FT                   /note="PFAM: Gp37Gp68 family protein; SPTR: A0ZIG7 Phage
FT                   protein; InterPro IPR011101; COGs: COG4422 Bacteriophage
FT                   protein gp37; KEGG: sus:Acid_6594 phage Gp37Gp68 family
FT                   protein; PFAM: Phage protein Gp37/Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27355"
FT                   /protein_id="ADD27355.1"
FT                   /translation="MANVGTAIEWTDATWNPTTGCNKVSPGCKHCYAERITERFSQHFP
FT                   QGFRFTLHPERLQEPYRWKKPRRVFVNSMSDLFHEQMPLRFLLEVFRVMRETPQHTYQI
FT                   LTKRHTRLLELDPLIEWPENVWMGVSVENQKYAVRVDFLRQTGARVKFLSCEPLLGPLE
FT                   LDLRGIHWVIVGGESGPDHRPIDPTWVRSLRDQCQRAGIPFFFKQWGGRTPKSGGRLLD
FT                   GRTWDEFPQTDSLTERQARLSRIGLDTIENTIRDPQSDFVL"
FT   gene            complement(555231..555986)
FT                   /locus_tag="Mrub_0585"
FT   CDS_pept        complement(555231..555986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0585"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; SPTR: B5IEN2
FT                   Site-specific recombinase, phage integrase family protein;
FT                   InterPro IPR002104; COGs: COG4974 Site-specific recombinase
FT                   XerD; KEGG: cak:Caul_5294 integrase family protein; PFAM:
FT                   Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27356"
FT                   /protein_id="ADD27356.1"
FT                   /translation="MESATPLKLAEVRGKKTKANSELDAVIRETARLWRKAHLDYDQSK
FT                   YVVERVRRMLELAPPPARRRVVERLSPEAVSRLLEAAYRLNPRKPVYGLMLKTLFYTGC
FT                   RVSEFVFLRAQDLHLDGEAPHLYVHKAKKDSVRYVPILPALAQELRVHLAGRTRGYLFE
FT                   SNRHQRYSPRAVQKLIQAAAKEAGLERRVYPHLLRHSVAQILLDRGMPLEQLQKFLGHR
FT                   DLKTTQIYAESSLEQVGESYRRVLGGRSS"
FT   gene            556164..557870
FT                   /locus_tag="Mrub_0586"
FT   CDS_pept        556164..557870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1066 hypothetical protein; SPTR:
FT                   O76602 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27357"
FT                   /protein_id="ADD27357.1"
FT                   /translation="MQTVQSSPSQRTIFWLFGVVLTLLLAACGGGTSGGSSGGGGGGGG
FT                   GGGGGGTTPSFTLALNPTSLTVQQGSSGSTTLTVTPQNGFTGAVNLALVDGSGNPVSGI
FT                   NLSPASVTVSGTSPVTQNLTLTVGSSVATGPYALQVKGTSGSLTQQVGLSLTVSAPGGG
FT                   GGSPSQVTVKVSDPSGSGYTGYYQDSNQNNWQPLNFTNNQATFNVSGSRYGVAVVCGSS
FT                   GSAGSTQFVLATVSESNLATVSCYAYGAPSTGPTITVTVDASQIASVVAPGDEVFVNDS
FT                   YPSSTLNSALKSTVSYQKSASGAVDLVVRIRQANGGPTKAVKVVRNVTSSNPTITFVPS
FT                   DLTNAQSVALTNPPPASFSQYVGYGYITASNTGIADLRVSNNSYLPVAGFQSGDRYISF
FT                   TEAVQGDYFTDGDGQRAITFKGYSTPPTSVAFATPWSTGALSSNAAGLPQISGLSYPGA
FT                   IAYGASYSTPSGRFLSVLVSSGYLAGATSFDLASLSPLLNSVGYTAPSNGTNAVVEVYA
FT                   LVSPMGLRRSLEFISVFGTPASFSLFTSDLDIQSVNVNKKYVVGGGAVSFP"
FT   gene            complement(558090..558934)
FT                   /pseudo
FT                   /locus_tag="Mrub_0587"
FT   gene            559206..560141
FT                   /locus_tag="Mrub_0588"
FT   CDS_pept        559206..560141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0588"
FT                   /product="iron dependent repressor"
FT                   /note="InterPro IPR001367; PFAM: iron dependent repressor;
FT                   PFAM: Iron dependent repressor, N-terminal DNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27358"
FT                   /protein_id="ADD27358.1"
FT                   /translation="MRWQVALLSLIAALALPVVGLVTGRVVGDFFLRGDLIGAVGAAFG
FT                   VLVYALALASSYSHLRHYYRGYEAQGVRASWALALAVEVATFYMSFAYVVIHSPWAFWG
FT                   SLIGAFVVFWGNFSSMYEARVQTATLRASSSVASFPGDSRVVDKAPAASEEPVVQAQPF
FT                   RAAVDPVQERSQYEAILETLLSAEAVETKISQVRQSVRAVQTATVPQKARSEPLSEIPT
FT                   RTEERQQEPTLLLSEGDKEVLRLAAEGPIGPSGISRALGIAKSSAGDRLKKLERMGLLV
FT                   KRGSSYVPTSHAQASIEGGQALYQGAQAPH"
FT   gene            complement(560363..562354)
FT                   /locus_tag="Mrub_0589"
FT   CDS_pept        complement(560363..562354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0589"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; plasmid stabilization
FT                   system; SPTR: A0Z9T6 Putative DNA helicase; InterPro
FT                   IPR007712:IPR000212:IPR014016; COGs: COG0210 Superfamily I
FT                   DNA and RNA helicase; KEGG: vei:Veis_4174 UvrD/REP
FT                   helicase; PFAM: UvrD/REP helicase; Plasmid stabilisation
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27359"
FT                   /protein_id="ADD27359.1"
FT                   /translation="MQRHTIFTITALRELQAVPARERDALLSDIDLLARDPRSGRLNLS
FT                   PLHKYPGFHRLKVGNWRVFCRLDEYVEIHAVRRRSEDTYSLPFNPRTLNTPSELTTPHP
FT                   DDWDEEDEKLAAGGPPKEQVFPLRPEQLEGWGVPRLYFPQFLSCTSDDDLLALDSVVPA
FT                   EWVVHVISMLYQPGLDQTQSEAQYVVHSRQELEDYLSGRLSDLLLRLDPEQIHASEWRL
FT                   EGPTLVRGGPGTGKTVVALYRALAYAQHRPGSRILFATYTTTLAHYAEQLLSRLIEERG
FT                   LDAEVEVSWVDRLVRQNLKAASWKIAGDSELLDAVRVVLGELRDPFLQGLGPRYLRDEF
FT                   HDVIQAWDLDHREYLSFARHGRQLPLYPEEREKVWVAYDRWRRLLDQRRLLSWNRARSA
FT                   ARASAQPNYDAVIVDEAQDLPPVALRFLLRLVKHPKGFYLTADANQSLYQQGFSFKAVD
FT                   QALDMRGRSLLLRRNYRSTRPIHAALAALARHPSLESEDLPEPAHRDGPRPLLVGIAHD
FT                   KEAGTLRDLIYRLCRQLRVPLSGVSILCPSEARAREVVDILNRLDVPAAWSKGEDLELD
FT                   QPAVKALTLHSAKGLEFPVVVVLDVNQGTLPRQAAVPAEEVEAYEARDRRLFYVACSRA
FT                   MQALVVAYDPRWPSPFVRELPPELWEQR"
FT   gene            complement(562354..563301)
FT                   /locus_tag="Mrub_0590"
FT   CDS_pept        complement(562354..563301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: LL5 beta protein, putative; SPTR: Q16FM5 LL5
FT                   beta protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27360"
FT                   /protein_id="ADD27360.1"
FT                   /translation="MADYLTDEWITQQQQRLDAAHEQVAHAIALFGRAGDSLPRLEAAL
FT                   QASEEHVSRLRMEFEQARAGFHSEVNGLLKRLKEEGKVQIERLGQHLSETLKDLEGLRD
FT                   QRLLWELRERVESLKQQWSATQEEWLEALREEVAAVEARVQEPLRDLDQNLRGGLEALQ
FT                   SEVFGAQTALRQELSSQLDQLRALLGHMNSQISAVSQSLEQEVRERQALGLALDTERSA
FT                   REALGQELHTLQQTHALLQEEFGVQSRRQQELERQVQELAQTLEQMGETISNTQQNNAT
FT                   RLDRLERYIRSLLAWFSSVRGLARLFKNPQGVEG"
FT   gene            complement(563294..566650)
FT                   /locus_tag="Mrub_0591"
FT   CDS_pept        complement(563294..566650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0591"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="COGs: COG0514 Superfamily II DNA helicase;
FT                   InterProIPR001650:IPR011545:IPR014001:IPR014021:IPR 004589;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family; KEGG:
FT                   slo:Shew_3474 ATP-dependent DNA helicase RecQ; SMART:
FT                   DEAD-like helicase ; helicase domain protein; SPTR: A0Z0Y2
FT                   Putative uncharacterized protein; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; PFAM:
FT                   DEAD/DEAH box helicase; Helicase conserved C-terminal
FT                   domain; TIGRFAM: ATP-dependent DNA helicase, RecQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27361"
FT                   /protein_id="ADD27361.1"
FT                   /translation="MELWPAEAYSRFSLLDPMAPERQGAFGRLLLPFFERAMPDSAALD
FT                   APKPGPEHWRLGGAPVTVDALEALQASSRWTLVQAKRQGIAVRSGDPAWGRWLVLGPAA
FT                   LRLWSAAWLARLGTGESGELRVRIRGDQPLPVLALLDSLELLEVVRRLYGLKQRLPRVR
FT                   LEADGLGEASQRALRAYLGDPEGQLRRLLLAEVEFGSVSEVDVLIDDPQDPLLLADWQP
FT                   DEVLEAARGLIQDPAGIDPGYHIVDPAPEVLDHLFSRFFRHHRLRPEQAEAVRRVLAGE
FT                   SLLVLLPTGYGKSAIYQLAALIQPGTALVVSPLVSLILDQVDHLYRDGITGVGFMSGRK
FT                   HAAGTAEATLEHLRNGRYRLFYIAPERLDLANFRRELGELIRGHRFSLIAVDEAHCVSE
FT                   WGHDFRTSYLHLKGLRQYIEQQGVTERVPMLALTATASPVVRADILRLLGISPDSVVQS
FT                   RSSDRPELSYSVHVVDGRQGFAGRLQALDEVLTRVAPTVLGAGSEGLLERDSRGRHRHG
FT                   AVVFAPFANAHSRAFFASNAAAVAEHLRRNRVLPEGAVGIHSNSAPGHCPRCGSTRYYS
FT                   DYGRYRCAEADCGFVGKRDDFTSPSDWDEHLLEVQAQFLDNRLPVLVSTKGFGMGIDKP
FT                   NIRLVVHYVMSGSLEGYYQEAGRAGRDRAHAHVALVTVPPDPTCAEQHLGDRAIFGLGA
FT                   DDPLPLPCLERDRRGFPTLRCPFGLKELCDVGQQAYFINQNFPGARDELTQLTEAYNRA
FT                   LTGRLLVESAGAGDSKPVEKALSRLRVLEVLHTYTRQRSHAYRATLNQDWTWARGVAAL
FT                   ADYVRGYGEATGTPDAVLIEVEELARSEGNQAEFVQRAGKILIEALYTTIRAMRLAGLR
FT                   NLYHYAALPAGSCRRVYLRRAFELRLPQDYSCGFCDTCVPDMKFGRERALVPEEAARER
FT                   ILAEGLENVLTGYNLTALRTYAREVVEAGFVGAVRGRAEYLLEQRPNDLAVLFLAALCA
FT                   GLEGERATAKVLTERALDVMLRARMGLTNQLAFVLALGEWVPSLADDLAGDPQGVLGRN
FT                   HPRLTLLETLRQLDPARAAHVERAWALEGLVKVAERLSKLLPAEVLKAFTTAVEHVTPP
FT                   HRDRGIGGMNG"
FT   gene            complement(566836..571212)
FT                   /locus_tag="Mrub_0592"
FT   CDS_pept        complement(566836..571212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0592"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; InterPro
FT                   IPR001650:IPR011545:IPR014001:IPR014021; KEGG: bsu:BSU22220
FT                   hypothetical protein; COGs: COG1205 Distinct helicase
FT                   family with a unique C-terminal domain including a
FT                   metal-binding cysteine cluster; SPTR: A2SR89 DEAD/DEAH box
FT                   helicase domain protein; PFAM: Domain of unknown function
FT                   (DUF1998); DEAD/DEAH box helicase; Helicase conserved
FT                   C-terminal domain; haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27362"
FT                   /protein_id="ADD27362.1"
FT                   /translation="MDKGREDLPETPMHQWQYLIYDEKAQGFLNPISGQRVPSEGAFPH
FT                   DTVVVWDGTTAFPVWLVPTDALPPGLPNTWCTAVAQARTVAELQRAVVSLAPAQAEEVL
FT                   RTLPDELIHAWTGEAWPRTLAELLYQMSLDRYCQRLRERGVELCQIPAISDEPLSLDQA
FT                   EVLNPRPQLRPGQVVPLDALGLDEHLARALAAAGAKEGLFTHQALSLEFLRATRHEPFD
FT                   LVITTPTASGKTLAFAPGILEDLLQRNNTALFIYPLRALTTDQYDKLTRICKGLPLKLR
FT                   PFFGSISLDELLQEGLPHVVVATPDKLNHYLDRPELAGFFSQVRYIVLDEAHAYRGYFG
FT                   INMALFLRRLMALVHSDVRLVLSTATLDNTADFVRRLTGRNRFRVVGASGAPVHARFFY
FT                   RGVAKNVPSLIHVVQRERRKGIAFVESRAETRRLAETYRRQRGTQVHPLFSGHRDYANV
FT                   LHQLRQGNESMFVFSTTTLEAGIDIGDLQHVAILGFPGSRNSFKQMAGRAGRSGPAHVV
FT                   FIPRTGRLGVAADEYYSRLDNLKRLVEAQADPVYINPANPVLLRQHLQRMRWEAHRMGL
FT                   RGGEELLEQLLSPAAVPETVRKELKRKFAPLLTQPLARVEAPPLRSMPGLTYLVIRLGE
FT                   GAPIQGIGELTLEAETTPEWMLGELRQEAAHREWALGLVFPHQGRYYRSIDWTRARVTR
FT                   NQRTEEAVLVWVEDVTDSLMDPEEYNRAYYGAKQVDRPDFKQVKHYHSPWLVVYPRLEE
FT                   VEARTAIGSVIAEAGRGRVRVGLELVVKRLTKTVQFRCPSLRSTRGIRGIHGVEEWVVE
FT                   DCDGRRVLLDPLEKRELLKSGSVVVPESARDGEEPIQGRGYVLQSYSKRQARVSTHAFN
FT                   FVLPGTCSCGEETEPHYGWKTGFENVPDTWKNHPVFSPLAREYETDLGQIRFSDGSTAA
FT                   YWALSNALAKAIPDVLETDLSDIGFALQAPRHELVFTAYDAVEGGIGVATQLPAKLPEI
FT                   LAEARRLLELSLRCDCQGQGCFGCILPLRELRLPQDIPATSGAVEAPPAEQARLLLEET
FT                   RPYKPEPNTTAAAHLLRNLLEPPSRPDTNTTLLPKLTEYPVFRRLIFVLDSLLLDSSSV
FT                   SKAQRLREDPDLLVENLRPIPRVMEILEELLGGRVEVVLVSNNSMRYVETALKRHFPAS
FT                   VAARLLGSAVASANKPSTGRLQPLIEDLNPQEVLLVGDRLEDVLTARRLGIVSALATWS
FT                   AADAAHALNAGPDLIFSAPEDLLYALGDYRAYLHPLEQEGVPAEVIAAPLRLSRAGRVW
FT                   SVLGRYLPERPRSRRANDLLSNARYQILDFKRSGKRVRAVADYLVRRFPDLPVAYVPSR
FT                   QPVQAGLDALAEELEARGHPVLRVLQWQRVPPLRQHDAGGEAERRANVAGALRVADPAA
FT                   VRGLRLLLLDDLISSGQTLIEADRALVEAGARPEALALAYSLWERDRAAGPEEEMA"
FT   gene            complement(571308..571835)
FT                   /locus_tag="Mrub_0593"
FT   CDS_pept        complement(571308..571835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27363"
FT                   /protein_id="ADD27363.1"
FT                   /translation="MHNLFNDVRSLEQEIKAYLVHVHSAKTLASSDNIILENGAQHLQR
FT                   LLEEVTDYDPDLSKPLESLQQRFTNLKRRLDPLLPSGEVVRVQVTANPPSPIPDPEAKI
FT                   YKTEQGWWLERTGERTLYRDLGTLANAVGMVSTLTDDLDLWRASLFGNTFTISKARPFS
FT                   GFRVSLTLPDDR"
FT   gene            572045..572680
FT                   /locus_tag="Mrub_0594"
FT   CDS_pept        572045..572680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0594"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; nuclease (SNase
FT                   domain protein); SMART: nuclease (SNase domain protein);
FT                   InterPro IPR006021:IPR008613; KEGG: sal:Sala_0134
FT                   excalibur; COGs: COG1525 Micrococcal nuclease
FT                   (thermonuclease) homologs; SPTR: A6FRL0 Succinoglycan
FT                   biosynthesis protein; PFAM: Staphylococcal nuclease
FT                   homologue; Excalibur calcium-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27364"
FT                   /protein_id="ADD27364.1"
FT                   /translation="MLRLLTCFLFALSLALAQDTVAGRASVIDADSLEIQGSRIRLWGV
FT                   DAVESSQTCLDARGRVWPCGRRATFALSDFLGQRTVYCVRKGTDRYRRMLAVCSVGGVE
FT                   INRWLVEQGWALSYTRYEGAVYLDSQKRAKAARRGIWQGSFQEPWTYRANPANPPSAGA
FT                   PRPSKPSSDIYYRNCAEARAAGAAPIYRGQPGYRPGLDRNGDGVACER"
FT   gene            572770..573225
FT                   /pseudo
FT                   /locus_tag="Mrub_0595"
FT   gene            complement(573364..573795)
FT                   /locus_tag="Mrub_0596"
FT   CDS_pept        complement(573364..573795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27365"
FT                   /protein_id="ADD27365.1"
FT                   /translation="MRAATLIMLTLSLSACSLVYPAYPIEAEVVDGTYSRSILESDGYW
FT                   VVTKHFDSDIFYFTLSKTEAADLALDNQWFWLTAESSGYDVSLYPRQVQLGQMVSLRVS
FT                   NKPGQPPPPADRRIVGVLVSWQEKTRSIRFMVNDLSTRR"
FT   gene            574068..574274
FT                   /locus_tag="Mrub_0597"
FT   CDS_pept        574068..574274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_0837 hypothetical protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2191)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27366"
FT                   /protein_id="ADD27366.1"
FT                   /translation="MPRMTIEIDEALLEEARRVLGVRTKREAIERALQELVRQQRRRGI
FT                   RAHAGRVELELTQETLRALRESR"
FT   gene            574274..574684
FT                   /locus_tag="Mrub_0598"
FT   CDS_pept        574274..574684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0598"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A7C4P8
FT                   PilT-like protein; InterPro IPR002716; COGs: COG1487
FT                   nucleic acid-binding protein contains PIN domain; KEGG:
FT                   PilT protein domain protein ; K07062; PFAM: PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27367"
FT                   /protein_id="ADD27367.1"
FT                   /translation="MARILVDTSAWIEFYHPKGARQVKQALGNALEVHEIAVIAPIAVE
FT                   LLSGAKSEKDYGLLAADLQALLWLPLGSEEAGVAGKLAYDLARSGQRVPTVDLLIAGSA
FT                   LVHGCELWHFGDAHFATIAGHSPLQEHNLKSA"
FT   gene            574886..575341
FT                   /pseudo
FT                   /locus_tag="Mrub_0599"
FT   gene            complement(575373..575729)
FT                   /locus_tag="Mrub_0600"
FT   CDS_pept        complement(575373..575729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0600"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; SPTR:
FT                   A7BRJ7 Protein conserved in bacteria; InterPro IPR002782;
FT                   COGs: COG4634 conserved hypothetical protein; KEGG:
FT                   afr:AFE_1368 hypothetical protein; PFAM: Protein of unknown
FT                   function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27368"
FT                   /protein_id="ADD27368.1"
FT                   /translation="MIRFLVDAHLPFRLVRLLRERGYDALHTSELPRGNATKDSEINAL
FT                   SLREKRVVVSKDADFIQSLILRGEPYKLLLVSTGNISNQVLEALFLEQLDVLCELLNTY
FT                   RYVELGRAEIVAHL"
FT   gene            complement(575726..575965)
FT                   /locus_tag="Mrub_0601"
FT   CDS_pept        complement(575726..575965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0601"
FT                   /product="protein of unknown function DUF433"
FT                   /note="PFAM: protein of unknown function DUF433; SPTR:
FT                   A0YJ05 Putative uncharacterized protein; InterPro
FT                   IPR007367; COGs: COG2442 conserved hypothetical protein;
FT                   KEGG: afr:AFE_1367 hypothetical protein; PFAM: Protein of
FT                   unknown function (DUF433)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27369"
FT                   /protein_id="ADD27369.1"
FT                   /translation="MTNPSALLQRITLEPEVNHGQPTVRGLRYPVRVILELLAGGMTPE
FT                   EVLADYPDLEPEDIQACLLYAAKLSEVGAVLRVA"
FT   gene            576014..577603
FT                   /locus_tag="Mrub_0602"
FT   CDS_pept        576014..577603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abb:ABBFA_001366 transcriptional regulatory
FT                   protein, C terminal family protein; SPTR: A3KKB5 Putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27370"
FT                   /protein_id="ADD27370.1"
FT                   /translation="MDALALYTQGRYWEALLLAQQQARVQAVALSLLALGQVAEAQALL
FT                   ESWQPQESVAQAERLALLGFAAFRKGDPATYRRWALAAAQIVQTPLTLYHLGLSLPPAD
FT                   GLLALQAALDRCEGPPEEQARLAYALARTYRRLGCLTEALSYASRAVLQAPEQPHYRLE
FT                   ELTLLALAGEEPLPALERSLPPLLAHAAPGVRYYALWLSLLLQGMQGQESPELLEALLR
FT                   QNSSPHQPYDLPLLVLLFKHRPSARPLLSRWLRAAAAGSSPDPLPQALQSLAQGLWHYP
FT                   RPEARPLLEAALPTLQTEWAEEALRAAAHLAALEGAPLPEPYRRMAQALRPEARALFLP
FT                   PELPPPATPYLRTLGAAHLEGFPALRPRSLELLTLLLAHPEGLSGEALARALYPAPNPQ
FT                   ALKSELCRLRQQGFEVQPRPYRLCTPIEADFLKLQEALQHHRLAEALSLYQGPLLPRSQ
FT                   APGIELLRNHLEEQLREAVLRQPDPEPLYRLTQRIPDDLVLWEALLERLPEPDPRRPAV
FT                   RAWVRRLNAQYR"
FT   gene            578512..580311
FT                   /locus_tag="Mrub_0603"
FT   CDS_pept        578512..580311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0603"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871:IPR017940; KEGG:
FT                   rsq:Rsph17025_2353 ABC transporter related; COGs: COG1132
FT                   ABC-type multidrug transport system ATPase and permease
FT                   components; SPTR: A1ZE49 ABC transporter permease and
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27371"
FT                   /protein_id="ADD27371.1"
FT                   /translation="MRLDRRTFRWRLVGLALRQVIQAAPLEATLLLLLLALGGLVPVGV
FT                   LGFTRALVDGLVAGLGEGVWGPWLWWPLLGLALAFALDFLLAPWVAYLQGAVNERLTAR
FT                   VHLLLMDKVGGLPDLTPFENPSFHDELQVLRDQAPYQPLNLLIFLGSAFRGSITVAGVL
FT                   LLLLSAAPLFPLLLLLATLPQAILTFRLQKGVWEAVLFTAPEARRMRYFAEALLEADTA
FT                   KEVRLFGLLPFFRGRYLEAFWALYRAVRRARGRQALGASGLVLLGALATAAALFLALRQ
FT                   ALSGASGLGNLVLVLQSVGSLQQNLFGLVQDGGMLYESLLYFERLERFLALPPTLRQPP
FT                   KPREVRSFEEIRFEQVGFTYPDGRRALQDVSFTLRRGERLALVGENGAGKTTLVKLLLR
FT                   FYDPGEGRILVDGVDLRELDLAAWRRLVAAVFQDFGRYALTLEENIALSDLKHLHDPKR
FT                   LEEAARAGGAEGLLLRLGPEALLSRAFGGTELSLGEWQRVALSRAFFRQAELLVLDEPT
FT                   ASLDPKEEAHLYARFAELAKGKTVLLITHRLGSVRMADRILVLSGGRLVEEGDHATLLA
FT                   RGGAYAELWRLQADLYSPDLADK"
FT   gene            580417..581610
FT                   /locus_tag="Mrub_0604"
FT   CDS_pept        580417..581610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0604"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; InterPro
FT                   IPR011701; KEGG: mag:amb4349 major facilitator superfamily
FT                   permease; SPTR: A6CNJ3 Macrolide-efflux protein; PFAM:
FT                   Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27372"
FT                   /protein_id="ADD27372.1"
FT                   /translation="MARAQLTGILLAQTTTYVGLQLFMFVAPWWALGFTESPLAPIGIF
FT                   LAITLANTLPGPLVGHLVDKSDPLRLLQTARILTVLLLAVIALISFVKLESIGLVCLLV
FT                   GLVGFTEFLYSTAFFSAVPRFIDRQGLLGLGSRLETINAVAGILAPVVAGHLLVLGNFT
FT                   VAFGAVAALLALGLLGFRGASAGKIGGEEDKSSGTESLSKTGFVQGLRLSVRQTLADKK
FT                   RLYLIAIPALANVAMAPLGALVLVAVHDLGLGAREAGWATSAFAGGVLAATLLLARFST
FT                   PRHLYPVGISVLVLGLGTVITGAVGYPYLLVGSFLAGGGTIALGLYARTLMQTLAGPST
FT                   LGKSLALQRTLRMSLRPLGLVLAGVGAELFGSRAAIAFLGFYLLIVGSAGLWFVRKT"
FT   gene            581685..582985
FT                   /pseudo
FT                   /locus_tag="Mrub_0605"
FT   gene            complement(583340..585214)
FT                   /locus_tag="Mrub_0606"
FT   CDS_pept        complement(583340..585214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0606"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PRIAM: 4-hydroxyphenylpyruvate dioxygenase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel;
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase;
FT                   InterPro IPR004360:IPR012307; KEGG: csa:Csal_0292
FT                   4-hydroxyphenylpyruvate dioxygenase; COGs: COG3185
FT                   4-hydroxyphenylpyruvate dioxygenase and related hemolysins;
FT                   SPTR: A3VA67 Putative uncharacterized protein; PFAM:
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily; Xylose isomerase-like TIM barrel; TIGRFAM:
FT                   4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27373"
FT                   /protein_id="ADD27373.1"
FT                   /translation="MRRSMATVCLSGDLRGKLEAIAAAGFEGFELFENDLLSFEGSTQE
FT                   IRQMAQDLGLTIVTLQPFRDFEGLPEPQRSRAFDRAERKMDVMAELGTDLFFVCANTSP
FT                   QSTGSLERIAEDLYELGERARQRGFRVGYEALAWSKHIYDYRDAWEVVRRANHPAVGLI
FT                   LDTFHIFSRNLELSAIAKIPKEKIFLVQIADAPLLEMGVLPWSRHFRSFPGQGQLPLDR
FT                   FMQVLRETRYDGWLSLEVFNDQFRTTPPKETALDGYRSLVYLQENPLEKLPVQTGGVAF
FT                   VEFAVSEEMAPTLAQFLGALGFQKRGQHRSKEVSLWQQGQINFILNSEPGSFAQAYNQV
FT                   HGTSVCAVAVLVEGVEEVLQRAQTYKAPIFYGPTGPGEHQIPALRGLDGSLLYLIEAQQ
FT                   EMDSFWAVDFELAAPQPTPTALQRIDHLAQVMPAAQVLSWVLFYRTILGLQTSNLLEIP
FT                   DPGGLIQSQAAESPDRSLRLVLNASQAGGTLAARFLNEYYGGGVQHIALATSDIFGTLE
FT                   RLQNNGLQLLPIPQNYYHDLEARYALEPALLERMQALNVLYDQSPEGEFFHAYTQTFDD
FT                   LFFIEIVERRGAYQGYGAVNAPIRIAAQTRLYKESLRTLSTPLRFRPD"
FT   gene            complement(585207..586181)
FT                   /locus_tag="Mrub_0607"
FT   CDS_pept        complement(585207..586181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0607"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Ketopantoate reductase ApbA/PanE domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; SPTR: A8MA90
FT                   Alcohol dehydrogenase GroES domain protein; InterPro
FT                   IPR013332:IPR013154:IPR013149; COGs: COG1063 Threonine
FT                   dehydrogenase and related Zn-dependent dehydrogenase; KEGG:
FT                   sil:SPO0596 sorbitol dehydrogenase, putative; PFAM:
FT                   Zinc-binding dehydrogenase; Alcohol dehydrogenase
FT                   GroES-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27374"
FT                   /protein_id="ADD27374.1"
FT                   /translation="MQAWVLEDYGRLSVHHRETPEGAGVLLQVAACGICGSDLSVYKGA
FT                   PAMRARWKPPLVLGHEIAGIVQEGPPDWLGQAVAVNPLVACGQCPACWEGLSNLCAHRT
FT                   NIGFHYWGGFAEQIRVPLSQLHRLPAGVPLWKGALAEPLAVALRAVELAGPVLGRPVLV
FT                   LGGGAIGTLAAWLLAQAGARVTVSERNPLRAAWLEGLGFIAEVVPTPSGQYDRVLETVG
FT                   AQSTLALAVNAARPGGSVVLVGLSDLEAPLPLQRTVLQEIRIQGSYVFTQAEFARATAL
FT                   LAHLPDTLAVRRPFAMAQTSFEELLAGRLAEAKVVLLHGGCNA"
FT   gene            complement(586191..587654)
FT                   /locus_tag="Mrub_0608"
FT   CDS_pept        complement(586191..587654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0608"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: A3K879 Putative uncharacterized
FT                   protein; InterPro IPR002823; COGs: COG3333 conserved
FT                   hypothetical protein; KEGG: csa:Csal_0071 protein of
FT                   unknown function DUF112, transmembrane; PFAM: Integral
FT                   membrane protein DUF112"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27375"
FT                   /protein_id="ADD27375.1"
FT                   /translation="MSFFSLESFLAMMLGALYGALFGSLPGLTATLAISLFIPIAIFLD
FT                   PTVAFSAIIGITATAIFAGDIGATAMRIPGTPASAAYTEEIHQIGKERSPAFALGISAL
FT                   SSALGSLVGVVILIGGSLGLAQVAKQFSSFEYFWLVLLGIVSGVFASPSMAKGLIAFGV
FT                   GMLIATIGYDPALGTPRFNFGNPNLLGGISFIVALIAFFGVAEVINNIYSYKKGHQPPA
FT                   SPNQNRSVAQEFFGAGGRLVWKERRLLLRSSLLGTFIGFLPGAGSDLAAWISSNFTRLR
FT                   RGSKEQVTLSGASSNNAAVAGTWIPALSLGIPGDTLTAIVLGMFLTMGITPGPDLFAKN
FT                   LGFVVQLYMAFILASLLMMPLVGYLGAALISTLLRIPMRLLLGAVMGLCLVGTYAINRN
FT                   PFDLYLLVVLGLLGLLMQRGGFPVGQLILGMVLGPLLEQYLMMSLIKTQWDLTAFFSRP
FT                   VAVVLAVCNLLLIVGMLWLRGQRARPNNP"
FT   gene            complement(587651..588094)
FT                   /locus_tag="Mrub_0609"
FT   CDS_pept        complement(587651..588094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR001196; KEGG: vei:Veis_4540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27376"
FT                   /protein_id="ADD27376.1"
FT                   /translation="MVNPARPFELLVCLIALALGLAAWFISDTFPRTAEGYLGPALFPK
FT                   LLAVGLAVASLSLLYRNLRQPGLGASFKLLAWGNLLRIGGVLLALLLTPWALDRLGLLG
FT                   SAGLLVLLSCLLLGARWLEALLTALFMVAFVYVVFVQLLKVPL"
FT   gene            complement(588246..589199)
FT                   /locus_tag="Mrub_0610"
FT   CDS_pept        complement(588246..589199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4284 hypothetical protein; COGs:
FT                   COG3181 conserved hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: A3JUR5 Putative uncharacterized
FT                   protein; InterPro IPR005064; PFAM: Bordetella uptake gene
FT                   (bug) product"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27377"
FT                   /protein_id="ADD27377.1"
FT                   /translation="MKRVFGILAVVAVLALTLVALGQRYPVRPITLIVPWSPGGSTDLT
FT                   ARSLAPVLGNILGQPVQVVNRTGGGGAIGHAAIAQGDPSGYTIGIITLEVVLPAWVNQT
FT                   KINADAFTPIALLVLNPVAIVVRKDAPWKTAQEFIADIKANPGKYKASGTARAGSYDYA
FT                   RLGFLKKLGLKDAALPWVPAQGAAAALQELISGGINVAFVSIGEASALVKAGEARYLAF
FT                   MTDRRFPAFPDVPTLKELGVDWTFASFLMAAAPKHTLPSVARQLDQAFAKAVQDPEFVR
FT                   FMNNANLVINHLNFDQTKAFLAERNRAMAELADELK"
FT   gene            589345..590013
FT                   /locus_tag="Mrub_0611"
FT   CDS_pept        589345..590013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0611"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; InterPro
FT                   IPR000524:IPR011711; KEGG: bbr:BB3957 putative
FT                   transcriptional regulator; COGs: COG1802 Transcriptional
FT                   regulators; SPTR: A6BG57 Putative uncharacterized protein;
FT                   PFAM: FCD domain; Bacterial regulatory proteins, gntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27378"
FT                   /protein_id="ADD27378.1"
FT                   /translation="MVQPSDVEELPLRERAYLHIKRLILNEELPPNSFLSERSLAQQLG
FT                   MSKTPVRLAIARLENEGFVRVSPQQGIVVLALSFEEVLEHIDFRLALESFVVKRLAGNL
FT                   SRSQARVLQEHIQEQQALAQHPQTQTEQLVLADMAFHRRLATTLGNRQIVQALERQQDM
FT                   LYRVAHRVYQKHPSRREQSIAEHQRLLQFLVEGEQAEALGLIEQHISRIKSLLISAAGG
FT                   "
FT   gene            complement(590040..590534)
FT                   /locus_tag="Mrub_0612"
FT   CDS_pept        complement(590040..590534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0612"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; InterPro IPR000086; KEGG:
FT                   mxa:MXAN_4891 hydrolase, NUDIX family; SPTR: A2VMT1
FT                   Putative uncharacterized protein; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27379"
FT                   /protein_id="ADD27379.1"
FT                   /translation="MVGGSRPQALPQSRRRVTSAGGVVLRERPGGKGLEVLLIAIKDGR
FT                   VWSLPKGQVEPGERYPQTAVREVREETGIEARVLAPLGSIRYHFTVKDDGVQTTVTKEV
FT                   HHFLMGYVGGTPRPQKEEVDGVAWFPVREALKRLSHQNERNAVLKALACWDTQAPMSAQ
FT                   P"
FT   gene            complement(590782..592258)
FT                   /locus_tag="Mrub_R0012"
FT   rRNA            complement(590782..592258)
FT                   /locus_tag="Mrub_R0012"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(592418..593560)
FT                   /locus_tag="Mrub_0613"
FT   CDS_pept        complement(592418..593560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0613"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; InterPro
FT                   IPR000644:IPR008915; KEGG: afw:Anae109_3134 peptidase M50;
FT                   COGs: COG1994 Zn-dependent protease; SPTR: Q3IUS4 Probable
FT                   metalloprotease/ CBS domain protein; PFAM: CBS domain pair;
FT                   Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27380"
FT                   /protein_id="ADD27380.1"
FT                   /translation="MFAKTIRLPLQLLGIPVSLDLSFLIVLPLLAFLIGSQLPLYLRLL
FT                   QIEASPDWLQGPMPYVLGLLAALGLFLSVLLHELGHALTARAYGVQTREITLWLLGGVA
FT                   QLEQIPRTRGAEAVIAIAGPIVSLLLSGLFALLRGLAPPGATDGQFLLGYLSFINLSLA
FT                   LFNLLPALPLDGGRILRSLLALYRPYLEATRTAVAVSKVMAFALGLLGLLIGNLFMLLI
FT                   AFFVFMAASAEGEQTVLSRTLEGLWVRDLMTREVSTVPPSLTVAELLEKMMLERHVGYP
FT                   VVEEGRLLGLISLEDLHGASPQTRVLERMRPPLQVNQDTEALAALQRMAEQGFSRLLVT
FT                   DEQGHLIGILSKTDLLRALQLRAAQMSLSDHPKNHIPGRA"
FT   gene            593653..594453
FT                   /locus_tag="Mrub_0614"
FT   CDS_pept        593653..594453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0614"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; SPTR: A0Z9P4 Putative
FT                   uncharacterized protein; InterPro IPR000878:IPR008189;
FT                   COGs: COG0313 methyltransferase; KEGG: mxa:MXAN_3552
FT                   tetrapyrrole methylase family protein; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: conserved
FT                   hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27381"
FT                   /protein_id="ADD27381.1"
FT                   /translation="MRLSLVPTPIGNLEDITLRALRVLREVEVVACEDTRRTGILLKHF
FT                   GISKPMLRLDQHTVGQARRLLEGYEWVAYVTDAGTPGISDPGAELVALALKEGWQLEVL
FT                   PGPTALIPALVASGLPTARFAFEGFLPQKRSERRARLAQVAGRTVVLYEAPHRLRETLQ
FT                   DLLQIYGPEHPVAVARELSKLHEEIWRGRLADALEHFKEPRGEFVLVLGPKAEPTAGLE
FT                   QEAEAVLEHLKAQGLKGKALVKALTEAGLPRNRAYELAHKPDTP"
FT   gene            594559..595527
FT                   /locus_tag="Mrub_0615"
FT   CDS_pept        594559..595527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0615"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="TIGRFAM: 6-phosphofructokinase; PRIAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase; InterPro
FT                   IPR000023:IPR015912:IPR012828; KEGG: bba:Bd3384
FT                   hypothetical protein; COGs: COG0205 6-phosphofructokinase;
FT                   SPTR: Q72H98 6-phosphofructokinase; PFAM:
FT                   Phosphofructokinase; TIGRFAM: 6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27382"
FT                   /protein_id="ADD27382.1"
FT                   /translation="MKRIAVFTSGGDAPGMNAAIRAVVRTGVAHGLEVIGIRGGYQGMI
FT                   EGDFIPMGPRDVANTLQRGGTILLTARSKEFMTPEGRARAAENLKKAGIDGVIAIGGNG
FT                   TYAGAAKLLAEHHIPVVGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHSR
FT                   VFFIEVMGRHAGFIALEVGIAGGAEVIVIPEIPTNAQACAEVINKSAEKGKRSSIVVVA
FT                   EGGYEGGAEQLAKDVRQYSGFDARVTVLGHIQRGGSPTAKDRVLASRLGAACVEALLSG
FT                   ASGVAIGEVNDEIRLTPFKEAIEKRKDINHKKYELAKVLAL"
FT   gene            595579..596124
FT                   /locus_tag="Mrub_0616"
FT   CDS_pept        595579..596124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0616"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PRIAM: Peptide-methionine-(S)-S-oxide reductase; PFAM:
FT                   Methionine sulfoxide reductase A; InterPro IPR002569; KEGG:
FT                   har:HEAR2602 peptide methionine sulfoxide reductase
FT                   (protein-methionine-S-oxide reductase) (peptide Met(O)
FT                   reductase); COGs: COG0225 Peptide methionine sulfoxide
FT                   reductase; SPTR: Q97Y45 Peptide methionine sulfoxide
FT                   reductase msrA; PFAM: Peptide methionine sulfoxide
FT                   reductase; TIGRFAM: methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27383"
FT                   /protein_id="ADD27383.1"
FT                   /translation="MQTLELATLGGGCFWCLEAVFDELKGVVDVVSGYSGGHVPNPTYE
FT                   QVCSKQTGHAEVVQITFDPSGISYREVLEVFFTIHDPTTLNRQGNDIGPQYRSVIFYHS
FT                   PEQQAVAREVMQALAQAGVWDNPIVTELVPFERFYPAEDYHQEYYRRNPYQPYCALVVG
FT                   PKVAKFRKQYFDRLKRTV"
FT   gene            596140..596772
FT                   /locus_tag="Mrub_0617"
FT   CDS_pept        596140..596772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0617"
FT                   /product="ribonuclease H-related protein"
FT                   /note="SPTR: A7AHD9 Putative uncharacterized protein; KEGG:
FT                   bha:BH0863 ribonuclease H-related protein; COGs: COG3341
FT                   double-stranded RNA/RNA-DNA hybrid binding protein;
FT                   InterPro IPR002156"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27384"
FT                   /protein_id="ADD27384.1"
FT                   /translation="MARAAKNQSKHYVVWKGRKTGIFSSWPEAEAQVKGFAGAEYKAFD
FT                   TLSEAREAFSGRYQDYLGPKATQNRLLEVPPPITPSYCVDAACSGNPGLLEYRCVETAS
FT                   GKEIFHRGPFAQGTNNVGEFLAIVEALRLCKEKGYTWPIYSDSINAIAWVKAKKARTNL
FT                   VRTQQNAELFERISQAEAWLRSHTYPNPILKWQTDSWGENPADFGRK"
FT   gene            complement(596780..597265)
FT                   /locus_tag="Mrub_0618"
FT   CDS_pept        complement(596780..597265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0618"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27385"
FT                   /protein_id="ADD27385.1"
FT                   /translation="MLSWLDLVALLVLSAALGVGIRQGVAFTLAVVPALLLYILLTAWA
FT                   GSLLPIAALPVLALALSLGMAYVRHFIPINPLSPVLEGIIGGLGGLAWGLFLAAVIWVG
FT                   FPSEFVASTGALRYPSEQISSGVKDGIVSSAFARPLFDWAAGSPLFKTALIPHIRHP"
FT   gene            597693..598835
FT                   /locus_tag="Mrub_0619"
FT   CDS_pept        597693..598835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0619"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; PRIAM: Amino-acid N-acetyltransferase; PFAM: arginine
FT                   biosynthesis protein ArgJ; InterPro IPR002813; KEGG:
FT                   afw:Anae109_0632 arginine biosynthesis bifunctional protein
FT                   ArgJ; COGs: COG1364 N-acetylglutamate synthase
FT                   (N-acetylornithine aminotransferase); SPTR: P96137
FT                   Glutamate N-acetyltransferase; PFAM: ArgJ family; TIGRFAM:
FT                   glutamate N-acetyltransferase/amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27386"
FT                   /protein_id="ADD27386.1"
FT                   /translation="MRLPIGFRAGATQAGIKPSGKPDLALLVSGTPCSWAFVGTLNKAA
FT                   APCVARGRQLLAAGQGLQAIVVNAGNANCATGEQGIWADARMAELAAAQLQLAPETVLT
FT                   ASTGVIGQPLPVEKIEAALPQIRLGLEIDPFMEAIMTTDLVPKMAEATLSSGARVVGVC
FT                   KGSGMIAPNMATMLAYIVSDAAVSQEELRRGWQGVVDKSFNQVTVDTDTSTNDMAVLMT
FT                   NGAAGPVDLAEFWQAVERVCVELARKLARDGEGATKLLTVKVTGAKSDVEARKAALSVA
FT                   ASPLWKSAVYGNDPNWGRVMMALGKAGVALEPDKVRITLQGIPLYAGKVLEFDRAQASQ
FT                   AMQAEEVLVEADLGLGEGQGTAWGCDLTEGYVRINALYTT"
FT   gene            598890..599351
FT                   /locus_tag="Mrub_0620"
FT   CDS_pept        598890..599351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_2879 major facilitator superfamily
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27387"
FT                   /protein_id="ADD27387.1"
FT                   /translation="MKRLAPLVVLFALLFGSLGKAQSDGFGIYSGFPTWIGVQYQVSSF
FT                   RLGAGLAFAGLGAGADYIVLEQAIPAAPGFDLSWYAGAGASVGFWTVLSNTGIYIFPHG
FT                   LVGIEYAFPAQPFSVYGELQVGFGIGTGALSGVIGGVDFNARAGLIFRP"
FT   gene            599372..600022
FT                   /locus_tag="Mrub_0621"
FT   CDS_pept        599372..600022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0621"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_0756 polymorphic outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27388"
FT                   /protein_id="ADD27388.1"
FT                   /translation="MRYAPLLFLLLLAGCQRPGDTQPPLIGITQPKSGVLSQRSLQVQG
FT                   YALDDVGVQSVKAGGKELLPEASRGQKLVRFTFRVQAPQSGQVEIKVDATDMSGQTRTV
FT                   RLPLVLDARPPQIVIERAERVVTVVQPAHKRTLPDGTEEEIPARTESTLQISGRVLDDT
FT                   GVDRVTLQYNRTFSPLSLPKGKEVSFYVELPVRRVTLIAVDAAGNRTSVDVSR"
FT   gene            complement(600024..601118)
FT                   /locus_tag="Mrub_0622"
FT   CDS_pept        complement(600024..601118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0622"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; SPTR: A3V742 Zinc ABC
FT                   transporter, permease protein; InterPro IPR001626; COGs:
FT                   COG1108 ABC-type Mn2+/Zn2+ transport systems permease
FT                   components; KEGG: bsu:BSU30740 manganese ABC transporter;
FT                   PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27389"
FT                   /protein_id="ADD27389.1"
FT                   /translation="MNADLVIILTAILVSTASALVGSFLVLRRMALLSDAISHAVLPGI
FT                   VLAYWLSGGERATVPALLGAAAAGLVTVVLVEWLTRTGKVKNDAAIGIVFPALFSLGVL
FT                   AVSLFFRNVHLDMDAVLYGEIAYAPFNTLNLWGREVPESWLVMGSLTLLNLLFVLLFYK
FT                   ELKLSTFDPGLAAALGLAPGALHYGLMTLVSFTSVGAFQSVGAILIVAFLIIPPATAYL
FT                   LTRRLPVMIALAVGVGVVSSLAGYALAIWLDASIAGMMATVAGLCFTLAFLFSPVEGYL
FT                   TARLRRERQRLEVAARLLVAHLAHHDQPVPEGEVLEEFGWNPRFLKQVREKARQAGWLE
FT                   VVREGLRPTARGLAMSSALLEPDP"
FT   gene            complement(601115..602248)
FT                   /locus_tag="Mrub_0623"
FT   CDS_pept        complement(601115..602248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0623"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; SPTR: A6ELK8 Putative
FT                   uncharacterized protein; InterPro IPR001626; COGs: COG1108
FT                   ABC-type Mn2+/Zn2+ transport systems permease components;
FT                   KEGG: bsu:BSU30750 manganese ABC transporter membrane
FT                   protein; PFAM: ABC 3 transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27390"
FT                   /protein_id="ADD27390.1"
FT                   /translation="MSELLLIFTDYTLRNVALGSAMLGVVGGVLGAFAVLRRQSLLGDV
FT                   LAHAALPGICLAFILTGTKAPLVLLLGGGLAGWLAAWLVLAVLRHSRLPEDSALGVMLS
FT                   SFFGFGVALLTFIQHSNNASQAGLDQYIFGQAATIVASDVRNFMVLGGVALLVVGLFYK
FT                   EFKLLSFDPAYAHSLGLPVRGLNTLLTSLMVLAVMVGLQTVGVVLMAAMLIAPAAAARQ
FT                   WTNRLEAMIGLSALFGAMAGVSGALISATRENLPTGPLVVLSMSAILLVSLFFAPLRGL
FT                   VWDWARTRQNRRRVRLERLLLDAHVLHAHGTLTPQTLAERRREPVAVALQNLEALRSLG
FT                   WVQEHPQGFILTPTGEQKAHELEQAMRVLPHRVEGSS"
FT   gene            complement(602444..603223)
FT                   /locus_tag="Mrub_0624"
FT   CDS_pept        complement(602444..603223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0624"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: sil:SPO3365
FT                   zinc/manganese/iron ABC transporter, ATP-binding protein;
FT                   COGs: COG1121 ABC-type Mn/Zn transport systems ATPase
FT                   component; SPTR: A4BY27 Zinc ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27391"
FT                   /protein_id="ADD27391.1"
FT                   /translation="MITQPRTVQNPESGASSPLRVRDLTVVYREKPALWDVDLEVPTGQ
FT                   LCAIVGPNGAGKSTLIKAVLGLVPVASGQVRFFGQSLAQARKRIGYVPQRGSVDWDFPT
FT                   SVLDVVMMGLYGQLGWFKRPGPREREAALRCLEQVSMQAFTTRQISQLSGGQQQRVFLA
FT                   RALAQDADLYFMDEPFAGVDAVTEEAILRVLHELKKQGKTVVVVHHDLETVRDYFDHLT
FT                   LLNVQVIASGPMEEVFTPENLKRTYGERMRWGERHSA"
FT   gene            complement(603220..604185)
FT                   /locus_tag="Mrub_0625"
FT   CDS_pept        complement(603220..604185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0625"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; SPTR:
FT                   A2TQ92 Zinc ABC transporter, periplasmic zinc-binding
FT                   protein; InterPro IPR006129:IPR006128:IPR006127; COGs:
FT                   COG0803 ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin; KEGG: tcx:Tcr_2149 periplasmic
FT                   solute binding protein; PFAM: Periplasmic solute binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27392"
FT                   /protein_id="ADD27392.1"
FT                   /translation="MRIRNHLKPSILLALLVLGLATQVSAQPDKISRLQPVRQTPVRVV
FT                   TTVNFITDLVQQVGGDRVRVEGLMGAGVDPHLYKASAGDVRRLQQADLVFYGGLHLEGK
FT                   MVELLERLPKAIAVTDAIPRERLIRPAGGFQGQFTYDPHVWFDVTLWQFTIGRVRDALS
FT                   QVDPAGASRYRANAEAYRKRLEQLDAFIRQQIAQVPPQQRVLITAHDAFNYLGRRYGLE
FT                   VRGLQGISTVSEAGTRDVQALADFIVERKIRAIFVESSVPRRAIDAVVAAVRARGWRVT
FT                   IGGELFSDAAGSPGTPEGTYVGMMEHNIRTIVNGLLGREP"
FT   gene            complement(604172..604891)
FT                   /locus_tag="Mrub_0626"
FT   CDS_pept        complement(604172..604891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0626"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   regulatory protein MarR; SMART: iron dependent repressor;
FT                   InterPro IPR000835:IPR007167:IPR001367; KEGG: tcx:Tcr_0904
FT                   iron dependent repressor; COGs: COG1321 Mn-dependent
FT                   transcriptional regulator protein; SPTR: Q9HRU8
FT                   Transcription repressor; PFAM: FeoA domain; Iron dependent
FT                   repressor, N-terminal DNA binding domain; Iron dependent
FT                   repressor, metal binding and dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27393"
FT                   /protein_id="ADD27393.1"
FT                   /translation="MNRTTHRTPLSEAQEDYLKQVLLLGSGEGMGRLEDTLPVSTQSLA
FT                   DRMQVKPASVTGMLKKLAELGLVEYEAYRGVRLTEAGYKVALEVLRHHRLIEAYLHQAL
FT                   GYGWEEVHAEAEKLEHHISEAFEQRIAEWLGHPSHDPHGDLIPSAALELPPTTPNRRLA
FT                   ALQSGQYGTVARVATQDQDALNLLARLGLKPGASLRLLEQGAEGSRIQVGGQRYLLPTS
FT                   LAQVLWIQIEEDQDANP"
FT   gene            605010..605393
FT                   /locus_tag="Mrub_0627"
FT   CDS_pept        605010..605393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0627"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1693 hypothetical protein; SPTR: A6NX74
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27394"
FT                   /protein_id="ADD27394.1"
FT                   /translation="MTYEAFAETAERLWDEIPAEYKRGLHGLHVLEHLKPDPDEPELLR
FT                   LGEYYDPGYPSVLGGFEGIGRHIALFYGSFAALAAEDPSFDWEGEIWETLLHELRHHLE
FT                   SLAWRDDLVQEDMENLRRYREGR"
FT   gene            complement(605559..606635)
FT                   /locus_tag="Mrub_0628"
FT   CDS_pept        complement(605559..606635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0628"
FT                   /product="glucose-1-phosphate thymidyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidyltransferase;
FT                   PFAM: Nucleotidyl transferase; InterPro
FT                   IPR005835:IPR005908; KEGG: bcr:BCAH187_A1373 putative
FT                   glucose-1-phosphate thymidylyltransferase; COGs: COG1209
FT                   dTDP-glucose pyrophosphorylase; SPTR: B7R2B2
FT                   Glucose-1-phosphate thymidylyltransferase; PFAM:
FT                   Nucleotidyl transferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylylransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27395"
FT                   /protein_id="ADD27395.1"
FT                   /translation="MVGDMKGLILAAGRGTRLRPLTHTRPKPVIRLAGKPIIRYAVDNL
FT                   LEAGITEIGVVVSPDTIEDIKLALKDCSGVQITYIVQEEALGIAHAVGTAKDWLGQSPF
FT                   VLYLGDNLFQKGVKSFVEAYQPGISAVIALVRVPDPRQFGVAVLEEGRIVKLLEKPKNP
FT                   PSDLAVAGVYVFGPVIMDIIANLKPSARGEYEITDAIQALVDRGHTVLGQEIAGWWKDT
FT                   GRPADLLDANRLLLVEQKSPTPVIEGQVHESQVTGRVVIEKGAVVKNSTILGPVHIAQN
FT                   AIVEGAYIGPFTSVGPNAVVRQAEVEYSILEDSAVVEDVPLRLHECILGVGARVTRRQS
FT                   LPKAHKLVLGDLSSLELA"
FT   gene            606775..607755
FT                   /locus_tag="Mrub_0629"
FT   CDS_pept        606775..607755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0629"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; InterPro IPR000843:IPR001761; KEGG:
FT                   mmw:Mmwyl1_0026 regulatory protein LacI; COGs: COG1609
FT                   Transcriptional regulators; SPTR: A3KKC2 Putative
FT                   lacI-family transcriptional regulator; PFAM: Periplasmic
FT                   binding proteins and sugar binding domain of the LacI
FT                   family; Bacterial regulatory proteins, lacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27396"
FT                   /protein_id="ADD27396.1"
FT                   /translation="MNHQQTPTIQDVARLAGVSTGTVSRVLNQRPGVHPETRARVLEVV
FT                   ARLGYVPMQAARELTGKGDTVGILLAPGVRRYIPYFVLLFEHLSEALWQAGLRLEETPI
FT                   DPAGLPLKPAKGYILLGAHDHDPRLEALAQARTPHVLVGVYPGAFWVAPDDEGGAYAAT
FT                   RHLLELGHREIAHLTGQPQHQAGRERLRGYRRALEAYQVPYRPELVLDGDFSTLTAYRV
FT                   VRKAWEGGLRFSALFAASDEMAVGALAALEDVGQRVPQDVSLVGYDDLPEVGEQLTTVR
FT                   QDIAEIARTTARLLKEALAGAAPHGIRVPVRLVVRGTTCLKEVEG"
FT   gene            607818..609050
FT                   /locus_tag="Mrub_0630"
FT   CDS_pept        607818..609050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0630"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   SPTR: A1RZC0 Extracellular solute-binding protein, family
FT                   1; InterPro IPR006059; COGs: COG1653 ABC-type sugar
FT                   transport system periplasmic component; KEGG: sme:SMa1364
FT                   ABC transporter, periplasmic solute-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27397"
FT                   /protein_id="ADD27397.1"
FT                   /translation="MKKILATLALAVLGLASAQTVVKLQGFGGNDTAIISSLVREIVNP
FT                   ALEKEGIRAEYQGIEGDYRAALLNALSAGTAADLFYVDIFWSEPLFASGRVEPLNKYFT
FT                   PQELAVFNRNLLNAFTLRGNIYGLPKDFNTLAVQFNKDLFDEAKVPYPNQTDTWDTFKD
FT                   KLKRVQAVVKDVAGLCVVADYARFGAFAYATGWRPFNAQGRTVLDANFRRAFEWYTSLV
FT                   KDGAGRYAQDLGEGWTGGCFGAEKAAVAIEGAWIGGFLRDKAPNMRYGTTLIPLDPVTK
FT                   QRGNFIFTVSWSMNAASKNKEAAAKVLRVLTSPEAQNWILSRGLALPSRSALANSPIFQ
FT                   RPGKENELNRVVFQGSTGVGGAVLPFKFGALDGGNWMRPINEALQAVITGKKSVDQAIA
FT                   DAQAELNRIVR"
FT   gene            609107..610198
FT                   /locus_tag="Mrub_0631"
FT   CDS_pept        609107..610198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0631"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A3TKH1 ABC-type sugar
FT                   transport systems, permease component; InterPro IPR000515;
FT                   COGs: COG1175 ABC-type sugar transport systems permease
FT                   components; KEGG: sme:SMa1363 ABC transporter, permease;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27398"
FT                   /protein_id="ADD27398.1"
FT                   /translation="MLRSRRTEALYALLFLAPFLIHLGIFFVFAFVRTVGFSFTDATLI
FT                   GQSSRFVGFANFVELFREPRFLAAFTHSISFMLVVTTLQTFLALVLAAVLNQRLRGITF
FT                   FRTVYYIPSVLSSAAVTVIAIWFFQKTGFLNTFIGYIGSVAPVLLVFGGLFVLAQAVQV
FT                   GWERWRGVPVPWLDPALATISLVVALALTWGLVGLGVVRPLEARPPEFTWLTNPDRFLG
FT                   IPIPLWSIVILNTFTTIPTLMLIFLAGLQDIPKSLYEAASIDGASPVQQFFSVTVPMLR
FT                   PVTFLVITLSLIGTLQMFDQVALMGDAAPLDSIIVLAYYVYNNVFSGEGQVGLASAAAL
FT                   ILAGLTFAIVLLQRALGISEKAH"
FT   gene            610209..611591
FT                   /locus_tag="Mrub_0632"
FT   CDS_pept        610209..611591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0632"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: sme:SMa1362
FT                   putative inner-membrane permease; SPTR: A3TKH0 Sugar
FT                   permease of ABC transporter system; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27399"
FT                   /protein_id="ADD27399.1"
FT                   /translation="MATQAIRPVRKLDERHLARQRWARAGWVYGTMLALAVFFIGPFYV
FT                   AFLGSLKDNPLEWPFRYSFAQTQPKNWAAAWRLGQLGAGNPWTGGFAPGAEIPFQISYF
FT                   VEEGQEPEPPTVTVPTRRAGAGLGAIFDEVQAAPYAQVSEVQEVSRRPAVVGGQPGQVV
FT                   TYAFTIRYPKGDATANQPTVPRLPLDVEAPRGQQYYAATLDPNRLERRGRVASWDSVTP
FT                   GFFGYVFRNYVRVFNEARDPNTGASFFLRWTANTFFVSLVVVLTTLLFASLGGYALARM
FT                   YLPGKNYLFAFIVFTMTVPSQATFISNYLVLRDLGLLGSLWGMIVWSAVGAGAVFIMKQ
FT                   FFESIPREIEEAALMDGATPVTTFFRIILPMAAPALGALTILTFQGMWNEFFKAAVVLS
FT                   GQQASYTLPLGLSFFRSAYGVAGDWGLMLASAFLSMIPIIILFVVFQRYFVEGVSTSAL
FT                   KG"
FT   gene            611664..613535
FT                   /locus_tag="Mrub_0633"
FT   CDS_pept        611664..613535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0633"
FT                   /product="Amylo-alpha-16-glucosidase"
FT                   /note="PFAM: Amylo-alpha-16-glucosidase; SPTR: A3WRY8
FT                   Amylo-alpha-1,6-glucosidase; InterPro IPR010401; COGs:
FT                   COG3408 Glycogen debranching protein; KEGG: gdj:Gdia_2125
FT                   amylo-alpha-16-glucosidase; PFAM:
FT                   Amylo-alpha-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27400"
FT                   /protein_id="ADD27400.1"
FT                   /translation="MLPLKEDDTYAVLSDQGLVEAGEQGFYRHDTRYLSSYTWVLPGFR
FT                   LLLSQSPRPDRLVQHWSWIKGPDQVVGVRRELQMERGGFWERLEFENTSLEAQAVEITL
FT                   RAQADFADLFEAKGWHRVERRLEGLEYTAPDGLRLATRLTCDPPPVQETALEGGALYTW
FT                   RFDLAPKQKALLHLKGRFESPFEPHTPPLPSYEAWRQRFPLHLESGHSQRVLEQAIADL
FT                   RALLFSLPEGLFPAAGIPWYVCPFGRDSLLTAYMMQPWASEVTQGVLTYLARHQGREVN
FT                   PFLDETPGKIIHEVRLGELSRTGQVPFARYYGTVDATPLFVILLHRYWKDSGDMAFVRR
FT                   LQPHWEAALAWMTDYADPDQDGFLEYAPNTQKGHLVQSWKDSFDSQSHRDGSLAQGAIA
FT                   VCEVQGYAYMAYQSAAAFYRALGQTGQAEAWESRAQALRDLFHQKFWLPELKTYAAGLD
FT                   GQKKPMAILTSNPGHLLWSGIVPEEVAPQLVETLFSEALFSGWGVRTLGAGEVRYNPLS
FT                   YHNGSVWPHDNALLIGGLVRYGFYEEALRAMEALFRLAMSQPDGRLPELVGGYPKHEEE
FT                   PPVPYPASCRPQAWDAAAVVYMLRLIHEIDQKREVKGLLELRKVKVQ"
FT   gene            613612..614394
FT                   /locus_tag="Mrub_0634"
FT   CDS_pept        613612..614394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0634"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; SPTR: A4KG97
FT                   N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-
FT                   glucopyranoside deacetylase mshB; InterPro IPR003737; COGs:
FT                   COG2120 conserved hypothetical protein LmbE homologs; KEGG:
FT                   bha:BH3320 hypothetical protein; PFAM: GlcNAc-PI
FT                   de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27401"
FT                   /protein_id="ADD27401.1"
FT                   /translation="MRLLAVFAHPDDESFFCAGTLAKYAALGHEVYLICATRGEQGRIR
FT                   HPAIDASLYPKGEALGKLREKELEAACAVLGLRPPIFLGYQDSGYPLEVAQANPRGFMH
FT                   QDLQQIEDVLLGYMAQLKPQVVIGFDPQGYYGHADHIHLHRATLGAFWRAGNVMPEPPK
FT                   RLFFPVRTKERVAQTRFDPERYGVSPCSLAVRVDVRPLAPTIRAAVLAHASQAGPEENF
FT                   SQVLLDWPGLLEEETFVLGGLRGSFPAMPVDDLLAEWS"
FT   gene            614540..615823
FT                   /locus_tag="Mrub_0635"
FT   CDS_pept        614540..615823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0635"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   SPTR: A6DP87 Putative poly(A) polymerase; InterPro
FT                   IPR002646; COGs: COG0617 tRNA
FT                   nucleotidyltransferase/poly(A) polymerase; KEGG:
FT                   scl:sce1090 hypothetical protein; PFAM: Poly A polymerase
FT                   head domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27402"
FT                   /protein_id="ADD27402.1"
FT                   /translation="MMDYRQVLQQLSFLPDLYLVGGAVRDILLGETPEDLDFATSAPPE
FT                   VVMRLAKAQGLEAIPTGLEHGTVTILIDHHPYEVTTFRRDVETYGRKARVAWGQSIEED
FT                   LARRDFTIGAIAMDAAGRVIDPYGGQQDLEAGVLRAVGDPAQRFREDYLRVIRAGRFAA
FT                   RYGFEIEPRTLQAARAAAPEVLSHVAIERVTAEFDKAFQNGTPSRFLRYLYDLEILQRL
FT                   IPEFEDTHLLLQNPRWHPEGDVLTHVLQVVDRAPPPYRWHALLHDIGKKDTARWRPEGW
FT                   YSFYGHERVGAGLIPRIARDLRLPNHLRDELVVTTALHMVPVFTKPTPAAIRKFQAQAG
FT                   PHLPALRALYEADGAGRRSKESWKFFEPQPVPVQPVLLGRHLIERGHKPGKVFSRMLKA
FT                   AYDWQLDSGETDIEALYRVALRALEREA"
FT   gene            615852..616565
FT                   /locus_tag="Mrub_0636"
FT   CDS_pept        615852..616565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0636"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; SPTR: A4A1W1
FT                   Alpha/beta hydrolase fold protein; InterPro IPR000073;
FT                   COGs: COG0596 hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily); KEGG: ank:AnaeK_3910 alpha/beta
FT                   hydrolase fold; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27403"
FT                   /protein_id="ADD27403.1"
FT                   /translation="MSVPVVLLHAFPYSPAMWAGQLEAVKGHPVLSPDILGFESLESAA
FT                   AHVLVEMDNLGWQKAVFVGLSMGGYVIFRLWNLEPERFAGMVLADTRATPDTPEAARSR
FT                   LEQAERIRLEGMQFFPEATLKGHLGVTTHACRPELVARVRQAQLEADPSRVARSLEALA
FT                   ARPDSVPLLSSISVPALVLVGEEDTLTPPADARQMAAQIPDSRMLILPEAGHLSNLENP
FT                   KAFNTALRGFLAELY"
FT   gene            complement(616559..619327)
FT                   /locus_tag="Mrub_0637"
FT   CDS_pept        complement(616559..619327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0637"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; InterPro
FT                   IPR013026; KEGG: hypothetical protein; SPTR: A7T5N6
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27404"
FT                   /protein_id="ADD27404.1"
FT                   /translation="MGEVSTLWQVHLETLRPHLSGRDHRGKKGSLRWLEAAVAERGGRA
FT                   GTVRNILYKDLGSPEEKLRLFEVICDLYTESGLEAPPLPSELALESARRALGRDKRRLF
FT                   RRFVRALEQGEKPQMVVVGGAATGKGVLLAAVERAVPGCLMVNLGGELAQHLHPLAEKL
FT                   GLELEGILSQLSPTQPYALQAALQDELRNELAGALNACGKPLLLRAEKEGQIGGLSLRD
FT                   TQGNPVGLAAWIEPLLRRLTIPFLAGLSEPPPNLAWHPLSAPSRAEARRYVKDRLPDLP
FT                   PERVEALVNQAGRNFAELSRLVLLEAAQTQDSPSAYNLAQDTALRPILYALAVLSPEAD
FT                   PGIPVPLLEKAIGKGLEHLSQAERALLAPMGEGKVRPALRSLLPEVPEKEARRLHTLAL
FT                   DFFRSDLFRQLHHARGAQRLDKLLELLSQDPSRLALLPTLWVESQSWPTLERERLAMAV
FT                   VRYRAVLGQYAHPEALEALELLFHSTDPAVQAWARVKAAEARVDAGDFPAALQLLPSPE
FT                   TLSGEIGAEGLLVWAAVERWQGDYAQAEAYVQQALSLPIQPFLADRVRLWQGLVAKDAG
FT                   RFEEALEALRQVSHDPLLVGRARYQSGDLLLRTGRVYEAEAQMRQGLQALEASGAPPEE
FT                   IARVRARFGTALRRIGNFEEAERYLYQSIREASDEFIRARAMSEASVLELARGRPLEAL
FT                   ALLAEAEAYLREVRERPEEAHYRHRRTLYRIAVAYWVRASGLPYLPPYVGGQKAPESLK
FT                   ILRQLREELLSKKLPGDRYTALSIDVALKLSLLMPAPKAEAMMQGCLQQSDPYFQAQAR
FT                   LGYAETLARQEKWAEALAQVVQIGDLQDPGVQSWKLGLETQALLGLGQEEAAWKKLQTC
FT                   AGLPAPYRAQLGRVLGKIWPAEALRTRLKTRSPLALDDCLALHLSQASPAQ"
FT   gene            complement(619371..620147)
FT                   /locus_tag="Mrub_0638"
FT   CDS_pept        complement(619371..620147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0638"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B8XNP4 Platelet
FT                   glycoprotein Ib alpha polypeptide; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27405"
FT                   /protein_id="ADD27405.1"
FT                   /translation="MNALLLWILGILGVLIMLWGLTRLPRGGLAWLGFGLVLGLAGLGG
FT                   AWLHQQYGTTVFWGLGILGVLLLVWALLNLRSRLAGWSAGLAVLLVLTGFGSIVLLNSS
FT                   SPNLLTSGTIPNPLNNFQTDPGSAPDGPTTNPTPPAETTPEPTPTPPETDPSQPATEPS
FT                   PSPAEPAPTAPVASGSVREVDPACPCLLSVRVKAPNPTVRILQDGTEVASSKLEYSSFS
FT                   LEAGDYTLQVEAPGYRTLSTLINVPRNKNLEVELAQ"
FT   gene            620298..621074
FT                   /locus_tag="Mrub_0639"
FT   CDS_pept        620298..621074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0639"
FT                   /product="5-carboxymethyl-2-hydroxymuconateDelta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PRIAM: 5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase; PFAM: fumarylacetoacetate (FAA) hydrolase;
FT                   InterPro IPR002529; KEGG: scl:sce2870 fumarylacetoacetase;
FT                   COGs: COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
FT                   (catechol pathway); SPTR: A4KKP9 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF2437);
FT                   Fumarylacetoacetate (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27406"
FT                   /protein_id="ADD27406.1"
FT                   /translation="MKLVRFDAGQWGVLEGETIHETDGPAGNPTGRHFDLGGVTLLAPA
FT                   TPTKIVCVGRNYLDHIREMGHDFGGDLPKEPGLFLKGPNTLAHPANPARPERSGDVVPY
FT                   PSFTNLLHYEGELAVVIESRMKNVPESEALEHVLGYTCALDVTARDKQKTDLQWVRAKS
FT                   ADKFCPLGPWLVTSLDPQNTTLRTYVNGELRQEAHTSLMIFSVAKILSYISSFMTLEPG
FT                   DVVLTGTPEGVGELKPGDHVEVAIEGIGDLHTRIGH"
FT   gene            621174..622409
FT                   /locus_tag="Mrub_0640"
FT   CDS_pept        621174..622409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0640"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; SPTR: A3CTZ1
FT                   Sodium/hydrogen exchanger; InterPro IPR006153; COGs:
FT                   COG3263 NhaP-type Na+/H+ and K+/H+ antiporter with a unique
FT                   C-terminal domain; KEGG: gsu:GSU1203 potassium/proton
FT                   antiporter; PFAM: Sodium/hydrogen exchanger family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27407"
FT                   /protein_id="ADD27407.1"
FT                   /translation="MYLPKPEILLLIVGTLLLLSVLATKLGGRLGIPGLLLFLLIGMLA
FT                   GSDGPGGIWFDNYYIAQLVGTLALIFILYSGGLFTRWNSVRPVLGAGLSLATLGVFFTM
FT                   LLTGVFAHWVLDLGWLEAFLLGAIVSSTDASAVFGVLRERAVRLRKPLRPLLEFESGTN
FT                   DPMAVFLTVGLTALITRPEMSAWQILPMFVQQMLLGLLLGYGLGWAVAWILRNIRLSFD
FT                   GLYAVLSVTLMLLVFSLTAVLGGSGFVAVYVAGVVVGNSDFPRKTALLAFHEGNTWLME
FT                   IGMFLTLGLLVFPSQLPGVAVGAILLALFLMLVARPLAIFLSLPHRRFALNEKAFVAWV
FT                   GLRGAIPIVLATFPLLAGVESAQKIFNVTFFVVLFSVLVQGTTLPLAARWLRVRAEDEV
FT                   VASPLSEAAGGR"
FT   gene            complement(622427..623944)
FT                   /locus_tag="Mrub_0641"
FT   CDS_pept        complement(622427..623944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0641"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="PFAM: Fibronectin-binding A domain protein; protein
FT                   of unknown function DUF814; SPTR: A6P056 Putative
FT                   uncharacterized protein; InterPro IPR008616:IPR008532;
FT                   COGs: COG1293 RNA-binding protein homologous to eukaryotic
FT                   snRNP; KEGG: bsu:BSU15640 hypothetical protein; PFAM:
FT                   Domain of unknown function (DUF814); Fibronectin-binding
FT                   protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27408"
FT                   /protein_id="ADD27408.1"
FT                   /translation="MEGLQIHAALRTLAPQLPRRSLGWAFPDEGTAALLLEGLGNLLLR
FT                   YRPPHPLLALEADRVAGEAKTPFQRLLEARCKGRLLKIEQLKLDRVVFLEFEGEKGFVD
FT                   TAPTRLVFELTGRNANLMVLDLEGRIIGIDRPVTPAINRYRELRSGLFYTPPPPYQKLD
FT                   PRTLQEDGLKPFVGQPLEQLIKNLDGVGKALGAELCRRAHLRPQTPLEPAHLPLIHKVI
FT                   HSLVEQPSLQTASPDLQTAWAQEEAEALRKPLREALQRQLRTLQARLGDAHNALERLEE
FT                   AQRLRNWGDLLMAYGHQLPPGPTAKLEDFSGQMVEIPLEAGLSPIQNASRFYARAKRLE
FT                   ANAERALEQIPAMEAQIAGLEQELAQLEHLSRQALQALKRKTREKGPQLGLRLTSPSGF
FT                   EVWVGRNSKENDLLTRMAHSEDLWFHAQGLPGSHVILRTQGRPAPLPDLLYAAQLAAHH
FT                   SKARGEKNVPVDYTAKKHVWRPRKAAPGQVLYTQVKTLFVDARLPTS"
FT   gene            complement(624033..624839)
FT                   /locus_tag="Mrub_0642"
FT   CDS_pept        complement(624033..624839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A0NU04 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27409"
FT                   /protein_id="ADD27409.1"
FT                   /translation="MLSIRSALLLWIALALAMPSGLAAQVKASSQPDLVPDTQVIVQRG
FT                   GGNGNGAGNNGNGNSGNGNSGGNNGNSGGNNSNSGGNNNTGGSNAAGNGNSNAAGNNPN
FT                   PSSNPSSTRQPRSYMGQVTVSAGGLVISGSVRIQSNSPWLSLAVPGMWLEATGVWEDDV
FT                   FVATDVKLHSPVPWAFYQGPGSLIGASQYQFVSAWLTNSRNDPFLALRAASEQSQVRVV
FT                   AYFDGNKFRALPSSFPVPPGLKPGWYELMGTVGSQGVVWSSSKAFP"
FT   gene            complement(624832..626154)
FT                   /locus_tag="Mrub_0643"
FT   CDS_pept        complement(624832..626154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0643"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: ppf:Pput_1406 integral membrane sensor signal
FT                   transduction histidine kinase; COGs: COG0642 Signal
FT                   transduction histidine kinase; SPTR: A6P0U2 Sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27410"
FT                   /protein_id="ADD27410.1"
FT                   /translation="MPPSKAVQALHILLSRPKGRLLGGFRSRLLLGLSSVVVLTALLVG
FT                   VLGFLQFQSTLSQEAWQDLISATNIVEQALLITPEQVLLNPDRLPRLAELGNSRFRVIR
FT                   TEQVFLEIGGRYPTQSTGWIKTERPLEYGFVLQAALETHSQSEALRTFWQTELLALPIS
FT                   LLLALVVAYLLFGYLMHPVRHLTEATHAIAQQRFPKPIPVPPGQDELSDLAESFNRMTQ
FT                   AVEGFLERERNFSRYASHELRTPLATLRAQIEALEQGLLTPQESLPAIKRSLERLEHLL
FT                   AALLALTRIPHKNPEPVEVGAVLHAVVQNLLLKEQQRITLKGNLGAQVLGYEELLQQAL
FT                   SNLVNNALKFSQGQVEVEVRQGAVIQIHIRDRGPGVPEKDIPRLGTPFLRVQPKVDGMG
FT                   LGLALVRHIASVMGGELEFSNRPGGGLEAILSLPSLEVSHA"
FT   gene            complement(626159..626815)
FT                   /locus_tag="Mrub_0644"
FT   CDS_pept        complement(626159..626815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0644"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; InterPro IPR001789:IPR001867:IPR005829; KEGG:
FT                   bpy:Bphyt_2190 two component transcriptional regulator,
FT                   winged helix family; COGs: COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; SPTR: A3IMT2 Two-component
FT                   hybrid sensor and regulator; PFAM: Transcriptional
FT                   regulatory protein, C terminal; Response regulator receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27411"
FT                   /protein_id="ADD27411.1"
FT                   /translation="MRILLVEDNADLAGPLLALLQRERYEVEWADNLSQAQALVDKLEP
FT                   DLIALDVMLPEGEDTGFRLARQLRRDGFGGAILFLTARDTVEDRVLGLDLGGDDYLVKP
FT                   FSLEELLARIRALLRRGSTLRQNVLERGPLRIEFASRKVCWNQQPVSLSDKEFVLLERL
FT                   ALHPERVFGVDELISKVFPNTKSGHRILRVYVHRLREKLGDSVIATQPGGYTLGV"
FT   gene            complement(626883..627683)
FT                   /locus_tag="Mrub_0645"
FT   CDS_pept        complement(626883..627683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0645"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="PRIAM: tRNA (adenine-N(1)-)-methyltransferase; PFAM:
FT                   tRNA methyltransferase complex GCD14 subunit;
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   InterPro IPR014816:IPR000682; KEGG: hypothetical protein;
FT                   COGs: COG2519 tRNA(1-methyladenosine) methyltransferase and
FT                   related methyltransferase; SPTR: Q8GBB2 tRNA
FT                   (adenine-N(1)-)-methyltransferase; PFAM:
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   (PCMT)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27412"
FT                   /protein_id="ADD27412.1"
FT                   /translation="MTYGDWALLQDRRGRVYLFRLQPGGIFNYHRGSIRHEAIIQAGAG
FT                   RFIATPQGERFSIHRPTLEDYVLQMPREATPTYPKDAATICFLLDLAPGMRVLEAGAGS
FT                   GGLTLYLARAVGPTGQVWSYESRLRHLERARRNLGEYEDWGNVTFVQGDLAQAELPPSS
FT                   FDGVALDLMEPWSVLHSIVPALKIDRFLVCYLPNLTQVVTLLEQIKTLQLPFLHERTLE
FT                   VQHREWDIRPPIAHPKFQQVGHTAFLVQLRRIEHTQQNTLLEVR"
FT   gene            627986..628492
FT                   /locus_tag="Mrub_0646"
FT   CDS_pept        627986..628492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0646"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: sat:SYN_01761 pilin
FT                   assembly protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27413"
FT                   /protein_id="ADD27413.1"
FT                   /translation="MKKATGLSVIELILVVSILGILMVLGGGWFSSDRIRVNQAAQILS
FT                   ADVTRARLEALRRNVPVGIRFDFSSGANFYQIMADVDQNGLDSSDPVINRIQFGAGEYA
FT                   RIVGRLRQCTVADAAAAASAEIVFDARGVYQLATSRTVELSIGSYSRFVNINQQGRAQI
FT                   RTACP"
FT   gene            628501..628935
FT                   /locus_tag="Mrub_0647"
FT   CDS_pept        628501..628935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0647"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: vfm:VFMJ11_0359
FT                   MshD; PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27414"
FT                   /protein_id="ADD27414.1"
FT                   /translation="MQNRGITLVELLIALAVLGVAFGVLVFSQVTNYRATARAGVVSQV
FT                   KDTATQILENQVGVVLANFTRYYNGCPTGSETGCYGSGFLINSGIDEGLDGEGQILIQS
FT                   SATSQGITINLATKVSCYDGFASRTAAIGVGSLEPCPRPN"
FT   gene            628945..629622
FT                   /locus_tag="Mrub_0648"
FT   CDS_pept        628945..629622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0648"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: vei:Veis_2823 putative
FT                   transmembrane protein; PFAM: Prokaryotic N-terminal
FT                   methylation motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27415"
FT                   /protein_id="ADD27415.1"
FT                   /translation="MRIHGFTILELLVVLAIFTGVLTIATRFLVSQSQDTRIIQERDEV
FT                   QDRARLVLQMVSQDLILAGSSRYVRNNEVRFDEANWVSCAPGTPCLSGTDHSERDTFVT
FT                   RYHTSLYPSGQERRSVGYTFDGTTLLRADVPCSQAPTGLIAASSYRELAPNITQLNIRY
FT                   VCGDSAATEVGLPSGCTVVTNPTERFVRAALVTVTATSPQGTYAYTIAQRVPIRNLKTD
FT                   EVL"
FT   gene            629622..631292
FT                   /locus_tag="Mrub_0649"
FT   CDS_pept        629622..631292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0649"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_6355 outer membrane
FT                   autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27416"
FT                   /protein_id="ADD27416.1"
FT                   /translation="MRQPRGIALVVTLAILVAVALLAFATSITTMISQWSARNDRGATE
FT                   AYYVAETGLQQWKTLLFQAYRWQLYQTIDRAAGSRTPTRSECGNVLAGGVDWNRNGTIE
FT                   SNETLPATRTGTVPMGAGVGTYTITIAQDPTRPRFMLVRSVGRYGGSQAIAQATFDLSN
FT                   TGPWNYAIFSGRGASNKHLNGGAIVRGGLYVQGDPGNPDKEVIGSTGNFAMLNEYNYSS
FT                   DAVLSNRLNSDMRSLSNLCATLRVQYGRVEVSGSSSYGTPNNKLLGAYVGDSVNDIYGN
FT                   TSDVCANNRGICTDDRGAFDLPPPLAPRFPEFNTTPCTSDPSRTWAACVRDEAATGGLR
FT                   ITSSAVLFPVGAIPTSPLSCLLGNLLNGGELRFGGSSVDCRYTLNGKTGGFRYVSGNPG
FT                   MLEIYGTLHTSGIDVRFSNAINYRAFNFADPTERNASIFVEGGSIYIQGDLLPDASSAT
FT                   FPDQVLGLLAQNNIEQLTNNAMGIFYAGNRFRTQQGQRTLGTVVSNEFCTTSAGGNQCN
FT                   AGQQAEVTYIPTMGNIPVAARIPEDTVIASFKVMSYERR"
FT   gene            631338..632327
FT                   /locus_tag="Mrub_0650"
FT   CDS_pept        631338..632327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0650"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: acp:A2cp1_3107 histidine kinase; COGs: COG2205
FT                   Osmosensitive K+ channel histidine kinase; SPTR: P0A4I8
FT                   Sensor protein cutS; PFAM: His Kinase A (phosphoacceptor)
FT                   domain; Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27417"
FT                   /protein_id="ADD27417.1"
FT                   /translation="MPLKRQLAWVIGLLAFIPNLVIVLTFWASFQGRSLETSLFLLVWL
FT                   SVLALTAAGVGYFLANTLMHPIDELTRSLHYLRGTGRTLAELSLPSPKQPPPAEIAQLR
FT                   EGFEEVLDHLRELLEAREATYAALTHDLKTPLLASLRALEYLEEADKIGPEKRKELLRN
FT                   LREELSRSYLLVENLLTASRLEARRIQPENLNLRSVLEDFRLRYAQQAQKRGLRLEIEG
FT                   AGQARAERLLLERALANLVENALRHAQSRVVLRAGDGWLEVEDDGPGLPDNLENLTQPF
FT                   RSQRLRGVRAGSAGLGLYVARRVAEVHGGRLENLALPGQGTRLRIRLA"
FT   gene            632526..632996
FT                   /locus_tag="Mrub_0651"
FT   CDS_pept        632526..632996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0651"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002416:IPR012902:IPR001120; KEGG:
FT                   maq:Maqu_0866 putative type-4 fimbrial pilin related signal
FT                   peptide protein; PFAM: Prokaryotic N-terminal methylation
FT                   motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27418"
FT                   /protein_id="ADD27418.1"
FT                   /translation="MARCSQASKQIRTPGGFTLLELIVVMAILGVAAGLGIAQIRNIGQ
FT                   RQQALATVDQIRQLFWQGATAAASRGGTNFLLVRSGNTLQVQSQVDGSVLRSVTLPNGV
FT                   SCSLSNGTLATFTSPGKVIFSSSFPANRQFTISAAGQTFTLTATLIGEVRRQ"
FT   gene            632993..633469
FT                   /locus_tag="Mrub_0652"
FT   CDS_pept        632993..633469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0652"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120:IPR012902; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27419"
FT                   /protein_id="ADD27419.1"
FT                   /translation="MRSRGLTLIEVVVAAGALAIVLGIFTTLLVGNMRQTSIVGGRAQA
FT                   NQLGLFLGRQILEADERAVPDEGESLTWGYGQLTNATSGFPSLTSEQQFANLALYRASV
FT                   TNQGAPSWASSNWQISQYRIEICWRSPEGEQCVNQSIVGPSPAQVGTEINSGIN"
FT   gene            633481..634347
FT                   /locus_tag="Mrub_0653"
FT   CDS_pept        633481..634347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0653"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: lch:Lcho_2930 type IV
FT                   pilus assembly protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27420"
FT                   /protein_id="ADD27420.1"
FT                   /translation="MRPRGFTVLELLLALLVLVIVMTLAFNTSIQGLQLNQSNEAVSSA
FT                   QNKARRVLEVLSQDLRTAAFAIVTHTPFNSNATSISFAQVAGGAGYAVSAVAGNSLAIV
FT                   SNSPTIATEIPVGSRLVVIDGNGNAVLTRTTGLPTLSGINTYTIPTTCSNLPVTATSQT
FT                   LASVVSLLGYSYDATNRKLVYQALGDATTTDVAYDVSNFRIDYVYQRRNGSSVSEERNP
FT                   SGYLVSGRAQPYFTSSGSEYTLRRLQFTLGVQLPLRGRNVERTYTGQVDMINNLYYQAK
FT                   VVSICNP"
FT   gene            634335..636248
FT                   /locus_tag="Mrub_0654"
FT   CDS_pept        634335..636248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27421"
FT                   /protein_id="ADD27421.1"
FT                   /translation="MQPMRDRQGIAIVVALTIILLLSVVSTLMFTRSINDLRTSRDNTA
FT                   MAQAINLARGGAVAATALLSNEVRASLESIVQSADPSIGGISTSDIWYYGGNATQPIAS
FT                   TVAARLAVLANTLQTSLNAAICNQNFAPDGSGATVRVRVHFTTAPACGQPFPASAQLPS
FT                   GYVVDDDNNPATPLTRQVQGYALPYVMVVTASPGTPYQRNVMVQGEYRFLLKNGSFARY
FT                   ALFTNRHRTRSNSSVWFTSNTLFDGPVHTNERFNFSFNPWFGGYVTSAGCTNAGASSCA
FT                   GSISPGAFFGAGNNTTFLSPSQMTNPNAPSWTSGGITHAPVFEGNPRVNWQEPFIPMPD
FT                   NNQNQRSAAQTGGLYFNSDIARLTLYAGDDTGTPPTCNASGVCTPATSPYQYIEVCLTT
FT                   ACTGNNRLLYRYDASGALYRYNGSWPGVLVRAGFNGMIFADGSINNLTGPARSDASNPN
FT                   TAPPALASFAQITVANAGSGENIRIQGDLKYQSPACSGTPTRSGNTVTRATCNNLSADN
FT                   ILGVYSQDGDILLGNGTNSSLQDLTIHGVLMTSRGEVAVQNYNSISPRGSIRLQGGIIQ
FT                   YTYGAFGQFNSSTGQMIQGYARQFTYDPRMQDRAPPFFPTTGVVQVSVATPLSFGQREQ
FT                   VY"
FT   gene            636340..636924
FT                   /locus_tag="Mrub_0655"
FT   CDS_pept        636340..636924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0655"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; InterPro
FT                   IPR000792:IPR013249:IPR001789; KEGG: pag:PLES_10991
FT                   two-component response regulator NarL; COGs: COG2197
FT                   Response regulator containing a CheY-like receiver domain
FT                   and an HTH DNA-binding domain; SPTR: A3TPE2 Two-component
FT                   system, regulatory protein; PFAM: Bacterial regulatory
FT                   proteins, luxR family; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27422"
FT                   /protein_id="ADD27422.1"
FT                   /translation="MRLLIADDHPLFRMGLRAALEREGFAVVAEAGDGQEAVKLGLELL
FT                   PDGVLLDVRMPQMDGITATRMLREQRYNGLIALLTTFNEPVLVQQAAYAGADAYWSKEL
FT                   PPEALAERLRRLGLGLEPRLRAPELPRLTAREQEVLQWMAQGLSTKEIARQMHISPETV
FT                   KDHLLRLYEKLEARNRVEALERARSLGLLSV"
FT   gene            637033..639138
FT                   /locus_tag="Mrub_0656"
FT   CDS_pept        637033..639138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0656"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002048; KEGG: oan:Oant_4858 outer
FT                   membrane autotransporter barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27423"
FT                   /protein_id="ADD27423.1"
FT                   /translation="MSDTRGLALVSTLVFMFIVIVLVSIAMLSSLNNRRNAQDALRTSQ
FT                   AQFAAEAGLERAVARLWHQVLASATSRSVTAYGVELDRMGLTNGTTIPSLFGAPQSLGD
FT                   GSSFVVQVSRQDDTRPDPDAIVLTVTSTGTLADGTTRRLRQVFRVDRAYFPFDYALLTN
FT                   NAECIFCHLEVKSLDALRGNPNPNDPSTWWRRAKVGVLESLIMRDDEEAGVVHGPLVAR
FT                   GTISRQYSGAIGPSSRYYTTMRPGDTRIRSATPITTTPADCSTPSNCTTPQNFYYNYPD
FT                   SSSLAAFGNRFPDGELPDRFPLPIPDANHNRLIDDAEWNAEVGSSLAGTNESYSAGTIT
FT                   AAMILNPAGRVAWPGGSAVQTRTSADLGQNPTNVLLDGSVIPIELSGTVFINGDVVLRG
FT                   FVRGNGTLLARGNLYVMGDLTYDCGTGSGLVPCDYSNPSRLPQLNLIAGGNLLVGDFMT
FT                   VQSDIESLSEEQMLSTRSNQPTISFCRENPTDAACYPEERPRPNLALTEIANFNRRELQ
FT                   RYLRDNSYRPRFYTFGEDRIYFATGCSHQPQRYGEYSTIAAGARVSFCRGDTILSSSTL
FT                   TAEQASRILAGAVRYEVTSSSFNNAILKNLWANSMNARGTGPLRTDGLLYSANAIFGLA
FT                   QRKYTKLGGRWDLRGALVAADTGILVPGPGDGSSGLTIYHDSRLRPRVPGGQQAQLRRG
FT                   VWEVVGQ"
FT   gene            639135..639590
FT                   /locus_tag="Mrub_0657"
FT   CDS_pept        639135..639590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0657"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: mms:mma_3359
FT                   type IV pilus assembly related protein; PFAM: Prokaryotic
FT                   N-terminal methylation motif; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27424"
FT                   /protein_id="ADD27424.1"
FT                   /translation="MNAPSQKGISLLELLIALAVLGILLGVGLVSLSAYRQSLVIREAA
FT                   TQVATELQSIRQQARRQSLNFSFQAVEGGNTYKAGRTAELASLPSRSLPPGVVFQRVPA
FT                   GGGGVTFLAPYGVVDAANRTFTLRGPGNRVLNVHVVGSTGKVVVRAP"
FT   gene            639580..639954
FT                   /locus_tag="Mrub_0658"
FT   CDS_pept        639580..639954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0658"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; PFAM: Prokaryotic N-terminal
FT                   methylation motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27425"
FT                   /protein_id="ADD27425.1"
FT                   /translation="MRRKAFSLVEVMVALAILSITILILSYFGSSFTLTRNAQIDTQAQ
FT                   AFARSYFDTLRARWSTRAAFAAGTPPSVALPSGFSNLTIATEDVQTIGTQVVLRRVTLQ
FT                   FTGPQNRPYRFTTEVVHPPQ"
FT   gene            639962..640777
FT                   /locus_tag="Mrub_0659"
FT   CDS_pept        639962..640777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0659"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120:IPR012902; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27426"
FT                   /protein_id="ADD27426.1"
FT                   /translation="MRKTGFTLIEMLIAAAIGVVILTLIAAGLRSSGDSLRFIQNNQLL
FT                   TEDLRNAGNLISDYLSVAAFVYPPGVTLSIGSAGGYSVRNPRTGDNTWQTGLDPVIALL
FT                   QPPRVENGVEVVKFVMIYPLNRGWVVARATGAENPGSDPANNDKWLLYIYERNLTVGGN
FT                   RLPNGLPATMPTTIPGSSGNLLADYVQPGGFMVSFADCLSFDEEGLAIPVPCPSTAPAP
FT                   LRAEHSAARVRFSLQGEIRQGGRDARVPASPCVSKRLPATCPSGLARLA"
FT   gene            complement(640779..642578)
FT                   /locus_tag="Mrub_0660"
FT   CDS_pept        complement(640779..642578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0660"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: GTP-binding protein LepA; small GTP-binding
FT                   protein; PFAM: GTP-binding protein LepA domain protein;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; protein synthesis factor GTP-binding;
FT                   InterProIPR000795:IPR000640:IPR013842:IPR004161:IPR
FT                   006297:IPR005225; KEGG: bha:BH1342 GTP-binding protein
FT                   LepA; COGs: COG0481 Membrane GTPase LepA; SPTR: Q5SKA7
FT                   GTP-binding protein lepA; PFAM: Elongation factor G
FT                   C-terminus; GTP-binding protein LepA C-terminus; Elongation
FT                   factor Tu domain 2; Elongation factor Tu GTP binding
FT                   domain; TIGRFAM: GTP-binding protein LepA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27427"
FT                   /protein_id="ADD27427.1"
FT                   /translation="MQERIRNFSIIAHVDHGKSTLADRILQMTKAVSDREMREQFLDSL
FT                   ELERERGITIKASAVRLFYQSKAGETYIFNLIDTPGHVDFGYEVSRALAAVEGVLLVVD
FT                   ASQGVEAQTIANFYLAMEHEHTIIPVINKIDLPGAQPLEVALEVEEVLGIPADDCIFAS
FT                   GKTGQGVDDILEAIVARIPAPKGRPEHPLQALIFDSIFDAYQGVIPYVRVMDGSIQPGD
FT                   TIRIWSTGKVFEVDKVGVFRPGALEPVARLGPGEVGWVTAAIREIGDAQVGDTITSAQN
FT                   PCEAPYPGFQPAKPVVFAGLYPTDTQEYNRLREALEKLKLNDAALSFEPETSEALGFGF
FT                   RCGFLGLLHAEIVQERLEREFDLDLISTAPSVIYRVKLTNGEEIEIHNPSELPNPDKIE
FT                   AIYEPYVKLTVYTPEEYVGSIMQLLQEKRGKMSNMHYVGKRVELVYEVPFGEILYDFHD
FT                   RLKSISRGYASMDYEQAGYQEGDLVKVSILVNEEPVDALAFIAHKDKAYGIGREIVDKL
FT                   AEVIPRQQFAVPIQAAIGGKIIARATVKALRKDVLAKCYGGDVTRKKKLLEKQKEGKKR
FT                   MKAIGKVDVPQEAFLAVLSAGRD"
FT   gene            642763..643602
FT                   /locus_tag="Mrub_0661"
FT   CDS_pept        642763..643602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0661"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; InterPro
FT                   IPR001638:IPR001320; KEGG: mes:Meso_3149 extracellular
FT                   solute-binding protein, family 3; COGs: COG0834 ABC-type
FT                   amino acid transport/signal transduction systems
FT                   periplasmic component/domain; SPTR: A6BRF3 Putative
FT                   cystine-binding periplasmic protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27428"
FT                   /protein_id="ADD27428.1"
FT                   /translation="MKRIGILGLAVLASLGMAQTKIGNCEVTGPKGQFPIRPAVAGQLT
FT                   VQTNLPGPGFWNGDSPATIKDGFEYCLAANIAHRAGLDKVVVQNVAWDALIAGQTRNFD
FT                   FALSQITITEARKRVVDFSRPYFSSDIGVLVRAADKAKFNSPASLKTARLGVQQATTAA
FT                   KFLSETLKHPQNLTRVFPDVAAGFTALRAGQIDAFIIDTSIVLSEAAKSGGALVVVGQF
FT                   STGENYGALFTKGNPNRAQIDKILEALEKDGTLKKLSQTYLAKEWGIDPTTVPLWRP"
FT   gene            643835..644062
FT                   /locus_tag="Mrub_0662"
FT   CDS_pept        643835..644062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0662"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; InterPro
FT                   IPR002059:IPR013223:IPR011129; KEGG: bcy:Bcer98_2221
FT                   cold-shock DNA-binding domain-containing protein; COGs:
FT                   COG1278 Cold shock protein; SPTR: A6CJW0 Cold-shock domain
FT                   family protein; PFAM: 'Cold-shock' DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27429"
FT                   /protein_id="ADD27429.1"
FT                   /translation="MQKGKVKWFNAEKGYGFIQREEGEPDVFVHYSAIQSRGFRTLNEG
FT                   DVVTFEIEPGKNGKGPQAANVSVVEPAKRF"
FT   gene            complement(644189..644422)
FT                   /locus_tag="Mrub_0663"
FT   CDS_pept        complement(644189..644422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0663"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; InterPro
FT                   IPR006163:IPR006162:IPR003231; KEGG: hiq:CGSHiGG_03365 acyl
FT                   carrier protein; COGs: COG0236 Acyl carrier protein; SPTR:
FT                   Q1J195 Acyl carrier protein; PFAM: Phosphopantetheine
FT                   attachment site; TIGRFAM: acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27430"
FT                   /protein_id="ADD27430.1"
FT                   /translation="MAILDDVREVIVEKLGVDAEKVVPEARFIEDLGADSLDTVELIMG
FT                   LEDKFGLEISDEDAEKIRTVQDAIDFIQSKQA"
FT   gene            complement(644494..645231)
FT                   /locus_tag="Mrub_0664"
FT   CDS_pept        complement(644494..645231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0664"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; Male sterility domain;
FT                   InterProIPR002347:IPR002424:IPR002198:IPR013120:IPR
FT                   013968:IPR011284; KEGG: bha:BH2491 3-oxoacyl-(acyl-carrier
FT                   protein) reductase; COGs: COG1028 Dehydrogenase with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenase); SPTR: A6CS72
FT                   3-ketoacyl-(Acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27431"
FT                   /protein_id="ADD27431.1"
FT                   /translation="MRKALVTGSSRGIGKAIALELARRGYALAVHYAGNQAAAEATAAE
FT                   AQALGASQVVVLGADLSSAQAAQKLVADANAALGGLEVLVNNAGITRDTLLIRMKDEDW
FT                   DTVIATNLSAIFHTTREAIKLMMRARWGRVINISSVVGILGNPGQANYVAAKAGLIGFT
FT                   KSVAKEYATRGITVNAVAPGFIESDMTAKLPEQVVAEYLKQIPAGRLGKPEEVAKAVAF
FT                   LASDDAAYITGQTLCVDGGMTPH"
FT   gene            complement(645245..646165)
FT                   /locus_tag="Mrub_0665"
FT   CDS_pept        complement(645245..646165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0665"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="COGs: COG0331 (acyl-carrier-protein)
FT                   S-malonyltransferase; InterPro IPR014043:IPR004410; KEGG:
FT                   mxa:MXAN_4771 malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; SPTR: A3XC60
FT                   Acyl-carrier-protein S-malonyltransferase; TIGRFAM: malonyl
FT                   CoA-acyl carrier protein transacylase; PFAM: Acyl
FT                   transferase domain; TIGRFAM: malonyl CoA-acyl carrier
FT                   protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27432"
FT                   /protein_id="ADD27432.1"
FT                   /translation="MIAALFPGQGSQEIGMGKALYEGSRAAREALDRAEAALPGLLKLM
FT                   WEGPEEELKLTANQQPALLAVGYAAFQAYLEMGGALPSFAAGHSLGEWTAHVAAGTLSL
FT                   EDGLRLVRKRGEYMQEAVPVGAGAMAAVLKVPAQTIQELTAGLAGVEVANYNSPEQTVI
FT                   SGTAEGVAKATEVLKGHKARVIPLPVSAPFHSSLMRPARERLAADLAQVELSTPRFPVY
FT                   SNVRAQPETRPSVIRELLLEQITHAVRWVEILQHLKAQGVKVYLEFGSGKVLTGLVGRT
FT                   LDGVEARSLTRPQEIAEYLAVLKQG"
FT   gene            complement(646191..647168)
FT                   /locus_tag="Mrub_0666"
FT   CDS_pept        complement(646191..647168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0666"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PRIAM: Beta-ketoacyl-acyl-carrier-protein synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; InterPro IPR013751:IPR013747:IPR004655; KEGG:
FT                   bcz:BCZK1071 3-oxoacyl-(acyl carrier protein) synthase III;
FT                   COGs: COG0332 3-oxoacyl-(acyl-carrier-protein); SPTR:
FT                   Q9RT23 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein
FT                   1; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III; 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27433"
FT                   /protein_id="ADD27433.1"
FT                   /translation="MNIGILALGTYAPERVMTNHDFEKILDTSDEWIVSRTGIRERRLA
FT                   AEGEFTSHLAFRAVEDLIRRHGRGALEGVDLVIVATNTPDALFPATAALVQDRFGLNAG
FT                   AYDLLAGCPGWGYAIAQAHAMVKSGLARKVLAIGSETLSKILDYTDRSTAVLFGDGAGA
FT                   AVIGPVPEGYGFKSFVLGADGSGGKELMLRCIADKLPDGSPMRQYAYMNGREVFKFAVR
FT                   VMNTATLEAIEKAGLKPEDIKYLIPHQANARIIEAARERLGLPPEQVWVNVDRYGNTST
FT                   ASMPIALQEALDAGKIHNGDHILFVTFGAGLTWAASVMTWWQPD"
FT   gene            complement(647349..647540)
FT                   /locus_tag="Mrub_0667"
FT   CDS_pept        complement(647349..647540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0667"
FT                   /product="ribosomal protein L32"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; InterPro IPR002677; KEGG: swi:Swit_3554 50S
FT                   ribosomal protein L32; COGs: COG0333 Ribosomal protein L32;
FT                   SPTR: P80339 50S ribosomal protein L32; PFAM: Ribosomal
FT                   L32p protein family; TIGRFAM: ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27434"
FT                   /protein_id="ADD27434.1"
FT                   /translation="MAKHPVPKKKVSKSRRDIRRAAVSTLTAPTLIKCANCGVLIPPHT
FT                   VCDSCGYYAGKKILEVKA"
FT   gene            complement(647630..648388)
FT                   /locus_tag="Mrub_0668"
FT   CDS_pept        complement(647630..648388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0668"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; SPTR:
FT                   A3IPF2 Putative uncharacterized protein; InterPro
FT                   IPR002747:IPR013838; COGs: COG1912 conserved hypothetical
FT                   protein; KEGG: sfu:Sfum_1405 protein of unknown function
FT                   DUF62; PFAM: Protein of unknown function DUF62"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27435"
FT                   /protein_id="ADD27435.1"
FT                   /translation="MREIFFLSDFGLADPYAAVVKAVMRQTAPGAVIHDLAHNLPPGDL
FT                   RRASYILYESVPYLPRQSVVLAVVDPGVGSSRRAVLVIGERLCYVAPDNGLLTLAYLQD
FT                   PPRKAYLLENPAYHLPRKSATFHGRDVFGPVAAHLASGVEPARFGPEVPVAELVRLPIH
FT                   LNFGNHGEVLTFDRFGNAITTLLATPAQVRGKKVRIRYHHIPVASHYAEVPVGSALAYV
FT                   GSAGLLEVAIHLGNAQEQLGLKQGDRVELG"
FT   gene            complement(648464..649960)
FT                   /locus_tag="Mrub_0669"
FT   CDS_pept        complement(648464..649960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0669"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A4BSK8 TPR repeat protein; InterPro IPR013026;
FT                   KEGG: noc:Noc_1987 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27436"
FT                   /protein_id="ADD27436.1"
FT                   /translation="MIALRAVPFAVGIALFAFTALAQLGAEGYYTQCKALYDQGVRDSA
FT                   KATCQLALVDNPNHLPSIKLLGRIYLEENNLAAAQPFLQQMKQLGPQDPEVALLEARFL
FT                   LLEGRPSEALARLPRGLSTEAVLLRAQVLEALGRYEEAYATYLRITASEEARLGAARLA
FT                   ERLGRPQEALGLLGSSPKEQLVQARLMWLSGNSRAAAEALEEVLPRLGPLEKDYIQTLG
FT                   LLAMVYYGLGEFEKGALVLRQLSSRVSLPSSLLGKVWPWLAVFLVYLALVLYGESRIEP
FT                   MRTVEMGNERRFGPGSLHLWLLLAIVLAGLASIGIGQVLYQNLLALFTPFQGQVVRPVF
FT                   YFLMGAFALLIAYRMVGQPGLVQALGPRSSWIEGTWAGLVLLALLGLYAYIAKPLGLSG
FT                   LGTMYPIFFGLAFLEVVVRGVGYPIFKERYKELSGLMIPVLYALAIPGPTIFFLMTSLF
FT                   LGWLYLRTKGALAGATAWVMAGLILTLIANLPWVRTLLIN"
FT   gene            650002..650757
FT                   /locus_tag="Mrub_0670"
FT   CDS_pept        650002..650757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0670"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A4BH61 Putative uncharacterized protein;
FT                   InterPro IPR013026; KEGG: pol:Bpro_4026 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27437"
FT                   /protein_id="ADD27437.1"
FT                   /translation="MHIRYNPCDFVVGCVPLYREETVRSLVLVLMVLWSLALAQNVAAV
FT                   EKLVDDGKFQEAYEAGLRLGSAEGFVLAARAASYFAGYLAKDNEKADWFGRAEAAARRA
FT                   IQADADNAEAYFELARAQGRLSQYRGILESLGLASSIKENLDKALRLNPRHAGARVALA
FT                   LWHHSLISKNVGWLYGANGNQIMPLFNEAIQLEPQTIIHKVELAGVLAAQGKKEEARKQ
FT                   YEAALAIAPKTAADRFDLERARRELAALR"
FT   gene            650974..651552
FT                   /locus_tag="Mrub_0671"
FT   CDS_pept        650974..651552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0671"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; SPTR:
FT                   Q3IP23 Putative uncharacterized protein; InterPro
FT                   IPR002790; COGs: COG1432 conserved hypothetical protein;
FT                   KEGG: vsp:VS_II0673 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27438"
FT                   /protein_id="ADD27438.1"
FT                   /translation="MNDPFSRIPGWSPQQRVGLFVDTQNLYHSARDYYGQNVNFESLMR
FT                   YAVANRQLVRATAYVVEREHDTSAWPFIYKLSTIGFRVRRMNLTLKETTDEGKPIYEGN
FT                   WDMGIAADMVRLMHTLDVVVLGSGDGDFVDIVEVLMERGIRVEVIAFKETTSQKLIDAV
FT                   DRFIHLPEIENAFVPSKERERTLIPRSEP"
FT   gene            651560..652576
FT                   /locus_tag="Mrub_0672"
FT   CDS_pept        651560..652576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0672"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:S-adenosylmethionine/tRNA-ribosyltransferas
FT                   e-isomerase; PFAM: Queuosine biosynthesis protein; InterPro
FT                   IPR003699; KEGG: pca:Pcar_1895 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase; COGs: COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase); SPTR: Q5SMH0
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; TIGRFAM:
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27439"
FT                   /protein_id="ADD27439.1"
FT                   /translation="MNLEDFDYHLPPELIAQSGAEPRDASRLMVIDRQTGQITHRIFRD
FT                   LPQYLRAGDVLVLNQSKVIPARTFATNPHGTGLEVLLVREIPSGEGLWEALLKPARRAK
FT                   VGSRLTFPDGLFATVEAIEADGTRLLRFSGNVWEHLENIGKMPLPPYIQASVDPARYQT
FT                   VYAKTPGSVAAPTAGLHFTPELLDRVRGLGVDIQYVTLHVGPGTFKPVHDDPDRHVMHL
FT                   EPYEVSPQTAEAVNRARAEGRRVIAVGTTVVRTLETAYSAELGGVQAGAGETQLFIRPG
FT                   FKYNVIDTLITNFHLPKSTLLMLVSAFMGHGLMKQAYQTAVAERYRFYSLGDAMLIL"
FT   gene            complement(652614..653162)
FT                   /locus_tag="Mrub_0673"
FT   CDS_pept        complement(652614..653162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0673"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; InterPro
FT                   IPR001451:IPR005881; KEGG: pae:PA3816 O-acetylserine
FT                   synthase; COGs: COG1045 Serine acetyltransferase; SPTR:
FT                   A3LER7 O-acetylserine synthase; PFAM: Bacterial transferase
FT                   hexapeptide (three repeats); TIGRFAM: serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27440"
FT                   /protein_id="ADD27440.1"
FT                   /translation="MLRVIERFREDIQAVLERDPAARGPLEAFLFSPGMHALWMHRLNH
FT                   WLWRANFKLLARILAHFTRMFTGVEIHPGARIGRRVVIDHGMGIVIGETAEVGDDVLMY
FT                   HGVTLGGTGFTREKRHPTIGKGVLLGAHAVVLGPIVVGDGAKIGAGAVVTKPVPPGATA
FT                   IGNPAQIIVREEALEAAPA"
FT   gene            complement(653271..654008)
FT                   /locus_tag="Mrub_0674"
FT   CDS_pept        complement(653271..654008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0674"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; SPTR:
FT                   Q5SK31 UPF0082 protein TTHA0821; InterPro IPR002876; COGs:
FT                   COG0217 conserved hypothetical protein; KEGG: glo:Glov_1245
FT                   protein of unknown function DUF28; PFAM: Domain of unknown
FT                   function DUF28; TIGRFAM: conserved hypothetical protein
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27441"
FT                   /protein_id="ADD27441.1"
FT                   /translation="MAGHSKWAQIKRKKAANDLKKGKIVSKYLRLIAAAARAGGSTDPA
FT                   ANVNLRNLIEAARDADVPNDNIERLLKRLAGGDDEGSNYEEIVYEGYAPGGVAIIVQAL
FT                   SDNRNRTASEVRHIFNKHGGSLGATGSVSWQFERRGYIWVEPNSEAAQEAAIEAGAIDL
FT                   QESEEGLEIYTDPQEVYAVANALKAKGFKPEDTEITMVPQNTMSLSQEEAEKVLRMVEA
FT                   LEELDDVQNVYTNLNLDNVSIGA"
FT   gene            654130..655368
FT                   /locus_tag="Mrub_0675"
FT   CDS_pept        654130..655368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0675"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; SPTR: A1HN83 Beta-ketoacyl
FT                   synthase; KEGG: gbm:Gbem_3104
FT                   3-oxoacyl-(acyl-carrier-protein) synthase 2; COGs: COG0304
FT                   3-oxoacyl-(acyl-carrier-protein) synthase; InterPro
FT                   IPR014031:IPR014030:IPR017568; PFAM: Beta-ketoacyl
FT                   synthase, N-terminal domain; Beta-ketoacyl synthase,
FT                   C-terminal domain; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27442"
FT                   /protein_id="ADD27442.1"
FT                   /translation="MAFMRRVVVTGIGPVAPNGIGAEAFHKAQLEGRSGIRRITQFDAS
FT                   SYPVQIAGEVDINPEAYIDKRELRRLDRFTQLALIAGHLALQDSGLELEKEDPTRIGTL
FT                   IGTGIGGMITWQEQSKVLFEKGGTRLSPFFIPMMIANMASGQLAMKYGFMGPSSTVVTA
FT                   CATGSDAIGNAFRVIQLGEADVMLTGGTEAVVTEMAIGSFGVMRALSTRNHEPEKASRP
FT                   FSKSRDGFVLSEGAAVLVLEEYERAKARGAKIYAELVGFGRSADAHHITEPHPEGAGAA
FT                   LAMQAALRDARIGPEQVGYINAHGTSTPVGDRAETLAIKKVFGEHAYRLSVSSTKSMIG
FT                   HLLGAAGAIEAVATVQALASGILPPTINLEDPDPELDLDYVPNTPRAKQVDYALSNSFA
FT                   FGGMNATLLFKRV"
FT   gene            655528..656745
FT                   /locus_tag="Mrub_0676"
FT   CDS_pept        655528..656745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0676"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; InterPro IPR005151:IPR001478;
FT                   KEGG: sus:Acid_6221 carboxyl-terminal protease; COGs:
FT                   COG0793 Periplasmic protease; SPTR: A7CAG4
FT                   Carboxyl-terminal protease; PFAM: Peptidase family S41"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27443"
FT                   /protein_id="ADD27443.1"
FT                   /translation="MAAFALVGSAVASPAQDLFDQATFLIGFYYNGPAKVPPFRELRRQ
FT                   YQPELDRLCASEGNRCGFDKAKQVIERIVRDIADPFTVLVTRDQLIDDERYGAGLGPAA
FT                   PRIGVWVRETPRGLVVSEAFPGEPAYEAGLRRGDLITQVADQPATLARLSAAEAARNPF
FT                   SLRYSRQGAARSLTLTPRVAGATMQPRLEINNNIAYLRVYHLYSSDSYSTAQRIHEAAR
FT                   RAEQAGARGMVIDLRDALTGYDSEALLAAAAFTGTGGFIYDRRFQGLDETHTVENGKLY
FT                   VQPEGAEKEEQSALERPYLARIPVVVLVNRHTYNSAEMLAYFLQAAGRAKVVGEPTAGA
FT                   LGMSGSAEGPLINGDFIAVSSLRMRNLDGSPFPLKVSPDVVVEDDLEALVAGRDPVLER
FT                   ALEMLR"
FT   gene            656755..658035
FT                   /locus_tag="Mrub_0677"
FT   CDS_pept        656755..658035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0677"
FT                   /product="peptidase S41"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR001478:IPR005151; KEGG: mca:MCA2533 carboxyl-terminal
FT                   protease; SMART: PDZ/DHR/GLGF domain protein; peptidase
FT                   S41; SPTR: A4CSB8 Putative uncharacterized protein; PFAM:
FT                   peptidase S41; PDZ/DHR/GLGF domain protein; PFAM: PDZ
FT                   domain (Also known as DHR or GLGF); Peptidase family S41;
FT                   TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27444"
FT                   /protein_id="ADD27444.1"
FT                   /translation="MRQLFATLALLLGSFSLASPAQDLFDQASFYLEFYYNGPATLNLK
FT                   ELTARYQSALDRACAPQKDTCPYEQAVPIIEQMLGELNDNHTYYLSPEELRGSRESRQG
FT                   NAPSRTLRIGVSHLPVPGSRDRLIVDVVEGGPADEAGLAYGDRIIAINGRLLSEFPDDN
FT                   QVVQFLTQSVQSGRPVVLTILRGPERQRLEITLTGREINLARFPSLKIRPDGVGVLKIP
FT                   NFDAQGQVGRRVHELVREAQQKNVRALVLELRGNSGGLLNEMILAAAAFLDDAYVALVD
FT                   RYQTERAEFRIRDGRLTIIRNGQTESANLPFLARWRGPLVVLVDGNTASGGEYLASAIQ
FT                   RAKVGPLVGVATLGIGNTTTRPFNLINGGALSISYNRAFFADGTPYPPRAIPDFVVESS
FT                   LEQLANTGRDLPFEKALEALGIKSAGR"
FT   gene            658137..658610
FT                   /locus_tag="Mrub_0678"
FT   CDS_pept        658137..658610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0678"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; InterPro
FT                   IPR000182; KEGG: afw:Anae109_0715 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27445"
FT                   /protein_id="ADD27445.1"
FT                   /translation="MKVSTRLVFLPVTTDSAVIVHNLYLNCPTYIALIGGDMPTLNDIQ
FT                   RELETLRHDTRRQAVLLMQEGRAVGFLDYKVAYPDLHSATISLLLIEERLQGQGLGKAA
FT                   VEQLEAQLRSRMNRLYAVVYGNNEQAKCFWERVGFEHLRDSGPTLSWYMKSLQ"
FT   gene            658726..659412
FT                   /locus_tag="Mrub_0679"
FT   CDS_pept        658726..659412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0679"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="SPTR: O59564 282aa long hypothetical dehydrogenase;
FT                   InterPro IPR002347; COGs: COG1028 Dehydrogenase with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenase); KEGG: met:M446_5987 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27446"
FT                   /protein_id="ADD27446.1"
FT                   /translation="MVVTARNQQKLEELVHEIRAAGGEAHAIAADLTQDRALEHLIAQT
FT                   QKLGTVELFLGNTAGPKPGAARDLKVQDIRVAAEQLWYPMVALVNALLPGMQSRQFGRI
FT                   LFITSLAAKEPIENLALSNALRAGLTGYAKTLAREVAPFGITVNTLGPGYTRTERVEEV
FT                   FAFRAQQQGISLEAAYAQQTAQIPAGRMAYPQEIADVAVFLLSARAGYLTGQAIMVEGG
FT                   AIRGLL"
FT   gene            complement(659484..660071)
FT                   /locus_tag="Mrub_0680"
FT   CDS_pept        complement(659484..660071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0680"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR003593:IPR005895; KEGG: sme:SMa1184 NosF
FT                   ATPase; COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; SPTR: A6GFN6 Putative uncharacterized
FT                   protein; PFAM: ABC transporter; TIGRFAM: heme ABC exporter,
FT                   ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27447"
FT                   /protein_id="ADD27447.1"
FT                   /translation="MVCSMLIEAIAVSKRYGRDWVLRNLDFQLAQHEAVALVGPNGVGK
FT                   TTLLRVLAGLVRPTQGSVKLSGRVGFLANPPAFHRHFTGAENLHYALRLDGKTGGRSEI
FT                   RAALTQFGLPHDKPVLSYSSGMKKRLAMARLHLQNPDIWLLDEPEAALDAQGRGLLENL
FT                   VQQARSRGGVVIATHDKSWLSLVDRIVELQGP"
FT   gene            complement(660081..660770)
FT                   /locus_tag="Mrub_0681"
FT   CDS_pept        complement(660081..660770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0681"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; SPTR: A3SRT8 CcdA, cytochrome c-type biogenesis
FT                   protein CdcA; InterPro IPR003834; COGs: COG0785 Cytochrome
FT                   c biogenesis protein; KEGG: maq:Maqu_3250 cytochrome c
FT                   biogenesis protein, transmembrane region; PFAM: Cytochrome
FT                   C biogenesis protein transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27448"
FT                   /protein_id="ADD27448.1"
FT                   /translation="MAAMSVVAAFLAGILSFLSPCVLPLVPTYLLYLGGERGRPLLNAL
FT                   FFVGGFSLLFLLLGLPFTLLGSFLSENRQLLGQAGGAILVLLGLYMLGLKPQWGVNLRY
FT                   QGDTSRPWGAFVLGAVLGLGWTPCIGPILGGILTLTAAGGGINSLLAYILGLAVPFLLV
FT                   ALLTDRIRPVLRQAARFSRWAEAVAGVALVAMGILMFTGTFTRLNSFFIKITPERLLNL
FT                   EKILIGQ"
FT   gene            660835..661848
FT                   /locus_tag="Mrub_0682"
FT   CDS_pept        660835..661848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0682"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: pmy:Pmen_1328
FT                   ABC transporter related; COGs: COG3842 ABC-type
FT                   spermidine/putrescine transport systems ATPase components;
FT                   SPTR: Q8U0R5 Sugar-binding transport ATP-binding protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27449"
FT                   /protein_id="ADD27449.1"
FT                   /translation="MLRVIGLGKSYPGFRLQVSLEVGVGQTLALLGPSGSGKSTLLRLI
FT                   AGLEAPEVGQVWLEQTELTPLAPEARRVGFVFQDYALFPHLSVWENIAFGLREARWDGA
FT                   SIRRRVAELLDLTHLGPHAQKRPNQLSGGERQRVALARALANRPRLLLLDEPLGALDLK
FT                   LRHELLWELRAILRQAGVPTIVVTHDQSEAFVIAQQIALLRGGAVVQVGSPEQLFRHPK
FT                   NAWVAGFLGHRNLLSADQSQQMGLPARPHLLPPEAITLGQGEEARVEERVFKGFVVGLE
FT                   LLWRGCKLYLEGPELGLYPGDTTQLGIDWSRVVALEEEPSSTPGAAQPSLEAPRAR"
FT   gene            661862..662500
FT                   /locus_tag="Mrub_0683"
FT   CDS_pept        661862..662500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0683"
FT                   /product="thiamine pyrophosphokinase"
FT                   /note="TIGRFAM: thiamine pyrophosphokinase; PFAM: Thiamin
FT                   pyrophosphokinase catalytic region; InterPro
FT                   IPR007371:IPR006282; KEGG: ret:RHE_CH04030 hypothetical
FT                   protein; COGs: COG1564 Thiamine pyrophosphokinase; SPTR:
FT                   A8RWT7 Putative uncharacterized protein; PFAM: Thiamin
FT                   pyrophosphokinase, catalytic domain; TIGRFAM: thiamine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27450"
FT                   /protein_id="ADD27450.1"
FT                   /translation="MQRFTILLGGLVTPTERLKAQVAGSRVIAADGGMRHAQALGLQAE
FT                   LWVGDFDSAPAELQQAYAQVPRETYPVAKDFTDGELAIEAALARGAAQLVLVGAMGGQT
FT                   DQTLAHLLLGIRLAQQGVPTLLTSGSEEAHPLLPGALRLDLPLHSKLSLLPLGGFSGLS
FT                   LRGVRWPLQKASIPLGSTQTLSNLAVGPVEIELEAGYGVVVAYPEPATL"
FT   gene            complement(662476..662973)
FT                   /locus_tag="Mrub_0684"
FT   CDS_pept        complement(662476..662973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27451"
FT                   /protein_id="ADD27451.1"
FT                   /translation="MDPFREYQDYVIAHRLREALDFFPGKLYSLCEYATLRLRRSELVR
FT                   KLVGRQGDPALLSRIEQISDEINFGFWSNPGLLKAFLKRLPPQQYPVLHSPEAFETLLS
FT                   HTERLRLKEPGLAGRYYLGWLRLPALLDEPSAFEQAMLEQEHLAEALGLFLDEFHKVAG
FT                   SG"
FT   gene            663004..663318
FT                   /locus_tag="Mrub_0685"
FT   CDS_pept        663004..663318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27452"
FT                   /protein_id="ADD27452.1"
FT                   /translation="MKEATAEKIPLLWWGLHPFWVTDAVYSGMDTRGWVLKAIETLRFA
FT                   SEKDIMRWLDEEGETLSKDELRRTLELLLQEDQLELKNDLFRLKRKSGSQSAFDSLFKD
FT                   "
FT   gene            663366..664541
FT                   /locus_tag="Mrub_0686"
FT   CDS_pept        663366..664541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0686"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; peptidase M20; SPTR: A2V759 Aminopeptidase;
FT                   InterPro IPR003137:IPR007484:IPR002933; COGs: COG2234
FT                   aminopeptidase; KEGG: bha:BH3861 aminopeptidase; PFAM:
FT                   Peptidase family M20/M25/M40; PA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27453"
FT                   /protein_id="ADD27453.1"
FT                   /translation="MGRQLFLRGALGLVAIGLLALAQAFSTERMQADLQALLSQGPRVA
FT                   GLPATTAAGEYLAAELRKVGYTVEFQPFTYSRTRDQGSSLLVGTTSFPVSSVAGSPGRR
FT                   VEGPLAVVPGAGLAADFADLNLQGAIAVVRRGGIPGLEKARLAAERGAVGLILLTEEPS
FT                   GTRFTFGGNSPIPGVTLSQSDGAGLFSQAGTRAVLDVRIVTEEVQGRNVIARRSSQNPL
FT                   VIVGAHYDSVPGSPGANDNASGTVTVLELARQLADSPLAAQIWFLFFDGEEDGLWGSRR
FT                   FVEQNPEIVRGLKGMLNLDMVGVNVNGTLGIGGSGELRALADCNALQVACGSAPGGGSD
FT                   HVPFAQAGVPVLFFFRGLDPNYHRPTDTLADPVLMAQTGQVVRGILERLLR"
FT   gene            complement(664548..665462)
FT                   /locus_tag="Mrub_0687"
FT   CDS_pept        complement(664548..665462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0687"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; SPTR: B3LQP1 Putative uncharacterized protein;
FT                   InterPro IPR001926:IPR000634; COGs: COG1171 Threonine
FT                   dehydratase; KEGG: aav:Aave_3217
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27454"
FT                   /protein_id="ADD27454.1"
FT                   /translation="MLTLQDIQHAAQRIAPYIHHTPVLSSQGLDKLLGRRFFFKAEHLQ
FT                   KTGSFKARGALNAALQLQNPRGLIAVSSGNHAQGVAYAAQVIGAPALVVMPEDASPTKK
FT                   AATRAYGAEVYDQGVTVENREQVVRALAEETGYALIHPFDDLRVMAGQGTQALELLQQV
FT                   PDLDAVLVAVGGGGLISGIATVIKSLRPACEVIGVEPETANDAQQSLQMGARVKLVQAP
FT                   RTVADGVRTLAVGEKTFPVMQRHVDRIVTVPDEVTLEAQRLMMQRLKQVVEPTAGLALG
FT                   PALMSYDLPERVAVIVCGGNWMP"
FT   gene            665557..666036
FT                   /locus_tag="Mrub_0688"
FT   CDS_pept        665557..666036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27455"
FT                   /protein_id="ADD27455.1"
FT                   /translation="MRILAEAIYELEPGFVLVGQTPALRELLKIWIHRHHMGFDLYVTS
FT                   IVEAEEETFPERMRNTIGRGLASSAEVLEALHCLEDIYPVAFHVLKNLPVGVRKATPEL
FT                   LALLEEQVVRVARSTTTGEFGPDDPPAQVVKLKAVCALDDYASDDDVSGLVLTDP"
FT   gene            666060..667382
FT                   /locus_tag="Mrub_0689"
FT   CDS_pept        666060..667382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0689"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="TIGRFAM: RNA modification enzyme, MiaB family; PFAM:
FT                   Protein of unknown function UPF0004 ; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   InterProIPR007197:IPR013848:IPR006638:IPR002792:IPR 005839;
FT                   KEGG: gsu:GSU2568 MiaB-like tRNA modifying enzyme; COGs:
FT                   COG0621 2-methylthioadenine synthetase; SPTR: A1HR14 RNA
FT                   modification enzyme, MiaB family; PFAM: Radical SAM
FT                   superfamily; Uncharacterized protein family UPF0004;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27456"
FT                   /protein_id="ADD27456.1"
FT                   /translation="MPLMEGVRLAVKTLGCKVNQVESDALVGLLKPLQPVVVPLEAGAD
FT                   LVVINTCAVTTSAEADARKEVRRARRANPAAFIVVTGCYAELAPDQLAELGADVVLPNS
FT                   RKAELPGVILQRFGLPADPITTPPNEFWGAGERGLLNNYVRAFLKVQDGCNAGCAYCII
FT                   PRLRGRERHRGYRDALSEAGALLEAGVQEIVLTGVRLGSYKGHPRGIAGLVEELALMGA
FT                   KVRLSSIEPEDTGDELLRVMQRFAPQVRPHLHLSLQTGSGRLLALMGRRYDKNYYRELA
FT                   QKAYDWIPGFALTTDVIAGLPTETEDEHQETLAFLEEVRPSRVHVFTYTPRPKTRAASL
FT                   PQVPIEIRKRRNKELQALAARLAEARVRPKLGGAVEVLVESFRGGKAYGHTPDYYEVEF
FT                   TGQARIGQTAWVRVEAIEGYTLRGALEAIKQEPARYLLPVV"
FT   gene            complement(667386..667751)
FT                   /locus_tag="Mrub_0690"
FT   CDS_pept        complement(667386..667751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0690"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27457"
FT                   /protein_id="ADD27457.1"
FT                   /translation="MGSLPARALWTGVFLILVSTLAVMGSKLTPTALIPGILGLLIALM
FT                   GIWADKTPSQKNLAMNIALGLSLLGLLGSLRGIPDFITLLGGGTVERPVAAMAQFATVF
FT                   ICLGFSIRWLVERRRKA"
FT   gene            667812..668138
FT                   /locus_tag="Mrub_0691"
FT   CDS_pept        667812..668138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0691"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; SPTR: A7C7G6
FT                   Histidine triad (HIT) protein; InterPro IPR001310; COGs:
FT                   COG0537 Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolase; KEGG: xca:xccb100_3356
FT                   histidine triad-like protein; PFAM: HIT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27458"
FT                   /protein_id="ADD27458.1"
FT                   /translation="MENPTVFGKIIRRELPADIVYEDDEFIAFKDIRPRSKVHILVCPK
FT                   EYIPTLADYPDTPEGALKLGKLMLTANRIAKQMGLEGYFIRIHVGEKGGQEVFHVHVHL
FT                   RSDA"
FT   gene            complement(668153..668920)
FT                   /locus_tag="Mrub_0692"
FT   CDS_pept        complement(668153..668920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0692"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; InterPro IPR004843;
FT                   KEGG: sus:Acid_0081 metallophosphoesterase; SPTR: A3YZQ5
FT                   Putative purple acid phosphatase; PFAM: Calcineurin-like
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27459"
FT                   /protein_id="ADD27459.1"
FT                   /translation="MRRLLALFLGLALGLPGLAQRLAVLGDWGAETPHRPLVAQALQQQ
FT                   HQVQPFEALLTLGDNFYPRGQPVRRYLEELPPVRIYPAFGNHDVPALTKQLELFRVEGP
FT                   YYAFRLENLEVFVVYSEHFSQAQRRWLEAALKASQAPWKIVALHRPLYSSGFHGGARSL
FT                   RQSIEPLLIQYRVPLVLAGHEHSYERLEARGVVHIVAGGGGAWLRDFRVVQPQSKVRLK
FT                   SPNYLILEASIERLLITAYNERNEVIDRVELKK"
FT   gene            complement(668917..669348)
FT                   /locus_tag="Mrub_0693"
FT   CDS_pept        complement(668917..669348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0693"
FT                   /product="protein of unknown function DUF151"
FT                   /note="InterPro IPR003729; PFAM: protein of unknown
FT                   function DUF151; COGs: COG1259 conserved hypothetical
FT                   protein; KEGG: dvu:DVU0983 hypothetical protein; SPTR:
FT                   A0YTA3 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27460"
FT                   /protein_id="ADD27460.1"
FT                   /translation="MVPARIEGMGVDPGNGNLIVMLRAENDLLLPVVIGALETQNIMVH
FT                   LSGEKPPRPLGPDLFYNTLELLGVKVLRLEIAELKEGTFYGRLILEQRGLEYEIDCRPS
FT                   DGMALAIRAGAPILIAEQVLEQAGIKESQLNRRGEPPKA"
FT   gene            669434..669976
FT                   /locus_tag="Mrub_0694"
FT   CDS_pept        669434..669976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0694"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; SPTR: A5TS89
FT                   Adenine phosphoribosyltransferase; InterPro IPR000836;
FT                   COGs: COG0503 Adenine/guanine phosphoribosyltransferase and
FT                   related PRPP-binding protein; KEGG: afr:AFE_0540 adenine
FT                   phosphoribosyltransferase, putative; PFAM: Phosphoribosyl
FT                   transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27461"
FT                   /protein_id="ADD27461.1"
FT                   /translation="MTVKTYAVEVAGVRRELPVVQVGPDVAVALFNMLGDTEVVEEAAA
FT                   ALAKRMPAEIETLVTPEVKAVPLAHALSRLTGKPYVVARKTEKPYMINPVSRTVISITT
FT                   GKPQLLVLDGTDVPLIKGKKVAIVDDVVSTGSTLKGLSDLITDVGGQVAAVLAVFTEGS
FT                   PREDVIALGHLPLFKPD"
FT   gene            670122..670658
FT                   /locus_tag="Mrub_0695"
FT   CDS_pept        670122..670658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0695"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; SPTR: A5TS89
FT                   Adenine phosphoribosyltransferase; InterPro IPR000836;
FT                   COGs: COG0503 Adenine/guanine phosphoribosyltransferase and
FT                   related PRPP-binding protein; KEGG: dps:DP1516 adenine
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27462"
FT                   /protein_id="ADD27462.1"
FT                   /translation="METYPITIGKITRHVPVVETLPGVHIPLVEIMGDVELVQAAAEGL
FT                   VKHLPPETDALLTLETSPIVLAHTMSALCGKPYVVVRRKRRPYMQDPIIQEVESLTLGV
FT                   TETLWLDSRMAEKLMGQNVALVFDVVSSGGTMNALEKVAKKAGANVVARLAAFHQGNSK
FT                   LPITFLSEIPILQTA"
FT   gene            complement(670726..671382)
FT                   /locus_tag="Mrub_0696"
FT   CDS_pept        complement(670726..671382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0696"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; SPTR: A6C3M0
FT                   Putative uncharacterized protein; InterPro IPR003140; COGs:
FT                   COG4099 peptidase; KEGG: sml:Smlt1102 hypothetical protein;
FT                   PFAM: Phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27463"
FT                   /protein_id="ADD27463.1"
FT                   /translation="MNPFSYHKPRSQLPYALYLPAGKPPKGGWPLILFLHGSGERGSDG
FT                   RKQSTVGLGPAIQENPQRWPAVVLMPQCPKGQQWAGEPLAQAYELLHQVEQEHQTNPRR
FT                   VYLTGLSMGGYGSWNLGGLYPRRFAAIAPICGAADPFMVWQRLGKVPIWNFHGAADEVV
FT                   PVSFSRALADALAKAGNTRARFTEYPSEKHDVWNRVYRELEFIQWLFAQQKRGGS"
FT   gene            complement(671406..671810)
FT                   /locus_tag="Mrub_0697"
FT   CDS_pept        complement(671406..671810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0697"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; SPTR: A3LF67
FT                   Putative uncharacterized protein; InterPro
FT                   IPR006683:IPR003736; COGs: COG2050 Uncharacterized protein
FT                   possibly involved in aromatic compounds catabolism; KEGG:
FT                   pap:PSPA7_1137 hypothetical protein; PFAM: Thioesterase
FT                   superfamily; TIGRFAM: uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27464"
FT                   /protein_id="ADD27464.1"
FT                   /translation="MHPSNLEEIQRLYTQAHFVQHIGLRLLDVGEGWCETAVDIQAHHQ
FT                   QQDGFIHAGVQATMADHSAGTAAATLIKPGQYVLTVEFKINLLRPAQGELLRCRAEVLK
FT                   PGRSLCVVESVVFAEKLFSKATVTLAVLDR"
FT   gene            complement(671816..673471)
FT                   /locus_tag="Mrub_0698"
FT   CDS_pept        complement(671816..673471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0698"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PRIAM: Methylmalonyl-CoA mutase; PFAM: methylmalonyl-CoA
FT                   mutase; InterPro IPR006099:IPR006098; KEGG:
FT                   aba:Acid345_1454 methylmalonyl-CoA mutase; COGs: COG1884
FT                   Methylmalonyl-CoA mutase N-terminal domain/subunit; SPTR:
FT                   B5ISK6 Methylmalonyl-CoA mutase N-terminal domain
FT                   subfamily; PFAM: Methylmalonyl-CoA m