(data stored in ACNUC7421 zone)

EMBL: CP001744

ID   CP001744; SV 1; circular; genomic DNA; STD; PRO; 5423075 BP.
XX
AC   CP001744; ABUK01000000-ABUK01000014;
XX
PR   Project:PRJNA29411;
XX
DT   19-MAY-2010 (Rel. 104, Created)
DT   01-SEP-2017 (Rel. 134, Last updated, Version 7)
XX
DE   Planctopirus limnophila DSM 3776 chromosome, complete genome.
XX
KW   .
XX
OS   Planctopirus limnophila DSM 3776
OC   Bacteria; Planctomycetes; Planctomycetia; Planctomycetales;
OC   Planctomycetaceae; Planctopirus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5423075
RX   PUBMED; 21304691.
RA   Labutti K., Sikorski J., Schneider S., Nolan M., Lucas S.,
RA   Glavina Del Rio T., Tice H., Cheng J.F., Goodwin L., Pitluck S.,
RA   Liolios K., Ivanova N., Mavromatis K., Mikhailova N., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D.,
RA   Tindall B.J., Rohde M., Goker M., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P., Lapidus A.;
RT   "Complete genome sequence of Planctomyces limnophilus type strain (Mu
RT   290)";
RL   Stand Genomic Sci 3(1):47-56(2010).
XX
RN   [2]
RP   1-5423075
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Ovchinnikova G., LaButti K., Clum A., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Markowitz V.,
RA   Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Tindal B., Klenk H.-P.,
RA   Eisen J.A.;
RT   "The complete chromosome of Planctomyces limnophilus DSM 3776";
RL   Unpublished.
XX
RN   [3]
RP   1-5423075
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K.,
RA   Mikhailova N., Ovchinnikova G., LaButti K., Clum A., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Markowitz V.,
RA   Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Tindal B., Klenk H.-P.,
RA   Eisen J.A.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; efeb9ad445ad644bf3d78c8bf8ffa5d6.
DR   BioSample; SAMN02598463.
DR   CABRI; DSM 3776.
DR   EnsemblGenomes-Gn; EBG00001104220.
DR   EnsemblGenomes-Gn; EBG00001104221.
DR   EnsemblGenomes-Gn; EBG00001104222.
DR   EnsemblGenomes-Gn; EBG00001104223.
DR   EnsemblGenomes-Gn; EBG00001104224.
DR   EnsemblGenomes-Gn; EBG00001104225.
DR   EnsemblGenomes-Gn; EBG00001104226.
DR   EnsemblGenomes-Gn; EBG00001104227.
DR   EnsemblGenomes-Gn; EBG00001104228.
DR   EnsemblGenomes-Gn; EBG00001104229.
DR   EnsemblGenomes-Gn; EBG00001104230.
DR   EnsemblGenomes-Gn; EBG00001104231.
DR   EnsemblGenomes-Gn; EBG00001104232.
DR   EnsemblGenomes-Gn; EBG00001104233.
DR   EnsemblGenomes-Gn; EBG00001104234.
DR   EnsemblGenomes-Gn; EBG00001104235.
DR   EnsemblGenomes-Gn; EBG00001104236.
DR   EnsemblGenomes-Gn; EBG00001104237.
DR   EnsemblGenomes-Gn; EBG00001104238.
DR   EnsemblGenomes-Gn; EBG00001104239.
DR   EnsemblGenomes-Gn; EBG00001104240.
DR   EnsemblGenomes-Gn; EBG00001104241.
DR   EnsemblGenomes-Gn; EBG00001104242.
DR   EnsemblGenomes-Gn; EBG00001104243.
DR   EnsemblGenomes-Gn; EBG00001104244.
DR   EnsemblGenomes-Gn; EBG00001104246.
DR   EnsemblGenomes-Gn; EBG00001104247.
DR   EnsemblGenomes-Gn; EBG00001104248.
DR   EnsemblGenomes-Gn; EBG00001104249.
DR   EnsemblGenomes-Gn; EBG00001104250.
DR   EnsemblGenomes-Gn; EBG00001104251.
DR   EnsemblGenomes-Gn; EBG00001104252.
DR   EnsemblGenomes-Gn; EBG00001104253.
DR   EnsemblGenomes-Gn; EBG00001104254.
DR   EnsemblGenomes-Gn; EBG00001104255.
DR   EnsemblGenomes-Gn; EBG00001104256.
DR   EnsemblGenomes-Gn; EBG00001104257.
DR   EnsemblGenomes-Gn; EBG00001104258.
DR   EnsemblGenomes-Gn; EBG00001104259.
DR   EnsemblGenomes-Gn; EBG00001104260.
DR   EnsemblGenomes-Gn; EBG00001104261.
DR   EnsemblGenomes-Gn; EBG00001104262.
DR   EnsemblGenomes-Gn; EBG00001104263.
DR   EnsemblGenomes-Gn; EBG00001104264.
DR   EnsemblGenomes-Gn; EBG00001104265.
DR   EnsemblGenomes-Gn; EBG00001104266.
DR   EnsemblGenomes-Gn; EBG00001104267.
DR   EnsemblGenomes-Gn; EBG00001104268.
DR   EnsemblGenomes-Gn; EBG00001104269.
DR   EnsemblGenomes-Gn; EBG00001104270.
DR   EnsemblGenomes-Gn; EBG00001104271.
DR   EnsemblGenomes-Gn; EBG00001104272.
DR   EnsemblGenomes-Gn; EBG00001104273.
DR   EnsemblGenomes-Gn; EBG00001104274.
DR   EnsemblGenomes-Gn; EBG00001104275.
DR   EnsemblGenomes-Gn; EBG00001104276.
DR   EnsemblGenomes-Gn; EBG00001104277.
DR   EnsemblGenomes-Gn; EBG00001104278.
DR   EnsemblGenomes-Gn; EBG00001104279.
DR   EnsemblGenomes-Gn; EBG00001104280.
DR   EnsemblGenomes-Gn; EBG00001104281.
DR   EnsemblGenomes-Gn; EBG00001104282.
DR   EnsemblGenomes-Gn; EBG00001104283.
DR   EnsemblGenomes-Gn; EBG00001104284.
DR   EnsemblGenomes-Gn; EBG00001104285.
DR   EnsemblGenomes-Gn; EBG00001104286.
DR   EnsemblGenomes-Gn; EBG00001104287.
DR   EnsemblGenomes-Gn; EBG00001104288.
DR   EnsemblGenomes-Gn; EBG00001104289.
DR   EnsemblGenomes-Gn; EBG00001104290.
DR   EnsemblGenomes-Gn; EBG00001104292.
DR   EnsemblGenomes-Gn; EBG00001104293.
DR   EnsemblGenomes-Gn; EBG00001104294.
DR   EnsemblGenomes-Gn; EBG00001104295.
DR   EnsemblGenomes-Gn; EBG00001104296.
DR   EnsemblGenomes-Gn; EBG00001104297.
DR   EnsemblGenomes-Gn; EBG00001104298.
DR   EnsemblGenomes-Gn; EBG00001104299.
DR   EnsemblGenomes-Gn; EBG00001104300.
DR   EnsemblGenomes-Gn; Plim_R0001.
DR   EnsemblGenomes-Gn; Plim_R0002.
DR   EnsemblGenomes-Gn; Plim_R0003.
DR   EnsemblGenomes-Gn; Plim_R0004.
DR   EnsemblGenomes-Gn; Plim_R0005.
DR   EnsemblGenomes-Gn; Plim_R0006.
DR   EnsemblGenomes-Gn; Plim_R0007.
DR   EnsemblGenomes-Gn; Plim_R0008.
DR   EnsemblGenomes-Gn; Plim_R0009.
DR   EnsemblGenomes-Gn; Plim_R0010.
DR   EnsemblGenomes-Gn; Plim_R0011.
DR   EnsemblGenomes-Gn; Plim_R0012.
DR   EnsemblGenomes-Gn; Plim_R0013.
DR   EnsemblGenomes-Gn; Plim_R0014.
DR   EnsemblGenomes-Gn; Plim_R0015.
DR   EnsemblGenomes-Gn; Plim_R0016.
DR   EnsemblGenomes-Gn; Plim_R0017.
DR   EnsemblGenomes-Gn; Plim_R0018.
DR   EnsemblGenomes-Gn; Plim_R0019.
DR   EnsemblGenomes-Gn; Plim_R0020.
DR   EnsemblGenomes-Gn; Plim_R0021.
DR   EnsemblGenomes-Gn; Plim_R0022.
DR   EnsemblGenomes-Gn; Plim_R0023.
DR   EnsemblGenomes-Gn; Plim_R0024.
DR   EnsemblGenomes-Gn; Plim_R0026.
DR   EnsemblGenomes-Gn; Plim_R0027.
DR   EnsemblGenomes-Gn; Plim_R0028.
DR   EnsemblGenomes-Gn; Plim_R0029.
DR   EnsemblGenomes-Gn; Plim_R0030.
DR   EnsemblGenomes-Gn; Plim_R0031.
DR   EnsemblGenomes-Gn; Plim_R0032.
DR   EnsemblGenomes-Gn; Plim_R0033.
DR   EnsemblGenomes-Gn; Plim_R0034.
DR   EnsemblGenomes-Gn; Plim_R0035.
DR   EnsemblGenomes-Gn; Plim_R0036.
DR   EnsemblGenomes-Gn; Plim_R0037.
DR   EnsemblGenomes-Gn; Plim_R0038.
DR   EnsemblGenomes-Gn; Plim_R0039.
DR   EnsemblGenomes-Gn; Plim_R0040.
DR   EnsemblGenomes-Gn; Plim_R0041.
DR   EnsemblGenomes-Gn; Plim_R0042.
DR   EnsemblGenomes-Gn; Plim_R0043.
DR   EnsemblGenomes-Gn; Plim_R0044.
DR   EnsemblGenomes-Gn; Plim_R0045.
DR   EnsemblGenomes-Gn; Plim_R0046.
DR   EnsemblGenomes-Gn; Plim_R0047.
DR   EnsemblGenomes-Gn; Plim_R0048.
DR   EnsemblGenomes-Gn; Plim_R0049.
DR   EnsemblGenomes-Gn; Plim_R0050.
DR   EnsemblGenomes-Gn; Plim_R0051.
DR   EnsemblGenomes-Gn; Plim_R0052.
DR   EnsemblGenomes-Gn; Plim_R0053.
DR   EnsemblGenomes-Gn; Plim_R0054.
DR   EnsemblGenomes-Gn; Plim_R0055.
DR   EnsemblGenomes-Gn; Plim_R0056.
DR   EnsemblGenomes-Gn; Plim_R0057.
DR   EnsemblGenomes-Gn; Plim_R0058.
DR   EnsemblGenomes-Gn; Plim_R0059.
DR   EnsemblGenomes-Gn; Plim_R0060.
DR   EnsemblGenomes-Gn; Plim_R0061.
DR   EnsemblGenomes-Gn; Plim_R0062.
DR   EnsemblGenomes-Gn; Plim_R0063.
DR   EnsemblGenomes-Gn; Plim_R0064.
DR   EnsemblGenomes-Gn; Plim_R0065.
DR   EnsemblGenomes-Gn; Plim_R0066.
DR   EnsemblGenomes-Gn; Plim_R0067.
DR   EnsemblGenomes-Gn; Plim_R0068.
DR   EnsemblGenomes-Gn; Plim_R0069.
DR   EnsemblGenomes-Tr; EBT00001696086.
DR   EnsemblGenomes-Tr; EBT00001696087.
DR   EnsemblGenomes-Tr; EBT00001696088.
DR   EnsemblGenomes-Tr; EBT00001696089.
DR   EnsemblGenomes-Tr; EBT00001696090.
DR   EnsemblGenomes-Tr; EBT00001696091.
DR   EnsemblGenomes-Tr; EBT00001696092.
DR   EnsemblGenomes-Tr; EBT00001696093.
DR   EnsemblGenomes-Tr; EBT00001696094.
DR   EnsemblGenomes-Tr; EBT00001696095.
DR   EnsemblGenomes-Tr; EBT00001696096.
DR   EnsemblGenomes-Tr; EBT00001696097.
DR   EnsemblGenomes-Tr; EBT00001696098.
DR   EnsemblGenomes-Tr; EBT00001696099.
DR   EnsemblGenomes-Tr; EBT00001696100.
DR   EnsemblGenomes-Tr; EBT00001696101.
DR   EnsemblGenomes-Tr; EBT00001696102.
DR   EnsemblGenomes-Tr; EBT00001696103.
DR   EnsemblGenomes-Tr; EBT00001696104.
DR   EnsemblGenomes-Tr; EBT00001696105.
DR   EnsemblGenomes-Tr; EBT00001696106.
DR   EnsemblGenomes-Tr; EBT00001696107.
DR   EnsemblGenomes-Tr; EBT00001696108.
DR   EnsemblGenomes-Tr; EBT00001696109.
DR   EnsemblGenomes-Tr; EBT00001696110.
DR   EnsemblGenomes-Tr; EBT00001696111.
DR   EnsemblGenomes-Tr; EBT00001696112.
DR   EnsemblGenomes-Tr; EBT00001696113.
DR   EnsemblGenomes-Tr; EBT00001696114.
DR   EnsemblGenomes-Tr; EBT00001696115.
DR   EnsemblGenomes-Tr; EBT00001696116.
DR   EnsemblGenomes-Tr; EBT00001696117.
DR   EnsemblGenomes-Tr; EBT00001696119.
DR   EnsemblGenomes-Tr; EBT00001696120.
DR   EnsemblGenomes-Tr; EBT00001696121.
DR   EnsemblGenomes-Tr; EBT00001696122.
DR   EnsemblGenomes-Tr; EBT00001696123.
DR   EnsemblGenomes-Tr; EBT00001696124.
DR   EnsemblGenomes-Tr; EBT00001696125.
DR   EnsemblGenomes-Tr; EBT00001696126.
DR   EnsemblGenomes-Tr; EBT00001696127.
DR   EnsemblGenomes-Tr; EBT00001696128.
DR   EnsemblGenomes-Tr; EBT00001696129.
DR   EnsemblGenomes-Tr; EBT00001696130.
DR   EnsemblGenomes-Tr; EBT00001696131.
DR   EnsemblGenomes-Tr; EBT00001696132.
DR   EnsemblGenomes-Tr; EBT00001696133.
DR   EnsemblGenomes-Tr; EBT00001696134.
DR   EnsemblGenomes-Tr; EBT00001696135.
DR   EnsemblGenomes-Tr; EBT00001696137.
DR   EnsemblGenomes-Tr; EBT00001696138.
DR   EnsemblGenomes-Tr; EBT00001696139.
DR   EnsemblGenomes-Tr; EBT00001696140.
DR   EnsemblGenomes-Tr; EBT00001696141.
DR   EnsemblGenomes-Tr; EBT00001696142.
DR   EnsemblGenomes-Tr; EBT00001696143.
DR   EnsemblGenomes-Tr; EBT00001696144.
DR   EnsemblGenomes-Tr; EBT00001696145.
DR   EnsemblGenomes-Tr; EBT00001696146.
DR   EnsemblGenomes-Tr; EBT00001696147.
DR   EnsemblGenomes-Tr; EBT00001696148.
DR   EnsemblGenomes-Tr; EBT00001696149.
DR   EnsemblGenomes-Tr; EBT00001696150.
DR   EnsemblGenomes-Tr; EBT00001696151.
DR   EnsemblGenomes-Tr; EBT00001696152.
DR   EnsemblGenomes-Tr; EBT00001696153.
DR   EnsemblGenomes-Tr; EBT00001696154.
DR   EnsemblGenomes-Tr; EBT00001696155.
DR   EnsemblGenomes-Tr; EBT00001696156.
DR   EnsemblGenomes-Tr; EBT00001696157.
DR   EnsemblGenomes-Tr; EBT00001696158.
DR   EnsemblGenomes-Tr; EBT00001696159.
DR   EnsemblGenomes-Tr; EBT00001696160.
DR   EnsemblGenomes-Tr; EBT00001696161.
DR   EnsemblGenomes-Tr; EBT00001696162.
DR   EnsemblGenomes-Tr; EBT00001696163.
DR   EnsemblGenomes-Tr; EBT00001696164.
DR   EnsemblGenomes-Tr; EBT00001696165.
DR   EnsemblGenomes-Tr; EBT00001696166.
DR   EnsemblGenomes-Tr; Plim_R0001-1.
DR   EnsemblGenomes-Tr; Plim_R0002-1.
DR   EnsemblGenomes-Tr; Plim_R0003-1.
DR   EnsemblGenomes-Tr; Plim_R0004-1.
DR   EnsemblGenomes-Tr; Plim_R0005-1.
DR   EnsemblGenomes-Tr; Plim_R0006-1.
DR   EnsemblGenomes-Tr; Plim_R0007-1.
DR   EnsemblGenomes-Tr; Plim_R0008-1.
DR   EnsemblGenomes-Tr; Plim_R0009-1.
DR   EnsemblGenomes-Tr; Plim_R0010-1.
DR   EnsemblGenomes-Tr; Plim_R0011-1.
DR   EnsemblGenomes-Tr; Plim_R0012-1.
DR   EnsemblGenomes-Tr; Plim_R0013-1.
DR   EnsemblGenomes-Tr; Plim_R0014-1.
DR   EnsemblGenomes-Tr; Plim_R0015-1.
DR   EnsemblGenomes-Tr; Plim_R0016-1.
DR   EnsemblGenomes-Tr; Plim_R0017-1.
DR   EnsemblGenomes-Tr; Plim_R0018-1.
DR   EnsemblGenomes-Tr; Plim_R0019-1.
DR   EnsemblGenomes-Tr; Plim_R0020-1.
DR   EnsemblGenomes-Tr; Plim_R0021-1.
DR   EnsemblGenomes-Tr; Plim_R0022-1.
DR   EnsemblGenomes-Tr; Plim_R0023-1.
DR   EnsemblGenomes-Tr; Plim_R0024-1.
DR   EnsemblGenomes-Tr; Plim_R0026-1.
DR   EnsemblGenomes-Tr; Plim_R0027-1.
DR   EnsemblGenomes-Tr; Plim_R0028-1.
DR   EnsemblGenomes-Tr; Plim_R0029-1.
DR   EnsemblGenomes-Tr; Plim_R0030-1.
DR   EnsemblGenomes-Tr; Plim_R0031-1.
DR   EnsemblGenomes-Tr; Plim_R0032-1.
DR   EnsemblGenomes-Tr; Plim_R0033-1.
DR   EnsemblGenomes-Tr; Plim_R0034-1.
DR   EnsemblGenomes-Tr; Plim_R0035-1.
DR   EnsemblGenomes-Tr; Plim_R0036-1.
DR   EnsemblGenomes-Tr; Plim_R0037-1.
DR   EnsemblGenomes-Tr; Plim_R0038-1.
DR   EnsemblGenomes-Tr; Plim_R0039-1.
DR   EnsemblGenomes-Tr; Plim_R0040-1.
DR   EnsemblGenomes-Tr; Plim_R0041-1.
DR   EnsemblGenomes-Tr; Plim_R0042-1.
DR   EnsemblGenomes-Tr; Plim_R0043-1.
DR   EnsemblGenomes-Tr; Plim_R0044-1.
DR   EnsemblGenomes-Tr; Plim_R0045-1.
DR   EnsemblGenomes-Tr; Plim_R0046-1.
DR   EnsemblGenomes-Tr; Plim_R0047-1.
DR   EnsemblGenomes-Tr; Plim_R0048-1.
DR   EnsemblGenomes-Tr; Plim_R0049-1.
DR   EnsemblGenomes-Tr; Plim_R0050-1.
DR   EnsemblGenomes-Tr; Plim_R0051-1.
DR   EnsemblGenomes-Tr; Plim_R0052-1.
DR   EnsemblGenomes-Tr; Plim_R0053-1.
DR   EnsemblGenomes-Tr; Plim_R0054-1.
DR   EnsemblGenomes-Tr; Plim_R0055-1.
DR   EnsemblGenomes-Tr; Plim_R0056-1.
DR   EnsemblGenomes-Tr; Plim_R0057-1.
DR   EnsemblGenomes-Tr; Plim_R0058-1.
DR   EnsemblGenomes-Tr; Plim_R0059-1.
DR   EnsemblGenomes-Tr; Plim_R0060-1.
DR   EnsemblGenomes-Tr; Plim_R0061-1.
DR   EnsemblGenomes-Tr; Plim_R0062-1.
DR   EnsemblGenomes-Tr; Plim_R0063-1.
DR   EnsemblGenomes-Tr; Plim_R0064-1.
DR   EnsemblGenomes-Tr; Plim_R0065-1.
DR   EnsemblGenomes-Tr; Plim_R0066-1.
DR   EnsemblGenomes-Tr; Plim_R0067-1.
DR   EnsemblGenomes-Tr; Plim_R0068-1.
DR   EnsemblGenomes-Tr; Plim_R0069-1.
DR   EuropePMC; PMC4136120; 24928878.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001744.
DR   SILVA-SSU; CP001744.
DR   StrainInfo; 158535; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083246
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC        David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Planctomyces limnophilus DSM 3776
CC   Culture Collection ID :: DSM 3776, ATCC 43296, IFAM 1008
CC   GOLD Stamp ID         :: Gi02301
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Surface water
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Sphere-shaped
CC   Motility              :: Motile
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Marine
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5423075
FT                   /organism="Planctopirus limnophila DSM 3776"
FT                   /strain="DSM 3776"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="surface water"
FT                   /db_xref="taxon:521674"
FT                   /type_material="type strain of Planctopirus limnophila"
FT   gene            614..3166
FT                   /locus_tag="Plim_0001"
FT   CDS_pept        614..3166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rce:RC1_3057 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65854"
FT                   /db_xref="GOA:D5SMD4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMD4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADG65854.1"
FT                   /translation="MQPGMMLANPGINHDERDQQQTVQAPAAQVRGVPQLISQNADGQI
FT                   ESDVQTAAERARLNEGLVRQNALTGHLPAERFPVQRHPVQHAGKQHSLPTRAKLPQEAA
FT                   SLGSVLIKAGLCHATSSRTNGSLQSADDRDVSVSSIVANQAPVKRSAATASVSPDLTKG
FT                   APDSAKALLFNTAPISDVGALQIFQEALIEAIGSSRYEMLFARKVTFDWQQVAATTSHH
FT                   QAGRLVLRIEDEFLRNWLRREYHPLLERLARECLQGSTILFSEDASLGQSVSSAKITPS
FT                   HTTDHQTTISRNPSEKISTTNTGVIAQLPAQNHMPSRNPRKSAVSDLKLGATISTIPSP
FT                   DQPAEHHAADQSSGAAEQRIDRQCANKPGANKSSRVLPVSDFPGANLDVMQSESAHNPA
FT                   SQNLPLAATPLAKSQLAAGNKVADDQVVASAAGRNPLVSQMAGPRRGAYVASTAFGSTN
FT                   QVPTAQAPTNQASGFSSASHESRSNSGAASHHSAPAHLGRTNAAKMSRRPMELSDLVVG
FT                   TGNELALAAARKVCDEVPAPFNPLYLFGNVGIGKTHLLEGISRQLRRQHPGLNVLMMTA
FT                   EQFANCFTQALRDKTLPSFRQKFRNVDALLIDDVDFLDNTRVIREEFLHTFTELAERGR
FT                   AIVLTADRHPKLLSKLGDELVTRFMSGLICRVEAPDQATRERIVQMKAARMGTDISEEA
FT                   LMWVAQKFRNNVRELEGALNCLHTWYTMSERRVGLATARQILADLERDCLKIVRLTDIE
FT                   QTICTLFGVRPRELKSSSRARTVSQPRMLAMFLARKHTQSAYQEIGQHFGGRNHSTVMA
FT                   AEKKVGEWLDSNSELHLGGRDWNIRELMDTLEQQLLAS"
FT   gene            complement(3189..4967)
FT                   /locus_tag="Plim_0002"
FT   CDS_pept        complement(3189..4967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0002"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: gme:Gmet_3382 heavy metal sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65855"
FT                   /db_xref="GOA:D5SMD5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMD5"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADG65855.1"
FT                   /translation="MVELTSKRWLSIPNLWNKFASRSIRGSLVVWVTLLLGAVLLFFAV
FT                   VLYETNRRLTIERIESELRSFGFSVLANGRFGNRFPTTDGGNRGDRDRHGRDGFERDRP
FT                   IGEPGPPGTNPPERNPLEAGREAGNPPQLLLADQIPLEQPERRNDRNGPNPRGGGRNDF
FT                   PPGEPFQRNGGPPDFDRRGPPERMYFFIRREDTGEIIDRSFDLPEDALAPFPESKLRGP
FT                   AAIHDPTQSRSVNGRWEVKIFDPSRSRSIVVGRWIQREWDDLQRLLLRTGLIALLSLII
FT                   GIAGTWLLARRVLSPLDDISKTVDKLTASTLNQRIDVAPLKTELQALAEVLNATFDRLQ
FT                   AGFERQVRFTSDASHELRTPIAVVLAQTEHALARERSAQEYRQALSACGRSASRMRTLV
FT                   ESLLALARADSGRLQLNCQPIDLLPVVEHAIESIKPKAETSQLKLAAQLTSATVFGDAV
FT                   FLGQVVTNLLNNAIEYNAPEGMIFVTLTSDTDSARISVVDTGRGMSAEERSHLFERFFR
FT                   ADAARSASGSTGHGLGLAICREIVELHGGKIDVSTELGRGSTFCVVLPLYREEAAEVST
FT                   EVAADPELNNSLTSSE"
FT   gene            complement(5023..5730)
FT                   /locus_tag="Plim_0003"
FT   CDS_pept        complement(5023..5730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0003"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: swi:Swit_3444 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65856"
FT                   /db_xref="GOA:D5SMD6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMD6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG65856.1"
FT                   /translation="MRALIVEDQPDLLFALRGMLEDEGYAVDTAADGESGLHRALVWEY
FT                   DVIVLDWMLPRLSGFDLLKQLRTKKSTPVLMLTARDGVADRVQGLDQGADDYLVKPFDR
FT                   GELLARLRALIRRAAGESESLLELGQGVTINLIHRKVFRDDVEIVLTAREYSIFEYLAL
FT                   HRGRVVPRTDLYDHIFDENDESLSNLLDVHISNLRRKLGRDVIETRRGLGYIIHSQASS
FT                   AELVDDASHDSAS"
FT   gene            complement(5718..5927)
FT                   /locus_tag="Plim_0004"
FT   CDS_pept        complement(5718..5927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65857"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65857.1"
FT                   /translation="MPECRWVGIVHFIWMPCCIGSTVCRLMGVDQELLAATFRVSPAVF
FT                   LSPAQGNLCNTSMTSQEVIAACVP"
FT   gene            complement(6006..7139)
FT                   /locus_tag="Plim_0005"
FT   CDS_pept        complement(6006..7139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0005"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold tRNA/helicase-
FT                   type; KEGG: GA27442 gene product from transcript GA27442-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65858"
FT                   /db_xref="GOA:D5SMD8"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMD8"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ADG65858.1"
FT                   /translation="MRKWAASILLLTGLAVSLPLTGVSNVWAQPPGDDPRPAGDRPAGD
FT                   RPGRPRPEGDNPDRPRPERGGPERGGPERPRGERPEGRGPEGRGPEGRGPEGRGPEGRG
FT                   PEGRGPEGPHRPQGEAVTVKGEVARISENIHGDVDGVILNDGTRIAFPPHVGNRLKERL
FT                   AVGTLLKVDGHKERTPRGTELVLARALTPGDGETIQLPHPPTPPGPPGRGPEGRGPEGR
FT                   GPEGRGPDGRGPGPRAEMDGPPRGPRDGGPEGRGPEGRGPEGRGPEGRGPDGRGPGPRG
FT                   EMDGPPRGPRDGGPEGRGPEGRGPEGRGPEGRWPGPRDEAGGPPRGPREGGPREERPGP
FT                   RDGGPEVRRPERPGPSTAELLEQIELLRKEVAELKKR"
FT   sig_peptide     complement(7053..7139)
FT                   /locus_tag="Plim_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 29"
FT   gene            7544..8851
FT                   /locus_tag="Plim_0006"
FT   CDS_pept        7544..8851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0006"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sus:Acid_6296 oxidoreductase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65859"
FT                   /db_xref="GOA:D5SMD9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMD9"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADG65859.1"
FT                   /translation="MTSPSMNPSVRSSRRQFLGVSAALAAGCFVTARPAFSASRSANEK
FT                   LNIAVIGPGGRGHENLMGVSSENIVAIVDADFRRAAKAFELFPNAKKFSDYRKLFDTPD
FT                   FFDAVVVSTPDHTHAAPTSIAMKQGKHVYTEKPLTHSLFEARSLQETATAAKVATQMGT
FT                   QIHAGENYRRVVEIIRSGAIGPVTEVHVWVGKGWGGGELPQEFPPVPEGLDWNSWVGPA
FT                   PFREFHPTYVPANWRRWWDFGNGTLGDMGCHYMDLPFWALGLKHPTKITAEGPALNLQT
FT                   APIGMTAEYEFPAVGSQPACKLKWYDGTMTPKEVRGRKVPGSGVMFVGSEGEMFADYGS
FT                   YKLYPEEKFADFKPPAPTIPRSIGHHQEWIRACKTGEPTTCSFDYSGPLTETVLLGCLA
FT                   YRMQKPIAWDAVNLKCPGTPEADAIINRPYREGWTL"
FT   sig_peptide     7544..7657
FT                   /locus_tag="Plim_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 38"
FT   gene            complement(8976..9230)
FT                   /locus_tag="Plim_0007"
FT   CDS_pept        complement(8976..9230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0007"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: nmu:Nmul_A0721 4Fe-4S ferredoxin,
FT                   iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65860"
FT                   /db_xref="GOA:D5SME0"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADG65860.1"
FT                   /translation="MTMVVTEPCRGCKDKACLVVCPCDCFHEDAEMVYINPEECIDCDA
FT                   CVSECPVSAIFHEDNVPAQWQHFVELNAQRSRVCPPAQP"
FT   gene            9261..10766
FT                   /locus_tag="Plim_0008"
FT   CDS_pept        9261..10766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0008"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="KEGG: scl:sce6952 protein kinase; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM:
FT                   Serine/threonine protein kinase-related; tyrosine protein
FT                   kinase; SMART: serine/threonine protein kinase; tyrosine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65861"
FT                   /db_xref="GOA:D5SME1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG65861.1"
FT                   /translation="MEAVCSGDEKLDEKADMPEPENLKIDLHDQSGVELVKLWASGNQD
FT                   AAQILVARYQIRLMAMISARLSAQYRHRIATEDVVQSALVSFFRTARHQTERSVIPTST
FT                   KSVWDLLALFARRKLSRAIERESASKRGGHWKRYSLEQFEHSFPVSPGSQELEELLIDL
FT                   RSQLDDSQSQLLELLLQNATQKEIAQQCAVDERTIRRRLMALRNLIAEQWAGEFSFPTK
FT                   ELRFSPTISLPQITYGQFVLGKLVGRGALGKVYRARWQPHGQLMAVKFMHRDLWKQPES
FT                   QDSFLREIDLASKIHHPGIIRYLGWGRSPHGGPYLLSEYIDGSALTKCSIADAPTRWKR
FT                   FIDICDAMAAAHQSGVIHGDLTPANILIAHDGRVVVTDFGFATQSYSKTENDHADLNFI
FT                   SPGGTIGFAAPEQISTAFGNISPATDIYALGALAFYLLFGRGPHQKIEQSIVDTLDEEN
FT                   VVIKETQTTAEETRLAKVVNRALKKAVRDRPQSIAELLDGMRG"
FT   gene            complement(10824..11840)
FT                   /locus_tag="Plim_0009"
FT   CDS_pept        complement(10824..11840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0009"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: hha:Hhal_2088 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; protein of
FT                   unknown function DUF201; phosphoribosylglycinamide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65862"
FT                   /db_xref="GOA:D5SME2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME2"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADG65862.1"
FT                   /translation="MSRGNIQSAATNPPRWNIALLAGGDSDERSISLRSGQAVCQALQE
FT                   RGHFILPIDPAIVSLKGMDWNGFDAVFIALHGRFGEDGGVQTLLEESGIPYTGSSSQAS
FT                   RLAFDKRIAKQNFDRMQVPTPAWCELSPHESFDSLLMKAKELGWPVVIKPASQGSSLGV
FT                   SIVRQPEQLQSAYERARHYDEALIMEAAIVGSEWTVGLHDDEILPPICIETDREFFDWV
FT                   AKYEDDHTRYIFDKPLPATCRQKLETACRGAVHALGVTGISRVDLMLDSEGNPWVLEIN
FT                   TIPGLTDHSLVPKAAQQAGWSLGELCEESIHRAIQRRPRRPHLLRRASFSTQARQRP"
FT   gene            complement(11910..13304)
FT                   /locus_tag="Plim_0010"
FT   CDS_pept        complement(11910..13304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65863"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65863.1"
FT                   /translation="MGVSQPWMAITSAMAQHWVDLCMGRWAASLLAASLSGAIVFQQLP
FT                   GLCAQEQIPSHEPPVSALSIENNSSAPRRLMGHESLIPQPATIITASGAAPTTPAKTRH
FT                   YIFQVQVIEVDEQGVQTVVATPRIQTTGTPSGFVTEKPDGQRFEFTVAVSNSFNRPAEV
FT                   STLPAAIPPAVTAAPAGTAQAPRSLGGTAEQYAAMPQIGGAPTLDANTSLETERNQAKN
FT                   LAFPDLSDLPPSPATAANSRPRAFIPNDQVAPLASTSLTSNNAMGSSASSVNSGSRAPA
FT                   GQTEPVITSETVLDRLSKKITVSLTNETRRSALRKVAEEAGVNIVIDPAALVSSRPKLD
FT                   DTVTLNIANQPADEVIEQLVAAAELAYAVKHEIVLIGHAEQLRPKPEDYFVKTYPAGEL
FT                   APLVNGQPDFDALVSEIQASVQPKSWKGPNSGSIRVFQSTGALVVRQTEAGHYALEKYL
FT                   KKRAIR"
FT   gene            complement(13644..14522)
FT                   /locus_tag="Plim_0011"
FT   CDS_pept        complement(13644..14522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0011"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: bcy:Bcer98_2559 UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65864"
FT                   /db_xref="GOA:D5SME4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME4"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADG65864.1"
FT                   /translation="MSFLEEFHDILKRDEPLAPYTWMKLGGPVQYFLEPRSVEELVAVV
FT                   KACAAQQITVRVLGGGSNLLVRDEGVSGAVIKLTHEAFQHIKIEGTTLVAGGGALLSNA
FT                   ISQAVKASLAGFENLAGIPGTIGGALRGNAGGRNGDIGQYVSSVKVLTIDGEIIDRSDD
FT                   ELSFGYRQSNLTELIILEATFQLIADAPDEIVRRLRKTWIMKKSSQPLAAQSAGCIFKN
FT                   PRGLSAGSLIEQANLKGTRVGGAEISERHANFIVSNGNASSADVLRLMDLVRSKISEQF
FT                   AVDLESEIQIW"
FT   gene            complement(14413..16122)
FT                   /locus_tag="Plim_0012"
FT   CDS_pept        complement(14413..16122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0012"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: afr:AFE_0205
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65865"
FT                   /db_xref="GOA:D5SME5"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME5"
FT                   /inference="protein motif:PFAM:PF08245"
FT                   /protein_id="ADG65865.1"
FT                   /translation="MTNSSHITEKLLANPWGKHGSPVWIHLIGVCGSGLRSLAEYLLAR
FT                   GFCVTGTDEQLPTAGLSELFPRGLVYTRQKNLPRAAIHSPDATALESGFSFPELSRLTS
FT                   NPENRLRQSIAAVPDLIIHSAAIPPADAGLQAARLAGIPAIPYHIALAHLINSSRSLCI
FT                   AGTHGKSTTTAMVAWMLSSSLAPEITDSIVNTNHPWRASFIMGGELIAPLPLSKPDQAM
FT                   ATLHRSGSYVEGDWLVAEACEYRQHFLAYEPELAAILSCEPDHFDCFASEAEFGDAFSK
FT                   FAARVKPDGRLVTAADSPMALQAAENAQAQVETFGLSMGNAKYPHWQARQIQRLGAKSR
FT                   FELFYCGKHRASVQLQIPGRHNILNALAALALTEQTGCPLPHRIQALASFQGIRRRFEW
FT                   KGLWRGIHLIDDYAHHPTAVIETLRTARQIFGSRRIALAFEPHQVSRLQALLPEFAQSL
FT                   ALADQVFIAPVFAAREGNSALKHTLIQDLAQRVRSAGIPTEVCGTLDHLRSSVEHKAGT
FT                   IDVLITAGAGHIDRIHYELSRRIPRHSQTRRATGSLHLDETGWPGAVLSRTA"
FT   gene            16614..16946
FT                   /locus_tag="Plim_0013"
FT   CDS_pept        16614..16946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0013"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: vpa:VPA0947 ArsR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65866"
FT                   /db_xref="GOA:D5SME6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME6"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADG65866.1"
FT                   /translation="MALESPLQLTPLDALAEAAECLKIVAHPHRLRILQMLLQKDFTVS
FT                   ELAQACDLPSAMASEHLRLMQRCGFLTSEKSGRKVFYHVIEPHLKDLLKCVEGRFGVSE
FT                   TILSAE"
FT   gene            17043..17984
FT                   /locus_tag="Plim_0014"
FT   CDS_pept        17043..17984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0014"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="KEGG: bid:Bind_0769 thymidylate synthase, flavin-
FT                   dependent; TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65867"
FT                   /db_xref="GOA:D5SME7"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME7"
FT                   /inference="protein motif:TFAM:TIGR02170"
FT                   /protein_id="ADG65867.1"
FT                   /translation="MANSDQAPEEISRTALLEELRWKKFPVLDDGFVCLVDVMGDDSSI
FT                   VQAARVSYGEGTKRVSDDRTLIRYLMRHRHSTPFEMAEVKLLVRVPMDCWRQWIRHRTA
FT                   NVNEYSTRYSVAIDSAQSTPIGEWRSQSTSNRQGSAGFLPNEIGAELTAAEERFQTAAR
FT                   ELYESRLAQGVAREQARKDLPLCTYTEAYWKVDLHNLLGFLSLRMDSHAQYEIRTFAKT
FT                   IGEQIIRPLFPVAWEAFLDYRFEGMFLSRLEVGMIQRLAERASAMKLVPPYSQADFLAV
FT                   QDPTWAGLTRSRERDECLEKLVEMGIVQPAVE"
FT   gene            18212..19546
FT                   /locus_tag="Plim_0015"
FT   CDS_pept        18212..19546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0015"
FT                   /product="metal-dependent phosphohydrolase HD sub domain
FT                   protein"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: bha:BH3818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65868"
FT                   /db_xref="GOA:D5SME8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME8"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADG65868.1"
FT                   /translation="MRHPYLDIPELAGLHGSGPLVRIPMQQDVPFTDRVRALVDTTEFQ
FT                   RLGHISQLGLSSLVYPGATHTRFEHSLGVFQNALEYLWQLGRDERFQAIVTPRHAEMLL
FT                   AAALLHDLGHWPFCHPIEDLDLPDIPHHEHFAAQFLSRDREIGQVLLNQWKIEPEEVLD
FT                   LLVKRTDEPALNLLRSILSGPVDIDKMDYLERDSLHAGVPYGRNFDRQRLIRSLVVNQA
FT                   GDGLAISAKGRTAAELMVFARYVMFSEVYWHHAVRSATCMFSRSFYELRHQLDLAAFFE
FT                   KSEWEVTQELRSKAKGTIVAPLMEGVFGPRRQLHKRVLEFSEHQSPELYRMLAGRPYEE
FT                   LVQVMERLTDRLSAKTGQAFGPTDLLLDAPPVHKEVEFRVTIWSPKTGTYQPLQEVSPV
FT                   VDALARTQFDDFVKRVRLFVKADWKPILKDLAGLEDELAAASRAS"
FT   gene            complement(19592..21061)
FT                   /locus_tag="Plim_0016"
FT   CDS_pept        complement(19592..21061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0016"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   bid:Bind_2997 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65869"
FT                   /db_xref="GOA:D5SME9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SME9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG65869.1"
FT                   /translation="MQWQLLKPLLAVLITGFFLASLTNAWLAIATARANESTRINELSA
FT                   SLQRASFPLNASVFKQLEELTGARFVALAAPSSSQNSITYQSSQLSLETSQLMMASFPS
FT                   IGTPSRPQNIHAGGEDWLTRTIERSVGLPQGPASRLIILLPVESWQSLWWRTALPPVLA
FT                   GTLAAFVCVVIVIWISRRLTGPLLDVASQTTQIARGNLSLLPVPRRNDEIRDLIVNVNS
FT                   MSQELVQLHQSIRHGEQLRTLGQLGAGFAHQLRNAALGARMALEFSERGDSSSSDHESV
FT                   QIALAQLQRMELYLDRFLRLSRPDRVHSTDKNSGHVSPSQTMIRLSGLADGVLQLIEPL
FT                   ARHRHVELHKDTSTFWEVEVRGDLVSLEQMLSNVVINALEAASSLELTSEASDQLPASL
FT                   KFKPTVVLKCLTTDHEVELSVCDNGPGPQANVQETLFQPFVTTRPEGCGLGLSVAQEIA
FT                   TGHGGEITWNRQQEPDGTMWTIFRIRLKKQR"
FT   sig_peptide     complement(20957..21061)
FT                   /locus_tag="Plim_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.505 at
FT                   residue 35"
FT   gene            21458..23131
FT                   /locus_tag="Plim_0017"
FT   CDS_pept        21458..23131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0856 2-oxoglutarate dehydrogenase,
FT                   E2 component, dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65870"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65870.1"
FT                   /translation="MPSGIEYLSWELLKSPAIEFFRRHQGGRLNSHLNPVALRDAGMGR
FT                   FTRWLGLSLSVLLLATVLPKTTALACTTAVISGKATRDGRPLLWKNRDAPNFRNELVFI
FT                   EDGRYKVLAVVNAGARQSIWMGVNSAGLCIENSVTNDLAFPKTAKGLGNGSFMLKVLRD
FT                   CATVADVEKLLEETNQSGRSTAANFGVIDAQGGAVLFETARASYRKFDANDPLVAPHGF
FT                   VVRSNFSITGKNAALKSEGATGPTLSDHPSRADLSDVYSAERYFRARELLEEPFKGHDD
FT                   QKSGPLDVRYLLRHVARDLADAAGTPCAGSVNSPEEELPPFIETKNTISRTTTVSFVVF
FT                   HGVKPGENPLLTTMWAGLGDPKFTIAVPCWVGMRQVSVDLRGEKEGGPVGVAARQLRQV
FT                   YYRQQTTANDTPVAASTSTSSTAVTSAVSGSQTASDAKPAERGEESEREEGASSSSGAV
FT                   SSGISGIETTGLKPIWESVWNQEDEVIERVERLLAQWRAKGVSPISQQMIHVQSAEQGL
FT                   TALQEAVRQAEKLFPAPGSVPVVPATPLNPPVPATSATSE"
FT   gene            23639..24388
FT                   /locus_tag="Plim_0018"
FT   CDS_pept        23639..24388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0018"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="PFAM: protein of unknown function DUF1080; KEGG:
FT                   swd:Swoo_0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65871"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF1"
FT                   /inference="protein motif:PFAM:PF06439"
FT                   /protein_id="ADG65871.1"
FT                   /translation="MIIQSVIGRCAMMAAGWIMFSDLPAVVAEETAAATGVVAKIDGVG
FT                   PGWRALGKDDFTNVNCYEDTWTWDGSLVKCTGKPVGVIRSIKPYTNFELVAEWQHLRAG
FT                   GNSGIFVWASEQALNSIKPGQLPPGGIEVQVLDHGYTEQYEKSTGKKADWFTSHGDVFP
FT                   VGSSKMKPFPPTAPNGQRSFPRKNLSKGINEWNHYYVRAINGEIRLWVNGEEVSGGEKC
FT                   EPATGFLCLESEGAPVEFRNIRIRELP"
FT   sig_peptide     23639..23725
FT                   /locus_tag="Plim_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.648) with cleavage site probability 0.592 at
FT                   residue 29"
FT   gene            24534..25226
FT                   /locus_tag="Plim_0019"
FT   CDS_pept        24534..25226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65872"
FT                   /db_xref="GOA:D5SMF2"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65872.1"
FT                   /translation="MSTIEATISAENLPQPVEPGSAAKVEADHLHRGTTLDESNSGATL
FT                   EAPRALSILMSFAFWILLALVSLSFATLVLSPKLHRREVLTKQYQQSLWELVILQEQTR
FT                   SLREIAKALEHDERFQAELARSQLGGIGNNEERYPLPENLLLAYPLEPPAPQLPVPPAQ
FT                   TWREFWIERFATDQTLRSGLIVFCVIGCLFGFGWLHEGAWHHSRLRPVRTLSQWIAVRY
FT                   ARRDRSAT"
FT   gene            complement(25335..25664)
FT                   /locus_tag="Plim_0020"
FT   CDS_pept        complement(25335..25664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65873"
FT                   /db_xref="GOA:D5SMF3"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65873.1"
FT                   /translation="MFRNLLNDENGAIISAELVLVLTILVIGVIVGLSEVAVAINTELN
FT                   DLSNAIGRLDQSYYFTGFKAISPKFKSATAGSRYNDEVDDCDLNGTCEIVCGASTVATT
FT                   EGGSI"
FT   gene            complement(26359..26631)
FT                   /locus_tag="Plim_0021"
FT   CDS_pept        complement(26359..26631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65874"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65874.1"
FT                   /translation="MFIGVEFMLRRSQVGKAEDDGHLPRASETVRLWQVQAGSDHPQNH
FT                   AMLMTRPCEETSGDSHFSQNSYWQKSSVSHNDLDEILIIHQIDVC"
FT   gene            26666..27772
FT                   /locus_tag="Plim_0022"
FT   CDS_pept        26666..27772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65875"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65875.1"
FT                   /translation="MRYHWFFLCMVMGLLAGCGEAPGIRQYEVTRPEFVERGNVDVPQA
FT                   PQVELEPATTWGAIWPRGNQAWFFKATASPEAVAGLATKWKEFVASVKFSDGSNPEWTL
FT                   PEGWSQLPGNQFRFATLVMKDAAGAPIELTVSSLPRSPEQWDSQLDANLSRWKGQLGIG
FT                   PMESSSVSQTTEKQGDDEVVFVLMQGSRAKGQGMMGGMSAPGTASTANMPAAESGQTKP
FT                   PAVNEMQKMVEGEIKLTPPAEWKPGKLNAFRKAAYEVTRGDERVEITVIDLAGESGGLL
FT                   ENINRWRDQVGMPAIELAALTSELKNVKTANGPAQLIEIEGSKGQSILGAVLPRGDRTW
FT                   FVKLQGSTPLAQQEKARFLEFLETSALP"
FT   gene            27971..31606
FT                   /locus_tag="Plim_0023"
FT   CDS_pept        27971..31606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0023"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   acp:A2cp1_1853 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65876"
FT                   /db_xref="GOA:D5SMF6"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF6"
FT                   /inference="protein motif:PFAM:PF01578"
FT                   /protein_id="ADG65876.1"
FT                   /translation="MATEFLPRTALNELNVPAISKPGLLGLVRSVLMPLASLKLTVVLF
FT                   AMAIFIVLAGTLAQVEDDIWVVIRDYFRTPIAWIKFQIFFPPSFFPDMPKIPGGFYFPG
FT                   GWLIGTIMAINLLAAHTVRFTFQAKGLRLFSGIGVLLVGAAMTWVVIISGDNASGILPE
FT                   NQQLYDQLWLCLKVSVYASFVLLFASLFWVPLSKPVTWGLLATGLAISIAGIIWLLFPG
FT                   NSETPSPSSMRILWQLTKGGLAGGCLLAGCLLAFGQRAGIVLLHGGIALLMLSEVLVGT
FT                   RAVEAQMSLSEGQTQNFVQDVRTVELAISNPLNDKSESVTVIPSNVLLGEPWGWKRYLP
FT                   GFLGGGSTGGALDETLTDPALPFGIRIHKFYNNAQIVDPKSFATNPATAGHGLKIGAIA
FT                   AETSKGTDAGGKVDMPAAYIELFKNDGTSLGTYLVSALLAESGEIDSVDIDGKKYQLAL
FT                   RFERHYKPYSVTLKDVRRELYIGTSTPKDFSSDLHIYDPARHVDRDVKVWMNNPLRFAG
FT                   DTLYQTGYHQSPQSGAEFSTISVVANQGWMIPYVSCMIVAIGMLAQFMITLLRFLNRIQ
FT                   KPEPAAMSIAEISDDPRRRPAKRPVVEDEPKPKTWGVWGWIPAGVAVLVFGGYIAGQSM
FT                   PRSTPFTEFDLASFGELPVVSQGRTKPFDTLARTSLQVLSGKSTYADANDKSQPAIRWL
FT                   LDIMAQPRVGGDHRVLRIENFELLALLGLERRPGFRYSPMEVADKLPELARQADLAREK
FT                   PATELTAFEKKLLQFERQIGQLDLLTAAFGLPRIGQENPANDLREAIRRQQALEVRHPP
FT                   LAVPPAADEDKWQTFASAWTMGIIRSVLSREEQDSQALSYLVTIYSSWAANKPQEFNKA
FT                   VADYREWLATQNLKDVSLTKLRFEAYFNRVDWFTQAAVVYLAGFVLAMLSWLFWQKPLG
FT                   RAALALLILGVIVHTLALAGRMYISGRPPVTNLYSSAVFIGWASVLLGILLEAIYRNGI
FT                   GNVIGATAGYATLLIAWGLAADGDTFDVLQAVLDTQFWLATHVTCITLGYATTYIAGLL
FT                   GLIYLVRGVLTPSLTPNMHRELYRMTYGVLCFSIFFSFVGTVLGGLWADDSWGRFWGWD
FT                   PKENGALMIVLWNALALHARWGGLVKERGLAVLAVMGNIVVSWSWFGVNELGVGLHSYG
FT                   FKEGTLFWLGLFVLSQLVVVMLGLVPKGFWWSARRHPELLSYYDR"
FT   gene            complement(31720..32082)
FT                   /locus_tag="Plim_0024"
FT   CDS_pept        complement(31720..32082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0024"
FT                   /product="translation initiation factor SUI1"
FT                   /note="PFAM: translation initiation factor SUI1; KEGG:
FT                   bpy:Bphyt_5669 translation initiation factor SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65877"
FT                   /db_xref="GOA:D5SMF7"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF7"
FT                   /inference="protein motif:PFAM:PF01253"
FT                   /protein_id="ADG65877.1"
FT                   /translation="MTRLFAGTAFDRPPTCEVCQKLEDECACPPVVKAPTWADPKTQTV
FT                   KLFEEKRKGNRFVTIVRGLKRETTDFAALLTGLKSTCGAGGSIEEDDLIIQGQQLQRIT
FT                   DQLKTLGYRIAGGKSK"
FT   gene            complement(32095..33429)
FT                   /locus_tag="Plim_0025"
FT   CDS_pept        complement(32095..33429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0025"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: wsu:WS1449 histidyl-tRNA synthetase; TIGRFAM:
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase class II (G
FT                   H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65878"
FT                   /db_xref="GOA:D5SMF8"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF8"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ADG65878.1"
FT                   /translation="MSELITPRVLGGFRDYLPDAMMARERLMETARRVYRSYGFSPIDT
FT                   PVLEYSEILLGKGGDESDKQLFRFRDNGDRDVAMRFDLTVPLARFSAMHAGELGLPFKR
FT                   YHIAPVWRGEKPQKGRYREFVQCDFDTIGTLSNAADIETLMVIYDLLSAIGFTQNGQPQ
FT                   FGIRVNNRLILNGVLEQLGVAEKSVGVLRAIDKLPKVGREAVLAEMVEKVSLSSDQAAQ
FT                   VLDLLSSEADLDQLEKLLASNAKASEGVARLKELLSAAKEAGIPASAVTIDLSIARGLD
FT                   YYTGTIYETFLTALPTIGSVCSGGRYDNLAGLFTKEQLPGIGASLGLDRLLAAMEELGM
FT                   IGHATTPAVVFVPQFDESKLGAYMHLARRLRAAGIATEVYPEAKKLGKQLQYADRKGFR
FT                   LAVIAGSDEFAKGEWQVKDLQSGSKEMIADAVLETRLLEILAAGK"
FT   gene            34097..35662
FT                   /locus_tag="Plim_0026"
FT   CDS_pept        34097..35662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0026"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   pfl:PFL_3613 di-haem cytochrome c peroxidase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65879"
FT                   /db_xref="GOA:D5SMF9"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMF9"
FT                   /inference="protein motif:PRIAM:1.11.1.5"
FT                   /protein_id="ADG65879.1"
FT                   /translation="MPIRLVFPSVCSGNVHSERTVSLTAVAPRLYTRDGQFKTGALFTP
FT                   YHDLTGTVTRAWHIFETHLPLKRFRKLCEVLRDLILKVAILLMLVLFIVQGSGASLSAQ
FT                   ETASTCEVNATNREPETTASPSVALKPKARAVRSIEERSQHIQRLRKEYELPTSNWPAP
FT                   AVDAGVKWRELGTIEAPPVSALAPTSPAKIQLGRVLFFDPRLSRTKEMACASCHDPDLG
FT                   WADGRMSAFGLGRTILARNTPSILNASLQPALFWDSRARNLEDQARQVLLNPKEMGATE
FT                   ADLIATLGNISEYRVLFQEAFGSESVSLDRVSQAIAAFETTLLGGRSPFDRFLNGQSQA
FT                   LSDSALVGLDLFRREARCINCHHGPTFSDGQLHGLNISHYGNKREDLGRYNVTGAAQDS
FT                   GLFRTPSLRNVTATGPYMHSGLFELDELLTLYNAGMPRTPHANDNSKTPRSSQYSGTKP
FT                   LPVKSPLLKPLGLNSQDLQDLASFLEALAEPRIRIRPPELPASDSQRELTNQKAASRPA
FT                   DESS"
FT   gene            35789..36784
FT                   /locus_tag="Plim_0027"
FT   CDS_pept        35789..36784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0027"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65880"
FT                   /db_xref="GOA:D5SMG0"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR027558"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG0"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG65880.1"
FT                   /translation="MLSPLRPHAAHRHSLRSAFTLIELLVVITIIAVLIALLLPAVQQA
FT                   REASRRTQCKNNLHQLGLGLHNHHSAYDAFPSTISGTIDGVSVFHGWGAQILPYMDQSP
FT                   LSGIYDFRQRNNNAVNRTAVETPLSFHVCPSVPGDTRRNFRFVTGAAGWGAASSDYMGV
FT                   SSISTTQYTNGFVATPRPTNTDGVFLFSSRPGTPGRKIKDVIDGTSNTMMVCESAGRSH
FT                   IYRLGNMVGNCDQSMLTATTTVGNANCVTISSWAEANLGALRGSLSDGTDTRGPCMVNC
FT                   TNNFQIYSFHEGSANILMVDGSVRSLSENVSNDIVAGLITIEGYEVLGEF"
FT   sig_peptide     35789..35926
FT                   /locus_tag="Plim_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.593 at
FT                   residue 46"
FT   gene            36879..38324
FT                   /locus_tag="Plim_0028"
FT   CDS_pept        36879..38324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65881"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65881.1"
FT                   /translation="MSVSVGFLFRPSRQRTFPGTRILSLLSFVAMLVLPSVYVFAVDSP
FT                   SSTNKLEAAGNTASIANKTSRLSEGANLQDPFPALTHLLFTDKLVPVEIGTVVPAPAGT
FT                   EVVVDPKRPWYFGKREGTSADERIFDGDVRVSPLLKWNNDNTGKLQLLATELRTALANP
FT                   QRKPAPLMQLSLQWDLLSVWWRLEQTEGTPPEVLLELARLITDLAQPAQTLNSLPDGYE
FT                   RAKAQFAGSKMVGYQTPWFSSDEILAEQDGWQQLARRSSKLFVAPHSLRASRIYMKALD
FT                   PAGTSADTEAFLKAWATSGTTRDWQPDRQVQTAMILSLIGITPDLQAVATPVIDEIRFR
FT                   VVHAPQDQIDPLETTSRDGSTIWLYYLSRSGTQQAGQPTYRFVSGNEQALFPEYGTSKH
FT                   TTFAAQCTLCHRLENSGKQAPGGIRSLSSYAGGKTTSDRLHRFRLAETEMSVVTARLKE
FT                   RLAVGAKTLPLAEFEYKKTTNGL"
FT   sig_peptide     36879..37004
FT                   /locus_tag="Plim_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 42"
FT   gene            38564..42169
FT                   /locus_tag="Plim_0029"
FT   CDS_pept        38564..42169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0029"
FT                   /product="membrane-bound dehydrogenase domain protein"
FT                   /note="KEGG: sus:Acid_3123 putative heme-binding protein;
FT                   TIGRFAM: membrane-bound dehydrogenase domain protein;
FT                   heme-binding protein; PFAM: Glycosyl hydrolase family 98
FT                   putative carbohydrate binding module; SMART: Glycosyl
FT                   hydrolase family 98 putative carbohydrate binding module"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65882"
FT                   /db_xref="GOA:D5SMG2"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR013428"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038637"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG2"
FT                   /inference="protein motif:TFAM:TIGR02604"
FT                   /protein_id="ADG65882.1"
FT                   /translation="MFSFRHIAHTLASYRCVTPLVLTPAVLMAGLVFAADPKPIYESPI
FT                   VSAETKGHSVAIDVPLNGAKELYLVVSDAGDGFGCDWADWIEPTLTTSQGQVKLTDLKW
FT                   SRAESGYGQVQLNHSCGGDALMVAGVQPSFGIGTHANSLIAYKLPEGTTRFQARGAIDD
FT                   GGANQGCGSTVKFAVYTQAPSPKATQATGGSAGSRELAKAVDQLDAGEGLEATLFAGEP
FT                   MMLNPTNIDIDPQGRVWVCEVVNYRHHNGERPEGDRILILEDTNGDGVADKSTVFYQGN
FT                   DVDSAHGICVLGDRVIISAGDTVFSLYDRNHDLKADPGSKEILFTGIEGKQHDHGIHAF
FT                   VLGPDGKLYFNFGNSGRRLKDKDGKVVVDLSGREVHDHRKPYQEGMVFRCDLDGSHVET
FT                   LGWNFRNNWEVCVDSFGSMWQSDNDDDGNRGVRINYVMEFGNYGYKDEFTGAGWQQPRT
FT                   NLETEIPLRHWHLNDPGVMPNLLQTGAGSPTGILVYEGKLLPAIFRNQIIHCDAGPNIV
FT                   RAYVTKPDGAGYSAEMVNILEGKRDQWFRPSDVCVAPDGSLIIADWYDPGVGGHRAGDV
FT                   EKGRLFRVAPPGAPYKFPKPDFSTVEGAIAQLASPNLSARSQAYLVLEKMGAKAEPALL
FT                   ALFETSKEPRLRGRALGLLKKNPAVLQKALKDSDADIRIAALRLIRQVYSPVAGSKNTT
FT                   VLTQAIGQLVSDPNAAVLRECLVALATSHASADDVHGKGVHVIPQKAELWAQLANQYQG
FT                   SDRWYLEALGIGAEGDWDACLGAYLKAHPNAAETLAGRDIIWRSRAAQTPELLAKIISD
FT                   PKTPAEELPRYFRAFDFLTSPAKDEAITQLAFATQPMPDGRDKLILAEALGRLKSFDPE
FT                   SNPARKAALARVLETTRGTPAYITLVDRFNMQAEYPGLLALAKAQADSQLGVDAARVLV
FT                   AKNQGVLIEAALVSKAPGDFSGAAILRAIGNAGGGEAIKLLRKLALDDKQPNEVRMEAI
FT                   RGLAKSQQGAEQLINLAKEQKLQGDSLAIAGFAVQAANHPKLKSQVDAIFPPPPSRNDS
FT                   PLPPLAQLIKNKGNITKGREIYFGVGTCAKCHQVGSEGKDVGPALTEIGSKLSREAMFE
FT                   SILYPSAGISHNYESFVAELSDGTSVIGLLVNQTDQEVALKSADGLIKTVKRSDIEELT
FT                   KQKISLMPADLQKLMTAQELVDLVEYLQTLKKSGN"
FT   sig_peptide     38564..38668
FT                   /locus_tag="Plim_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            42475..43188
FT                   /locus_tag="Plim_0030"
FT   CDS_pept        42475..43188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0030"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; KEGG:
FT                   dol:Dole_2149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65883"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG3"
FT                   /inference="protein motif:PFAM:PF02591"
FT                   /protein_id="ADG65883.1"
FT                   /translation="MDSSGMQLKGLHTIHLALRDVQALIDRGPKQTLAKKQLIQKRQAD
FT                   HEAARDRLKQARLLADQKNLQLKTQEARIAEYRAKQNTAASNREYDIIKGQIAADEMSK
FT                   SVLEDEIFETLEQIDKCQLEIAEREKEVAAAQAELVRYEAEYAAEKPGLEARKATLVQQ
FT                   LASAEGCLPANIIPDYRRQIQAHGADALAPVENRSCSACYLQLTQQLFMELRAGKPMFC
FT                   RSCGRLIYLDAEADE"
FT   gene            complement(43383..43526)
FT                   /locus_tag="Plim_0031"
FT   CDS_pept        complement(43383..43526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65884"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65884.1"
FT                   /translation="MFTEMQGACRWERIAPTSDHGRCPETVVEINGRGEQQPEPGFLDA
FT                   PL"
FT   gene            43882..44853
FT                   /locus_tag="Plim_0032"
FT   CDS_pept        43882..44853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0032"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65885"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG5"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG65885.1"
FT                   /translation="MFPRRRGFTLIELLVVIAIIAVLIALLLPAVQQAREAARRTQCRS
FT                   NLKQIGLALHNYESTYGCYPTRTTGLTANPDAKRHGMPVRLLPFIDQAALFNTYDFRQH
FT                   WYFPVNEPAIRTPLTIFTCPSDPTPNVDTSTFTVDSVTYSTLQRSTTDYAENGGVSTNL
FT                   TLASGLVDAQTVNNPDGPFEDNFKICRIRDIIDGLSNTIFVGERGGVPLRYNSGVPSGA
FT                   VIPGTGMLNTSDGGGGWADYRQGVRMAGSTAGTGARNISSTTNFGRCAINCTNHEEYYS
FT                   FHTGGAHFLMGDGSVRFNSENISITVMARLLSAQAAEVVGEY"
FT   sig_peptide     43882..43986
FT                   /locus_tag="Plim_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.955 at
FT                   residue 35"
FT   gene            44942..45913
FT                   /locus_tag="Plim_0033"
FT   CDS_pept        44942..45913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0033"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65886"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG6"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG65886.1"
FT                   /translation="MKRRGFTLIELLVVIAIIAVLIALLLPAVQQARESARRTQCRNNL
FT                   KQMGLALHNYHDQYQCFPAGFYRGWPFVNTTTTPTSGSPGWGWQTMILPQIDQAPLYNL
FT                   LNVGANRLNGTATVTFQGVAGTPIKVLGQQPIAAYRCPSDVGARLNPNRGDYATSNYLG
FT                   VFGPAFDNTVEGSDALVRGSWIGRNRGIFGANSSTQFKNITDGTTNTVMIGEIALGSFR
FT                   VDSAGLPVNFNGGTWMGLSSDNTSNVNTALSLCGYCIPANTGAVNRRINSPNGGNAFSS
FT                   FHTGGAHFAMADGSVRFLSENLDLDIADRISGMADGLTVSLD"
FT   sig_peptide     44942..45040
FT                   /locus_tag="Plim_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.959 at
FT                   residue 33"
FT   gene            45961..46794
FT                   /locus_tag="Plim_0034"
FT   CDS_pept        45961..46794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0034"
FT                   /product="biotin apo-protein ligase-related protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65887"
FT                   /db_xref="GOA:D5SMG7"
FT                   /db_xref="InterPro:IPR015834"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65887.1"
FT                   /translation="MLMRFSSFCLFVAFSIAASSLTLSVAQAAEPIRVSIYDHSDGSAN
FT                   GPKNLMKFLTEENGFKCVRVSPEEIRDTDILTKTDVLIIPGGSASAQSKKLEEAGCGKI
FT                   KEFVKNGGGYVGICAGAYLATSDYSWSLGLMNAKVVDKAHWARGTGPVELEMKETGKTL
FT                   LGESSDLVGVYYGQGPLLSPGSTKELPPYEPLALYATEIAKKGAPSGVMVGTSAIAKVN
FT                   YGNGRVICYSCHPEGKNGPHHLIKAGVRWAAGIDELPAPVASPQKLSADSTTKVD"
FT   sig_peptide     45961..46047
FT                   /locus_tag="Plim_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 29"
FT   gene            47027..47953
FT                   /locus_tag="Plim_0035"
FT   CDS_pept        47027..47953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0035"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   hypothetical gene supported by CR386744"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65888"
FT                   /db_xref="GOA:D5SMG8"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG8"
FT                   /inference="protein motif:PFAM:PF05013"
FT                   /protein_id="ADG65888.1"
FT                   /translation="MINQGRCCMLRSSFMVSTLFVLAMGVFVPAARAQTASNQPAVSKK
FT                   PATTKPKKVEFVTIQKGTLPVILSAPHGGELDLPGSLPRDRKSGGSRFQTVRDVRSSEL
FT                   AEAIANQLEAEFGQRPYLVILRVSRKYLDANREADYAYESPEAQVVYDEYHGAIEQFKK
FT                   SILEKHGSGLLIDVHGQSKEKGAVYRGTRNGLTISALNRRVGKDAASLYSKVMEDAGLR
FT                   VVPPSTAAPNQEVEYNGGEIVVAHGSQNPGGIDCIQMEFGADLRSVAALPQTAKDFVKG
FT                   LSPFLKEHYGVSEQRQAAAGGTSPAGR"
FT   sig_peptide     47027..47128
FT                   /locus_tag="Plim_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.981 at
FT                   residue 34"
FT   gene            48141..49274
FT                   /locus_tag="Plim_0036"
FT   CDS_pept        48141..49274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0036"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aeh:Mlg_0002 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65889"
FT                   /db_xref="GOA:D5SMG9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMG9"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG65889.1"
FT                   /translation="MQLVCPRAVLSAAFTVVGAVVPSRTPREILKNVKLDAVASGPGAT
FT                   SSAQLTGTDGDGTSIRFDLTDVECKVGGSALLPTQRLTSILRELTDDTVSLEVNGDAVW
FT                   LRCGGSEFRLSAEDPADFPTAPEFVEEDYFVVPADVFRRLIKRTLFATDAESTRYALGG
FT                   VLVEITADQVRMAATDSRRLAVAVGACSVEGQPVSGSQQPVVPSKAMSLIEKSLGDEAT
FT                   NVCLAIHTNDISIRAGRASITTQLVQGRFPDYRKVIPARYEAEIDLVASTFLSAVRQSQ
FT                   VVTNEESRGVDFTFAEGTLRLASKAADIGQSKIELPIGYQGSELTIRFDPRFVGDFLRV
FT                   LEGSSTVHLKLINDESPGVFTTDDDYTYVIMPLSRDS"
FT   gene            complement(49565..50875)
FT                   /locus_tag="Plim_0037"
FT   CDS_pept        complement(49565..50875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0037"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sus:Acid_2550 oxidoreductase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65890"
FT                   /db_xref="GOA:D5SMH0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADG65890.1"
FT                   /translation="MDQLNGSRREFLATTGMVAGAALAAQAGLATSAYAQGDDVIRIGL
FT                   VGSGGRGTGAARDALSTDHNVKLVAVGDVFEDRANRAVGSIKGGLGDKGSKVDVAPDKV
FT                   FFGFDAFKKVIDSGVDLVILATPPGFRPQQFEYAINAGKHVFMEKPVATDAPGVRQVLA
FT                   ASKLAKEKNLKVGCGLQRHHDIGYIETINRIKDGQIGDVIAMRAYWNNAGVWEPPLKRE
FT                   NAKSEMEYQMRNWYYYNWLCGDHIVEQHIHNLDVCNWVKGDYPVRANGMGGRQVRVDKR
FT                   YGEIYDHHCVEFEYKDGSRTYSQCRHIPNTWNQVSEFVHGSKGTSNPSGSITAAGNDWR
FT                   YRGPRPNPYVVEHDDLLKAIKGGVAYNEADNGAFSTMTSILGRMATYSGKVIEWNDALN
FT                   SQISLFPKELSWDADMPVKPDSEGNYPIATPGVTKVV"
FT   sig_peptide     complement(50768..50875)
FT                   /locus_tag="Plim_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.623 at
FT                   residue 36"
FT   gene            complement(51133..52110)
FT                   /locus_tag="Plim_0038"
FT   CDS_pept        complement(51133..52110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0038"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="PFAM: protein of unknown function DUF1080; KEGG:
FT                   sus:Acid_2979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65891"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH1"
FT                   /inference="protein motif:PFAM:PF06439"
FT                   /protein_id="ADG65891.1"
FT                   /translation="MRHMNFTWRTVLTLGLAAGACFLVDNTAMAADGPKTAYLDAAAAG
FT                   PDFAIQGEYAADGWGLQVIADGDSKFRGVLYQGGLPGAGFEGKTDKFKLNGATKDGKTS
FT                   LAGSDYEVVIEGTKAVVRHSAKSVELNKVQRTSPTLGQKPPAGAVVLFDGTNVDQWDKA
FT                   SMTEDKLLNVGTRTKEKFEDYTLHIEFRSPYMPYARGQARGNSGLYLGDQYETQILDSF
FT                   GLEGADNECGGIYINSKPRVNMCLPPLSWQTYDVDFTCAKFDEAGNVKSPAKTTVRHNG
FT                   VVIHENLELKPTPGGGQKDQKPGAIFLQNHGDKVHFQNIWILKK"
FT   sig_peptide     complement(52018..52110)
FT                   /locus_tag="Plim_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 31"
FT   gene            complement(52268..52696)
FT                   /locus_tag="Plim_0039"
FT   CDS_pept        complement(52268..52696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0039"
FT                   /product="putative thiol-disulfide oxidoreductase DCC"
FT                   /note="PFAM: putative thiol-disulphide oxidoreductase DCC;
FT                   KEGG: bba:Bd2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65892"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH2"
FT                   /inference="protein motif:PFAM:PF04134"
FT                   /protein_id="ADG65892.1"
FT                   /translation="MSEVASQKVQPSSRVILFYDGQCGLCQKSVQFVLKRQPQGSILFA
FT                   PLQGTTAAEMLPAADREQLDSMVVAKNGQLFRHSTAALAIAQELGGFWKVLGHLGSIIP
FT                   RPLRDLIYRSIARNRYRMFGQADACRLPQPGERERFLD"
FT   gene            53215..54561
FT                   /locus_tag="Plim_0040"
FT   CDS_pept        53215..54561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65893"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65893.1"
FT                   /translation="MDATRARIALLAIAFLHCSLLSLTAQAASYRTPNFIVTAPTDEFA
FT                   RVVGEAAEEFRRDLCLSWTGREMPRWGKPCPISCKVGNYPAGGATTFNFDRGEVYGWNM
FT                   EVQGTPERILDSVLPHEVNHTIFACYFRRPLPRWADEGAASLIEHESERMRLEKLAIEA
FT                   TGGRRKIPLRTLLGMKNYPQDQRQVLTLYAQGYLLADYLIAKSSKGEYLKFLQSAHERG
FT                   WDQALQSHYGYSNVEQIEQEHDRWVLAGCPRQPARPGEMLAGNNSQPASELQATRTQPT
FT                   APLAMVASNSPGTASEPRGFSLTRPFERRSATNSNVDNLRVRGQNPETSQAVAILDRTE
FT                   TSDVLVAATAPGNRPENSRIVQNEGYIPADPVANLRTTEIEDVAANTQKIDPRLAEARA
FT                   ALAAATQAMQSGPVASSSAPIKDRAQLSQPLLQQTEIPQFEPRATARVE"
FT   sig_peptide     53215..53298
FT                   /locus_tag="Plim_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 28"
FT   gene            complement(54779..55603)
FT                   /locus_tag="Plim_0041"
FT   CDS_pept        complement(54779..55603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_1227 polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65894"
FT                   /db_xref="GOA:D5SMH4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH4"
FT                   /inference="similar to AA sequence:KEGG:CCV52592_1227"
FT                   /protein_id="ADG65894.1"
FT                   /translation="MADEKRTAVSYLVFDIEAIADGELVSRIRFPGENLSAEAAIAKYR
FT                   AELMETTGKDVLPVTYMLPVSVAIAKIDPEFRLLDLVVLDAPEYRPHRIAQLFWQGWQH
FT                   YGYPTLVSFNGRSYDMPVLELAALRYGFSIPAWFSLELRSFEQPRNRYNSSSHFDLCDF
FT                   FSNFGATRLSGGLNLLANVLGKPGKSGIDGSMVQDFHHQGRDEEINDYCRCDVLDTYFV
FT                   FLRSQVLQGKLTLQREQQLVGETKTWLENQADNSPAYQHYLSHWGDWQPPPA"
FT   gene            55775..56941
FT                   /locus_tag="Plim_0042"
FT   CDS_pept        55775..56941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65895"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65895.1"
FT                   /translation="MKICEVSRHWGSLLDWKTIGFCLSGLLLLGTLEPAAAQSKSSRTS
FT                   ALQPNTTKSAAVRVAPPYNDKTPKRYDLTARASEIDPRAKEHPEIGFVFNKDGKPQDVQ
FT                   HAVVDTRVKPRGKLVIWLMGHNQGLFERISGYGMHGIQVHYANGWFGKLNKEPPPDELY
FT                   LGRIRLEAATGEDFSPDIEIPLPDGMAERSRQFVKWLAKENPQGKWEQFLTEEGDLRWE
FT                   DVIMSGISHGSTTAARFAVHQKVDRVVMFSGPRDQLEGWYKLPSATPHERFFGFTHVLD
FT                   GGWTADHYCRSWLLLGLNDFGPTVNVDDAKPPFSNTRRLVTNANVGNDANNAHGASVPG
FT                   GPSPKNSKGVYLYEDVWKYLFTHPVDRKGPAVPAEADCTLEHKVKGKK"
FT   sig_peptide     55775..55888
FT                   /locus_tag="Plim_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.648 at
FT                   residue 38"
FT   gene            complement(57212..58414)
FT                   /locus_tag="Plim_0043"
FT   CDS_pept        complement(57212..58414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65896"
FT                   /db_xref="InterPro:IPR021829"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH6"
FT                   /inference="similar to AA sequence:KEGG:LACBIDRAFT_313598"
FT                   /protein_id="ADG65896.1"
FT                   /translation="MVVEKLSKTWFNLVHGRNLVYNQCWEDPRLDRVALELTSNDRVVV
FT                   ITSAGCNALDYALAGAGHVHAVDMNLRQNALLELKQAGIRKLDYEDFFQIFGNGGHPQW
FT                   STIYTQKLRPELSDTTRKFWDRKKAFFTGDTRRKSFYFHCTSGTFAYIINVYIDRIAKL
FT                   RDGVNAILAASSLEQQRDIFKQYKLAESLWRPFIRWAMRRDMTLALLGVPRAQRKQIDE
FT                   QYPGGILQFVMDRVEAVFTKLPIKDNYFWRVYLTGQYTPECCPEYLKPEGFAQLKAGAV
FT                   DRVSTHTNHILGFLQETPHQISRFILLDHMDWLSKDPAMAILTQEWQGIMDKAAPNARV
FT                   LWRSAGLNGEFVNPIQVTVNGQKKTLGEALEYNRPLAEELHAKDRVHTYGSFCIANIKN
FT                   T"
FT   gene            complement(58465..59556)
FT                   /locus_tag="Plim_0044"
FT   CDS_pept        complement(58465..59556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0044"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rpt:Rpal_4491
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65897"
FT                   /db_xref="GOA:D5SMH7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADG65897.1"
FT                   /translation="MPDVHSVRNTHFLPGREALEQLEWNWRPAGSQRPAPRHPGEDQKR
FT                   GKDLLGEFPAPRERGVSVESRLSPIEDRQERAIRTVFVSDTHLGCRHAHAVELLDFLRS
FT                   VEPESLYLVGDIIDGWKLKKSFAWKQVYNDILSRLHDLAASGTKIYLTPGNHDAFLRRF
FT                   QWGFDFVTIEDEFVFEAADGRKYLVIHGDKFDVVEQSAQWVSGVASIGYDLLLSANWLF
FT                   SRWFKAPASGSYSFSGRVKRSVKQAVRYISSFEQRLARYALEQGCEGVICGHIHTPAHD
FT                   HRHGIVYCNTGDWVENCTAFVEYAHGEMELIHYFETFSTRKTSAADCSHETSVTNNSLP
FT                   LPIPALACACSELAPQDLAAVPC"
FT   gene            complement(59974..60768)
FT                   /locus_tag="Plim_0045"
FT   CDS_pept        complement(59974..60768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0045"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: pla:Plav_2493 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65898"
FT                   /db_xref="GOA:D5SMH8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG65898.1"
FT                   /translation="MDAHTKTSQLVSESNTSTAKVPSLAYGVDPTRPEKYSLRQARYHA
FT                   VSEEIARLIPEFQARGRRLKILDVGIWNGVLMRYVEALPGSEIVDLHGVDLTLQPTIYK
FT                   PENWASLNAGDLMGGLNFLESNQFDLVVCEQVLEHLPTVDDAISTLGRVLAPGGLLIVG
FT                   VPIFPEGIHLVRKHLVPAVDKLVGKKKPRGHLQAFSKRTFIGAVTQHAPVKVVAARGFR
FT                   IFSGGLLRPLENQKWWWQLNRTAGETLPSLCTEIQVLARKAA"
FT   gene            61141..62496
FT                   /locus_tag="Plim_0046"
FT   CDS_pept        61141..62496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0046"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="PFAM: protein of unknown function DUF1080; KEGG:
FT                   sus:Acid_4919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65899"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMH9"
FT                   /inference="protein motif:PFAM:PF06439"
FT                   /protein_id="ADG65899.1"
FT                   /translation="MLHALPRLACFSPEFLMLSIAGCLLSLFVVAPAQAQEDNNPPPGF
FT                   TALFNGKDLTGWWGLGTYDPRKLDAMSEADFAAFKAKSLEDIARHWSVKDGILINDGHG
FT                   LYLTTDKTFGDIELLIDYKTVPKADSGIYLRTTPQVQIWDSTETAKFSIGADKGSGGLW
FT                   NNLPNHPGKDPLAKADKPFGEWNRFRIIQVGARTTIYLNDQLVVDHAIMDNYWDKAAPL
FT                   RKNGYIQLQTHGGEISWRNIFVREIGSEEANKILASKSESGFESIFDGQSLAGWAGAAD
FT                   QYEVANGAIRCQKGKGGNLYTEKEYANFVARLEFRLPPGGNNGLAIRYPGKGNPAYSGM
FT                   TELQVLDNDAPQYAKLDVRQYHGSAYGMAAATRGYLRPTGEWNFQEVTINGSKITVELN
FT                   GTIILDTDLSKVSEYMANSPHPGKDLVKGHFGFAGHGDAVEFRNLSIKPLAD"
FT   sig_peptide     61141..61248
FT                   /locus_tag="Plim_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            complement(62730..63809)
FT                   /locus_tag="Plim_0047"
FT   CDS_pept        complement(62730..63809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0047"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; iron-containing alcohol
FT                   dehydrogenase; KEGG: aha:AHA_3188 3-dehydroquinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65900"
FT                   /db_xref="GOA:D5SMI0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI0"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ADG65900.1"
FT                   /translation="MVPVNLGPRSYQVRIGAGLSKQVAIELGNPGSALVVSDTNVAPLA
FT                   AENLTQQLAEAGWNVRLAVQPAGETAKSLREIEKLYDQLIAMQADRSTHVIAVGGGVVG
FT                   DAAGFAAATYARGLPFIQVPTTLLAAVDSSVGGKVGVNLPAAKNIVGAFHQPKAVFIDT
FT                   DLLATLPPREFAAGMAEVVKYGMILDESFFDWLEAEQPKIQSHDPTFLARIIQRSCELK
FT                   AQVVEADEFETTGLRAVLNFGHTFGHAYEALAKYGTLLHGEAVSIGMIDAATLACQLGR
FT                   IPEEVVSRLTKLLQSFQLPVSLPSGMKLDPQQIIATMRLDKKSVGGKLRLILPTRIGHV
FT                   ESVRDVSEELVLKTVARHG"
FT   gene            64239..66605
FT                   /locus_tag="Plim_0048"
FT   CDS_pept        64239..66605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0048"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: dal:Dalk_4262 cyclic nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65901"
FT                   /db_xref="GOA:D5SMI1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI1"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ADG65901.1"
FT                   /translation="MSDSDSSGQSPAPSQTTHQGPVILPNPWRDWVIDGLIKYRVWWLL
FT                   LACLMTAISIWPAGQLKFDESIESMYAPGNPHLRDYLESKKWFGGDEFIFIAYHDPELF
FT                   EEAGENRLSQLADEVSAVPGVIPTSVQCLATYLRMTRHPAFRSRREELLDFSRGVLLGS
FT                   DNQTTCIAVRLQESERAVDSAGQPISRGQTIAKLRALAEKQSFPTFVIGEPILVHDMFR
FT                   YAQEDGEFMGWAASALLIGVVLFFLRDLRSVILPFVIVQMTILWTKAGLWASHLELTMV
FT                   SSVLGSLLTIIGVSTVVYMSLYYHELRQSLDRETAFRRMLQVIGIDIIFVCLTTAAGFA
FT                   AQLSSHLHPVQSFGITMVLGSLLVLVAMTLVLPGGMLLGPDRAGAQKPRGDQQVSQWLA
FT                   SLTQFVLAHRFWMGIVTLAAVIYGMAGLMQLQVETDFTKNFRSSSPVVKSLDFLETRLG
FT                   GAGLWEVNFPAPHRLTDEHLDKVRQLAENLRGLIGTAEGQGLTKVVAMTDGLDLVPLLP
FT                   FLIPDAQAQSRWLNSLQPEFVPSLYNAEQGRMRIMLRGLERQSAREKQALIDRVETLAK
FT                   EQFPDAKVTGLFVLLNYLIDSLLQDQRTDLMVGALGLIAIMSIAYRSIVMGFVSLVPNV
FT                   LPIMLLLGTMGWLGLRVNIGTAMISSDTMGLTIHDSIFYMSAYLRARRSGLNFQGALGE
FT                   VQTEVRKPLIYSNVALILGFLVLTTSHFVPLITFGVLVSTAIAGGLLVNLLLLPPLLQL
FT                   VDRPWLGLAPDSARTAGPEETAGTEQNPVEPTSSV"
FT   gene            complement(66641..67747)
FT                   /locus_tag="Plim_0049"
FT   CDS_pept        complement(66641..67747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0049"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: hha:Hhal_2324 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65902"
FT                   /db_xref="GOA:D5SMI2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI2"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ADG65902.1"
FT                   /translation="MTDAALVDALQLMLIPKIGPATYERLIQHLGSPTAVLEASAAVLE
FT                   QAGLSSTLASRVSLGRDRAEARQTLQQCEALNIRATCLNRDDYPVRLKEIDRPPPVLFI
FT                   QGSVTAADQLSVAIVGSRSPSVYGEQMAKNFAGGLARAGVTIVSGLARGVDGLAHRAAL
FT                   EAGGRTLAVLGGGINQLYPREHIELARQVVEQGALISEYAPDVPAIAPQFPQRNRIISG
FT                   LSLATLVIEASEKSGSLHTARHAMEQHRDVLAVPGRVDSDASKGCLKLIRDGAILVRHV
FT                   EDVLEALGHLSAPVQKPGGQVVQQPRELLLNDQEQKLLQLVGIEATPVDTVLTQCGLEY
FT                   SRALSTLTVLEIKKLVRRLPGNFVVRIS"
FT   gene            68055..69056
FT                   /locus_tag="Plim_0050"
FT   CDS_pept        68055..69056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0050"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Plekhb2-prov protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65903"
FT                   /db_xref="GOA:D5SMI3"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65903.1"
FT                   /translation="MPTNSKTQEVNSRAMHRIQRSLFFTPLLLGLISLTGFSNAAQAET
FT                   SIQDEASFFSPAAKETALSRLKALEAKTGHEVQLQTVATLPEPWKGQLASGQPKQGVFV
FT                   DFTKDRGQLAKAKGLFILVVKDPAHLEVAADRRLRNAGFTTSQRNAVAETLLNGFRAKD
FT                   YDDGLLATVTLIEKEFGTLRSPSAAPVQAKESAAAPANTLPAKPAGEGDLGGWGWVLGI
FT                   GAVVLIVMIGMSLLRALFGGGAGAGAGMGGGGGMGFGGSLLTGLFGAMAGHYLYDTFFN
FT                   NHSHGSAFGNDATSGMDDPNRNDWGSGGDFGDSSGFSGGDFGGGDFGGGGDF"
FT   sig_peptide     68055..68186
FT                   /locus_tag="Plim_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 44"
FT   gene            69523..71595
FT                   /locus_tag="Plim_0051"
FT   CDS_pept        69523..71595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GE18300 gene product from transcript GE18300-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65904"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65904.1"
FT                   /translation="MNTLDTTFPATNAAASQAPSEKSVAVAFSPAQSSTPAGSESLSWL
FT                   GVRPSHAAGFVLSVAFHAWLLMTLFRLEVISPFEMIYSSIETRFSAEVEPPIVLEETPV
FT                   FELANPDDRELPQVMAMNSTAVGRAIADRPELAVPAEFRQRFELAPPAPPIIDIPEGVE
FT                   LSDTIVVPGTTGQAMVQLDAALDRITWEIAQNLKEKKVLVVWVLDASASIVKQRQQIAN
FT                   RLKRIYSELDALDEKGEFGRATQPLISGVVTFGASTNFITPQPTDNADDVTRAIAEAPT
FT                   DPSGVENTFTAVSQVLSQWGDYRHTQNRRLMILVITDEAGDDHGPPLELAISRCRNFGA
FT                   KAYVVGPAAPFGRRQGFVDYVAPEDGKTYRLPVDLGPETVVAEGVDLPFWYDGPQYTYL
FT                   SSGFGPYALTRLVHETGGIYFMTNLTTTQSLSITGEFDSQKMKPFEPEYRYGTPQDLLR
FT                   VLSKNPLRASVVTAAEFSQATKIRSLGTPPMEFRVQPGNFRQQLTRAQESVAITSAAIE
FT                   RILANYPQGMERQGADKFLAQEKHPRWRVAFMLGYGRLLAQKARAYEYNSACAQLKTKM
FT                   GDEDVAKKSNHWIFRPEPELQYAPIFKKTADQANKLLQMVIDEAPGTPWALLAQRELQD
FT                   GFGIRVVERFIPPPPPVTARPQPPAQPKLAPKFAPEPKPQKPAPPPPPKPVLPKL"
FT   gene            complement(71816..72415)
FT                   /locus_tag="Plim_0052"
FT   CDS_pept        complement(71816..72415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0052"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   xca:xccb100_0497 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65905"
FT                   /db_xref="GOA:D5SMI5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI5"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADG65905.1"
FT                   /translation="MLFVLDNYDSFTYNLVQRFGEIDPQIDLQVVRNNEITVAQVADLK
FT                   PRAIVVSPGPCSPTEAGISMELIRTLGPIIPTLGVCLGHQSIAQVFDSEVVRAPRLMHG
FT                   KLSHVHHKGEGLFAGLPTPMTCTRYHSLIVPEATLSTDLEVTAWVEDPGHPREVMGLRH
FT                   KTYPIHGVQFHPESFLTQGGIDLLKNFLKLAGVIDA"
FT   gene            72650..72874
FT                   /locus_tag="Plim_0053"
FT   CDS_pept        72650..72874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0053"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   gme:Gmet_0098 RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65906"
FT                   /db_xref="GOA:D5SMI6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI6"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADG65906.1"
FT                   /translation="MPMPILTLDQFLKQQGWVATGGHAKLVIQEGEVIVNGEVDLRRGR
FT                   KMRVGDVVEWNGERAEVPEGSGALPPLGA"
FT   gene            complement(73146..73466)
FT                   /locus_tag="Plim_0054"
FT   CDS_pept        complement(73146..73466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0054"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: tgr:Tgr7_2924 histone family protein DNA-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65907"
FT                   /db_xref="GOA:D5SMI7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI7"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2924"
FT                   /protein_id="ADG65907.1"
FT                   /translation="MTTEDKKPLSKTDIFAAIAESTSLSKKDVQAVFTALNDLISKQVG
FT                   KKGPGVFAVPGLLKIQVVRKPATKATQRANPFKPGEMMVVKAKPARNTVKIRALKSLKD
FT                   MV"
FT   gene            73924..74706
FT                   /locus_tag="Plim_0055"
FT   CDS_pept        73924..74706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0055"
FT                   /product="Forkhead-associated protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_4029 FHA
FT                   domain/GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65908"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI8"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG65908.1"
FT                   /translation="MADFLIRTGSSTGRKLSLPARELIVGRDDKADIRLNSSLVSRRHC
FT                   RILPGTILRPGVETVIVEDLKSQNGTFVNEVPISTPTTLEPGDRLRIGAMIFELAGADS
FT                   TGSRASTTDPVAARTGFARPPATAAPSESDITDWLSLPAGQKQGEFGASSNRYGLDLPG
FT                   LDLHGQDPSGKDLSGQDTAEIGFEVLDAVRKSLEAKSSSSLRDDAEISSVTTAPASDDS
FT                   PQLVPAALSGEAALPPKEWTSQAARIIQQYWKNTTPGS"
FT   gene            74830..75477
FT                   /locus_tag="Plim_0056"
FT   CDS_pept        74830..75477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0056"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: zmo:ZMO0575
FT                   N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65909"
FT                   /db_xref="GOA:D5SMI9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMI9"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADG65909.1"
FT                   /translation="MRIISGRFRRRTLQANPGNTTRPITDRAKVILFDNIERFFKGQRV
FT                   LDIFCGTGSLGLEALSRGADTCVFIEQDHRAFELLKANIAHVGATEIAVPWRVSALKSS
FT                   LKPRGTDWYPYGLVFFDPPYVMLKDVRPGEPLYRMFLRLARPDITTEDVLVVLRGPEGA
FT                   EYTLPDCWQIERNMKVGSMELALIRKAYATPLPENQTDEDSGVENDEPQAGN"
FT   gene            complement(75501..75788)
FT                   /locus_tag="Plim_0057"
FT   CDS_pept        complement(75501..75788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65910"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65910.1"
FT                   /translation="MPLYVYEEVLPDGSGGDRFEILQSISAPVLEVHPETGVPVRRCLT
FT                   SAAISRPWSAQSDSTKLSDRNLDKMGFTKYVKGKNGYEKTCGDGPDIIRK"
FT   gene            complement(75855..76781)
FT                   /locus_tag="Plim_0058"
FT   CDS_pept        complement(75855..76781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0058"
FT                   /product="putative membrane bound transporter"
FT                   /note="KEGG: mxa:MXAN_5780 putative efflux ABC transporter,
FT                   permease protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65911"
FT                   /db_xref="GOA:D5SMJ1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65911.1"
FT                   /translation="MVLMAASSIELANQLGNWALFGIGTLIVIGGLLAYSYGTKGGIIA
FT                   RATTKEAVRQPVFWLSVTATIVFLLINTWLPFFSLGEDLKMLKECGLTTILICGLLIAT
FT                   WTASTSIADEIEGKTAMTLLSKPITRRQFILGKYIGILQTVLLYMIPVSIVFGLLIFYK
FT                   VGYDARESSKEIPTALQRLPDVIQMFPGLVLTFLEVAILGAISVAISTRLPFVVNMAIC
FT                   FPIYVIGNLTPQLVQAGAIKFEFVAFMAKLISIVLPGLEWFNMSTAISTGTMVPPIYLA
FT                   TATLYALCYIAASILLAFILFEDRDLA"
FT   gene            complement(77070..77600)
FT                   /locus_tag="Plim_0059"
FT   CDS_pept        complement(77070..77600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65912"
FT                   /db_xref="GOA:D5SMJ2"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65912.1"
FT                   /translation="MRRHRRLSDWILLILAVGALLLAPWLIASEDLALQNPQPHLQDRL
FT                   LVWIPAGLSTIVPDVVNTTDGQFYWPFPHACMSRRLFDIDCPGCGLTRSTIKTLQGQWL
FT                   AGFKRHHWGWLAAFVLILQIPYRILSLSGSSLVRQPWQEPWLARCISWGIPLLALVITG
FT                   EWILQKTISAFHT"
FT   sig_peptide     complement(77514..77600)
FT                   /locus_tag="Plim_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.521 at
FT                   residue 29"
FT   gene            complement(77702..77932)
FT                   /locus_tag="Plim_0060"
FT   CDS_pept        complement(77702..77932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65913"
FT                   /db_xref="GOA:D5SMJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65913.1"
FT                   /translation="MDPTSADSNSSRLSTGDWLICLFCQLGGILIGASRCALGQWKSGL
FT                   SMIGLSLGMALVWNLTYLFMQILPDILRKLV"
FT   gene            complement(77932..78786)
FT                   /locus_tag="Plim_0061"
FT   CDS_pept        complement(77932..78786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0061"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase; KEGG: aba:Acid345_1347
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65914"
FT                   /db_xref="GOA:D5SMJ4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ4"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADG65914.1"
FT                   /translation="MHNSPRNPSADSDPLEVSVHQSQSSLLPQEKSLWELLSTWRNGDL
FT                   SDDDLKAQLPLLDAWRLHTGGELRLDLGRYSRCGVPEVIYGPGKRPDQIVEAFELLARS
FT                   QQPALATRLTPDQAEALLMAFPAATVNSLARTVSLGSLPRHERTVCVVTAGTSDRPVAE
FT                   EAAETARWLGAPVELICDVGVAGPQRLLAELPRLRQAAVVVVVAGMEAALPSAVAGWVA
FT                   VPVIAVPTSVGYGANFGGLAAVLSMLNSCAANVTVVNIDAGFKGGYVAGLIARPHEPMR
FT                   AGN"
FT   gene            complement(78961..79995)
FT                   /locus_tag="Plim_0062"
FT   CDS_pept        complement(78961..79995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0062"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: phosphofructokinase; KEGG: mxa:MXAN_6373
FT                   6-phosphofructokinase I"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65915"
FT                   /db_xref="GOA:D5SMJ5"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ5"
FT                   /inference="protein motif:PRIAM:2.7.1.11"
FT                   /protein_id="ADG65915.1"
FT                   /translation="MKVGILTGGGDCPGLNAVIRGAVRVIGNAGGEVIGLQRGWRGAID
FT                   GIGTPLTLENTADILWKGGTILGSSRTNPYKNPEDVKKLLASYERLGLDALIAIGGDDT
FT                   LGVANKLYNDHKLNTIGCPKTIDNDLSCTDVTFGFDTSINICMESIDRLRTTAESHQRI
FT                   IVVETMGRHAGWIACEAGMAGSADYILVPEMKVDIEAMCNVLKKRREAGKMWGIVVASE
FT                   GAVIAPEEGYVTSNAKVDDFGHVSLGGVGELVASIIEKRTGIETRHVILGHLQRGGTPS
FT                   AYDRVLGTRLGVGAGRLVIAKKFGRMVALQGTSIVDVALQDAVGKLKTLDPSFYQDAAE
FT                   FFTV"
FT   gene            complement(80113..81459)
FT                   /locus_tag="Plim_0063"
FT   CDS_pept        complement(80113..81459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0063"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP- binding;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: bha:BH2787 acetyl-CoA carboxylase
FT                   biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65916"
FT                   /db_xref="GOA:D5SMJ6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ6"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ADG65916.1"
FT                   /translation="MFQRILVANRGEIALRIIRACREMGIQTVAVFSEADRHADYIRLA
FT                   DEAYCIGPAQSANSYLLINRIISAAEVGNVQAIHPGYGFLSENEHFAEVCRSCNIEFIG
FT                   PPHEAMAKLGDKVTAKEIAKSAKVNLVPGSDGLITDEETAIGIANKIGYPVLIKATAGG
FT                   GGKGMRVARNDITLKAGLKQAALEAEKAFNNAGVYLEKYIENPRHVEVQILADQHGEVL
FT                   HLWERDCSTQRRHQKMIEESPAPNLPNNVREELCKAAVRLVKTAGYTNAGTCEFIVDKD
FT                   NNFYFIEVNARIQVEHPVTEQVTGIDLIRQQIRVAANEPLGIKQKQVPCNGHAIEVRIN
FT                   AEDPDNDFRGSPGKITKLRIPGGLGVRWDSHVHEGYVIPPYYDSMIGKLIVHKPTRLEA
FT                   IACMKRCLDELVLEGVKTTIPLLKRIFNHSAFVEGKMYTTFVEQELVGR"
FT   gene            complement(81744..82247)
FT                   /locus_tag="Plim_0064"
FT   CDS_pept        complement(81744..82247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0064"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: cja:CJA_2740 acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65917"
FT                   /db_xref="GOA:D5SMJ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ7"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ADG65917.1"
FT                   /translation="MSEASPASGEPFDLQKLQQLFELMEKHDLSEVNLKNGPEHIRLRR
FT                   GSSTVTVAAPAPTYLPAPAAPVASAPAAAAPAVATSAAPAAEAGLIDIKSPTVGTFYTS
FT                   PTPEDPAFVNVGSTVGPQTVVCIIEAMKVFNQIPAEVSGTIAAVLVKNGDPVEYGQPLF
FT                   RVRP"
FT   gene            complement(82469..83659)
FT                   /locus_tag="Plim_0065"
FT   CDS_pept        complement(82469..83659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0065"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG: ecc:c2924
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65918"
FT                   /db_xref="GOA:D5SMJ8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ8"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADG65918.1"
FT                   /translation="MATERQKQERSVIDQGATEKVMAGKPPEKSATDRPALRRSKLLSL
FT                   IKKAGLRGLLVTNPKNVTYLTGFSGDDSYLVVTPEKTVLLTDSRFTTQIEQECPGLPYE
FT                   TRTARKPMAELVGAFFKSSGSLSLGFESQHVSFALHQDWANRLKSITLVPTTDLVEQLR
FT                   CIKDPSEIAETREAVQMAQRGFEVVKSLFVPEMTEAAIAADLEHAMRRFGAAKVAFDPI
FT                   IAVGPRAALPHARAGNSQLSEAGFVLLDWGASTPKGYKSDITRVVATGKVPAQIEKAYR
FT                   VVLAAQLAAIALIRPGASCQEIDTAARKVIEDAGYGKYFGHGLGHGIGLDVHENPRFSP
FT                   ISTDELKVGQIVTVEPGIYFPELGGIRIEDDVLVTKDGHEVLTSLPKSFEEFQARR"
FT   gene            complement(83756..86404)
FT                   /locus_tag="Plim_0066"
FT   CDS_pept        complement(83756..86404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0066"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bca:BCE_2442 MmpL
FT                   family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65919"
FT                   /db_xref="GOA:D5SMJ9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMJ9"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADG65919.1"
FT                   /translation="MFQSLGNWITHRWYLVIAGWLSLVITMAIVAPPLDDVITTGEFAF
FT                   LPANFPSRVAEDLFAKAFPADTQRSAIVLVVRRVGENRELTDRDLQFVDDGVDSDDPDR
FT                   DNELRELLLKIADQFGGLVGQPDDESAESGSTEESSTDASKTAAKGNDANVPRSSEKAA
FT                   VPAKPAAPLAPLGLGNSQITAIRTYKDPKIGRLLRSEDQKATLVMVELTKDFMDAANKK
FT                   IVRAVEELLSSRDFMKIVPLGLDISLSGNAVVGRDMLVTADASAKATELLTVVLVIFLL
FT                   IAIYRAPLLAIIPLLTVFVSVELSLCLLRLLADYRFVVLFQEIKPYVTVLVYGAGVDYC
FT                   LFLIARYKEELDAGVNYEDAIANSLGKVGAAITASAGTVICGIAMMIFAQFVKFHEAGI
FT                   AISTGLIIVLMASLTFTPALLRAAGAWAFWPQMKRERPSSTTGWLPAASPLKAFTEALG
FT                   VNRFWTRLADTILERPLTTLLVSIAAMTPFAIVGLLFFSHLSYGLLSDLPANSPSVLGT
FT                   KAVQEHFPAGATGPVTVLLRNNNIDFSQRTGDTPGGIDAIKELTLELRKHLADAQLADI
FT                   RSVSHPFGGEEDLDSIKQVARRKITTDRSVKFYVSKEPGFDGHLTRLDITTTNDPFARD
FT                   SIEQLSKVEHLIQQSLPAILKDGTTIYISGSTASIRDLKTVTDSDQIRIDVLVISGVFL
FT                   ILVILLRQPAICLYLVITVLFSYLATLGFTYAFFWAIEPDFAGLDWKVPMFLFTILIAV
FT                   GEDYNIFLMTRIEEEQHEHGPVGGVVHALSRTGRIISSCGIIMAGTFASLMAGSLKGMT
FT                   QLGFALAFGVLLDTFVVRTILVPAYLVMLHGGRFGRLGPWMGAKPATDKFPAQAKGENY
FT                   ANPAESPSNSA"
FT   gene            complement(86633..88777)
FT                   /locus_tag="Plim_0067"
FT   CDS_pept        complement(86633..88777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0067"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: afw:Anae109_2043 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   AAA ATPase central domain protein; peptidase M41; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65920"
FT                   /db_xref="GOA:D5SMK0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK0"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADG65920.1"
FT                   /translation="MTELESSENQPTQSSTTPAPVKSEIVKSEPVKPDPVKTEPAKPLG
FT                   TKRKAEKPGSSNLVWYLLIAIVISIGVFTLGGSGKRTTVEFSDFKQRLKQGSLTATNVF
FT                   EVEIGPTSIRYQDQPGNKGREATSSKRVTPAYFVVPVVGMRDGAQTSIIELLDKNGINY
FT                   GFSAEPPEWQMMLYYLGVPLILLAVFLYVFRKMAGPGAAMSFGRSRGKLYAQEEIGVTF
FT                   QDVAGIDEAVEELREVVEFLKTPEKYQALGGRIPRGVLLVGPPGTGKTLLAKAVAGEAG
FT                   VPFYGLSGSDFVEMFVGVGAARVRDMFQQAGERSPAIIFIDELDALGKVRGSGMPGGHD
FT                   EREQTLNALLVEMDGFSSDQSVIVMGATNRPETLDPALMRPGRFDRHVLVDRPDVKGRE
FT                   AILKVHASKVKVDDHVNLKYLARLTPGFVGADLANLVNEAALLAARANKPKVTNIEFEE
FT                   AVERIVAGLEKSTRIMPEEEKNRVAWHEIGHALVACSLPHVDPVHKVSIIPRGLGALGY
FT                   TLQRPEEDRQLITKTELQNRICVLLGGIAAEDIVFNENSTGGSNDLQRATDLARRMVTE
FT                   FGMSPKLGRVHYSDTSRSAFLANAATVSESAHSEETIREIDLEVRRIIDAAYETAHEIL
FT                   VTRRAAMDHLTRELLEIEVMDAEKLQQILSQYQTGPQIMPGTSAQISPNPTSLPTPAVA
FT                   PYRPGESDGSSEGGNPVNVG"
FT   gene            complement(89058..90866)
FT                   /locus_tag="Plim_0068"
FT   CDS_pept        complement(89058..90866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65921"
FT                   /db_xref="GOA:D5SMK1"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65921.1"
FT                   /translation="MPLKVRCKACGTVVTAPDAARGKAIRCPDCESKIPVPAGDSKATA
FT                   SKKGASAKSSKSASGEDGLANLDLSDLEDSGASICRKCGTEVDPEATECPNCGIDLATG
FT                   GLGETARKKQMKGPDPDKFYENLWSESWKFALKYKLFAFRTMMYLLVSSTIMFGSAFML
FT                   LWVSSPPPRYFWGLIAVVSVMAIPGWFWFLDTEIIKATMERKDKLPRINFDFFLCSSLG
FT                   LQAVAWQLAFALPLLAVPYLLGWFVIVPMEGLPLSVKIAYFLAWQIPIASLLPAVMSHM
FT                   SMPVSYPGWMFWKLLPGYFKTIKASWTWTGMFLLTNLLPMIFLGLIIGLSAEPLVDLAK
FT                   TMDNNGQIVYAKWQVENNPIKADKPGGVAPANPFEAKSKEEIKPPNYFSLILPSVFWVL
FT                   ACLSASWTAVFNMRTNGQFAYFNKNRLGLIGRAKEYKYVAKEKTDEDEVAKPKGVVDAV
FT                   AVVMVCGILGAVGGLVTSSFADLPFPMLPTMAFGAASGFALASFIGWCVMLAPAFRASM
FT                   AIGLLMIFFPLIGAILLYNKEPEETKFGLTAFLGGALLEGIAFGVFFVTAIKAVVDALP
FT                   PPDPAAGAAPALWLMNLSSLGHWFGC"
FT   gene            complement(91167..92885)
FT                   /locus_tag="Plim_0069"
FT   CDS_pept        complement(91167..92885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0069"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: pca:Pcar_2073
FT                   Na/dicarboxylate cotransporter- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65922"
FT                   /db_xref="GOA:D5SMK2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK2"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ADG65922.1"
FT                   /translation="MAEGDEIDSGWAGRLGLWLGPLLGLVVLVVPGPADLPHAAQRLAA
FT                   VVVLMAVWWATQCVPMAVTSLVPLIAFPLLGIDSAKNVAGTYLTDSSMLYLGGFIIALA
FT                   IERWGLHRRVALHVVKATGTSPHGIVWGFMLATFLISMWISNTATTLMMLPIAMALMTS
FT                   LEELLCTFDEKEPDFLTTQALGRLSCQTYLGVAYAASIGGVATLVGTPTNMAFVGIWEK
FT                   QFPQAPPISAGQWMATWLPFGLVFLGLAWFVLTRKLTTPAGFSRLNRDFFRERLHDLGP
FT                   MSRPEWRVLIVFSLTAILWLTRTDLPLSSNLIIPGWGGQAEAFLSWLTADAKPASSHKD
FT                   WINDSTVGLLFAVLLFVVPAGEQDVKRGSPRLMDWPTANRLPWGILLLFGGGFAIAEGF
FT                   RITGLSRWSGDLFAYFFIGQSPVVTVLGICALMIFLTEFTSNVATVNAVLPVFAGAAIA
FT                   LGLDPRLVMIPATIATSCGFMLPAGTPPNAIAFGTGRIPIGQMLKYGLWLNLMGIVLCT
FT                   AATWVLLIPQMGIRLGEVPAWAVPIEKASSPIEPVAPTLSNAPKSKLSPADEGKK"
FT   gene            complement(92956..93969)
FT                   /locus_tag="Plim_0070"
FT   CDS_pept        complement(92956..93969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0070"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: bcr:BCAH187_A1915 ABC transporter, ATP-
FT                   binding protein; TIGRFAM: heme exporter protein CcmA; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65923"
FT                   /db_xref="GOA:D5SMK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK3"
FT                   /inference="protein motif:TFAM:TIGR01189"
FT                   /protein_id="ADG65923.1"
FT                   /translation="MSTPFLEARGLKKTFGSHQAVKNVSFSIMHGEAFGLLGPNGAGKS
FT                   TTIRMLAGLMAPDAGEVLLEGEPAWKHPEKWKRQLGLAPQQLALYPELSAIENIRFFGG
FT                   LYGLKGAALSQRTDELLELVGLEDAAHRIAANYSGGMQRRLNLAITLVHKPRLVILDEP
FT                   TVGVDPQSRAHLLESVRQLARDGTSIIYVSHYMEEVEALCRRVAIIDHGVVLECGVLDQ
FT                   LLGSVPTQLVLHVRPANSVDSVGAGHDPSSSFSARLQHIAQRVDPEATGVKVSVGENVE
FT                   SLPTVLIETSFTEWPDRLHQLSQAFHAESIVIDRVESRQQNLERLFLQLTGRALRA"
FT   gene            complement(94142..94972)
FT                   /locus_tag="Plim_0071"
FT   CDS_pept        complement(94142..94972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0071"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65924"
FT                   /db_xref="GOA:D5SMK4"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK4"
FT                   /inference="protein motif:PFAM:PF01148"
FT                   /protein_id="ADG65924.1"
FT                   /translation="MGTQTSEKPAPAIDLPQPRRKAFHFQPALHEESPQRKIHWHVAIP
FT                   DRLSNETLAIIPRTDLTSPVDPYVPIFCHRSLSTQEFRRRLWHMTPGLLPLLLWVIPHT
FT                   DPWGWIVWSVVLGLTLSTATIMLRWFSRIARPGEDHGYDAVLAYAVVVLATLWLFPGRE
FT                   EIGMMTLAILAFGDGSATLLGLKFGERKLPWNGCKSWVGLWAFIAMGTLAGAIMFWGEF
FT                   RPGIDFRLALGVSFLASLTAGLVESFPSLRNDNLRVGIAAAGTGAIAHLLLIPS"
FT   gene            95821..96777
FT                   /locus_tag="Plim_0072"
FT   CDS_pept        95821..96777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0072"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65925"
FT                   /db_xref="GOA:D5SMK5"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK5"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG65925.1"
FT                   /translation="MAQVSGGSTRRSGFTLIELLVVIAIIAILIALLLPAVQQAREAAR
FT                   RTQCKNNLKQVGLAMHNYHDTHNTFPPGNIRGALNVGHGPTAWVHILPYVDQAPQYNRV
FT                   NFSTPGTWWGGTAGPPVGGPHGATWNGFIVNGFICPSSPLVSRNSYNGGQNVWQRASYT
FT                   LIEGAVGLNEVANNGNGIRSNGGMFTRDRNFNFRDMTDGSSNIVMVAEQSNWGRDAANT
FT                   NNVEYRSDGGDSVWMGTDYGNRCFNTTTVRYAINTRSNALSGSGSQSCNTPIQSAHTGG
FT                   AHVLIGDGTVKFLSENMNFDTLRFLADRADGNVVGEF"
FT   gene            96906..97334
FT                   /locus_tag="Plim_0073"
FT   CDS_pept        96906..97334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65926"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65926.1"
FT                   /translation="MFRSMFVAFVCSALLMNAGCGSADRGPQAQLTGKVTFSGQPVPEG
FT                   VVQLSKVGGGAGASANISADGSFSVVLVDPLPPGEYLVLIVPPTIEDNSNPNSPPVQKP
FT                   KEMEQIPPRYGNAKTSPLKVTLKEGANTADFALEPEKK"
FT   sig_peptide     96906..96977
FT                   /locus_tag="Plim_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.578 at
FT                   residue 24"
FT   gene            97368..97529
FT                   /locus_tag="Plim_0074"
FT   CDS_pept        97368..97529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65927"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65927.1"
FT                   /translation="MGWLGLSLRTPSNLHNQLGVREDAQPQPPAVIWSIEFIRTIAAED
FT                   MLHDLSAY"
FT   gene            complement(97673..100711)
FT                   /locus_tag="Plim_0075"
FT   CDS_pept        complement(97673..100711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65928"
FT                   /db_xref="GOA:D5SMK8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65928.1"
FT                   /translation="MTKTCSEVYVLIPSHSLEDFPQDLGEEAAGSLLEAFAIAWHPALL
FT                   ATAGRIPQWYRADAPPEPAPGQLLILPQPSEDWFPYDWHERLEQAGAGLLKTVARREDN
FT                   LQQLQAWLESDADDSAQPSLFFQPEAKTSIDDFLAFGTTVLQLELLSRQMRHFSSLDEI
FT                   ILQQRTVGAARSLAAGEFLPCRQQLATAYENLLETRERFYPGEISLFDLCLAPSELDMP
FT                   RLKAALNGFTWPVNEPLGNQPAVNFLAGSLETSPLLKLADEQLPLAAPQELTAPSNTAP
FT                   TTTLKELLAQGAVDVLGGEAIELCTPLISPQMWIRNFQQGHLLAKTQLGIVPRVFARRL
FT                   FGLVSQLPGLLSQTGYAGALHLLLDEGTYPDEEFSSFRWEGTSGEAVTAFSRIPLPAQS
FT                   AGTFLRLATRLGEALDSDGNPALGFARWPEVATPWFHDLQRAATFAPVLGKFVTCKEFL
FT                   ERVEYPDHVRQYHAGEYLSSSLVYAVAAREKNAISRVASAWKLQGQQAAWQFCEVQRAL
FT                   LSPSENRQQPVQGIKSGGQRWEDELLAHFRVIGASDNRATTDHAANADEEWSAETALQQ
FT                   TAQQFANLLGSKIQNHEAAASPAGTLLINPLPWARPVPEEMEDGTFPTIPPCGYLWLAQ
FT                   NTPNGKSPARKSKPVVKFTEGVLSNDLFEVVFHPQTGGIARIRRHEQRENRLSLQLARR
FT                   FPRERAIRLGPDPDDEVIKTAYSEMRAGELSIIALTSHSLTVRSLGDLIDQAKGERICY
FT                   YKLDVTIRAGSLKVEIDLQFLELAAFDGDPWNNYIGARFAFGSEMAAISRSVLGSVHVA
FT                   GSERFEAPEFVEICDGSLRATILPHGRPYFRKTGPRMLDGLMVVSGETSRRFRWTIAID
FT                   DPHPARLAHEAMVPLVRLENVTRPATGETSFFVQCPAKQVSILSWEAGMTDWPIEAPAD
FT                   PSDTESVDRAAKATVSKKSCRVRLMETEGQAKTFSMVWYAPLAGAHKLTLGGAHAAWLK
FT                   TTGNESRVALSAYEVADIEFVFE"
FT   gene            101772..104021
FT                   /locus_tag="Plim_0076"
FT   CDS_pept        101772..104021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0076"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   afw:Anae109_0686 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65929"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMK9"
FT                   /inference="protein motif:TFAM:TIGR01175"
FT                   /protein_id="ADG65929.1"
FT                   /translation="MAELKSAWGIEIGQAGLKAIKLRYAEASNQVFAVAFDYVPHPKLL
FT                   SQPDADPDELISEALKTFLSRNQIQGDLLGISLPGSKSLLKFIQLPPVEESKVAEIVRY
FT                   EARQQIPFPLEDVIWDFQPMGSSSVEGGFMLDAEVGLFAMKRDDIEHQMYPFNQRKLEL
FT                   ELVQIAPLAVYNFLWFDRLGQRKDPEQSLNTLADDQYVVALDMGCDQTTLIVTNGKKIW
FT                   TRNVPIGGNHFTRALTREMKLTFAKAEHLKCNATKSPDPKAVFQAMRPVFNDYVNEIQR
FT                   SIGFFSSVNRSAQITKLVGLGNGFKLAGLAKFLQQNLNYEVEKIDTFPSSVGDSVLTAP
FT                   LFHDNILTFTGPYGLALQLLGQTQIHTSLLPPEIVVARKIRRKKPWAVATAAVLLFGLA
FT                   TSVAGYGSVAQSVSKSRFGNAETQADEVAKYASKLDSDYKAQEGRNAAAKERGEKLVKA
FT                   LDSRANWLELYKAIDESLPRDESAEQLDETRIELMNRISLKSVTSKKYDDLATWYNDNA
FT                   QLAKVSPQYFSAFDKAEARKTGPTGPGYVFTLHGVHFHHAPEDPVKGQGTGYVVNTLLK
FT                   NLQSFKVTRKDSVTGQVIETPVGQLGISYATVKADPFVLIDYYPMGRPDMASASSAARG
FT                   LRPGFQPGFNPGGSGAESSYSPPTPGGISSPGIPSPGIPGTGTGRVIDTQLPPEQVNTP
FT                   RKIHMTNFVVQFVWKPTPEKDRPKEDPALPPVDPAAAPQDGQAAPVATPQTPPAV"
FT   gene            104138..105877
FT                   /locus_tag="Plim_0077"
FT   CDS_pept        104138..105877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65930"
FT                   /db_xref="GOA:D5SML0"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65930.1"
FT                   /translation="MEKLEPIIRNRFWILSGLVVILSLAGWWMASSSLATTIDTRTKEI
FT                   KAAEDKIPKGNVPSADYSNKLSTINTYQERQVELARTMLWDQQRAKMAWPKNIQPYADE
FT                   AGYRGEFAPLARDIYRTSSPSDIASVWQKVRPFNAQTGEGVVVFPLQAMPVKYWRDLPP
FT                   TSKEMWDAQEDLWLLDSLLSTITQLNGGETTNNRLDASIHQILKLQLMGGKRGEPIDAP
FT                   AAGGDPSGGGGEGYSPPMASGGDAFSSGGGGRGGKIAPPASADFPIKEEFGSAGGEGGL
FT                   NGSSSSADSFAADPSALGDGAPQMAAARRYIDDDEGAPFRTRGFYLSVLMDHRRIPDFI
FT                   AELTSNERSVWPVEVVRVQMIRKNEDGNFARGGASGMPNYGAEAGSFGGSSPTFGTASE
FT                   GFTGGGANSVPPEFLTQSQGINPQDANNPMLMNKIQAANAALQTALTDPNIAEVVIAGY
FT                   FTLYNPPQTAPEAAAATSADSTAAPATPAAPATSETPAGTEPTTPEMTNPAPAENPPVD
FT                   GATPAAPAAPVNPAPTDPAATPPANTPPAAPTAPATTPAAPAGEPAAPTGEAAPATPPA
FT                   GGT"
FT   sig_peptide     104138..104245
FT                   /locus_tag="Plim_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 36"
FT   gene            105982..108105
FT                   /locus_tag="Plim_0078"
FT   CDS_pept        105982..108105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65931"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65931.1"
FT                   /translation="MAGIKGLNFKSLLVDHGEKIVLAGIGLLVLGVWGTTSWSRTEKSP
FT                   DEIIKKATNSKTNIDAGVWPVEKANEFAIVAYQDRASQLLKPMESVAAYEFSTPLYHPL
FT                   YRKQEQIKEPEWLPVADLIADAGTAIIAINKGLDVTLAETETGDLTKASEEEVNTEFAI
FT                   RSGVGGTAAGGPGASGAETPVGSYSPPPVSESTFGSSSPYGLDGSVGGTVSSVEARGVR
FT                   YVAVRGIVPLQQQVAKLQKALNLQSLTEAEQYLELLDFKLERQEAVAGDNPWVGKWEAV
FT                   DMVADSQILAESPNFDIDPFDARISDATITAPLPLRLMGYWGEHATHPKVRNFTLSPEE
FT                   RAKQERFLDKVVETATKERALLEQSQKPQRRGFAVVQRDLRALQGAIMSSSSSDQILGT
FT                   MSTMMAVPGSPAMTSQQLKKMLDTAGGRLLLFRYLDLQVKPGRAYRYRVKLLFTNPNYN
FT                   LPIEQIVDPSVAAGAERESPWSTISNPAVVPGDVKYFLAGSERDPVRDVTRSIRKAVAN
FT                   MSVYQWDAKLGSLLNSTLDLTSVGQVIKETKKVKRADLGNGTYEDADIVIGTTDLLLDV
FT                   AADVEVNVTLQSKLPVHMAELGLTPVSGKLNFGLLPEAVVVNEAGQMEFIDSKTNQKQE
FT                   DELKRRYEGEKKEYEKFKPPEVADPLLGPGGGEESSYVPPGMGDPTARKVSSKKIRTNR
FT                   KGQPGMGSSPPAP"
FT   gene            108465..109634
FT                   /locus_tag="Plim_0079"
FT   CDS_pept        108465..109634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0079"
FT                   /product="Isocitrate dehydrogenase (NADP(+))"
FT                   /EC_number="1.1.1.41"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: mca:MCA3071 isocitrate dehydrogenase, NAD- dependent,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65932"
FT                   /db_xref="GOA:D5SML2"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML2"
FT                   /inference="protein motif:PRIAM:1.1.1.41"
FT                   /protein_id="ADG65932.1"
FT                   /translation="MYDVTLIPGDGVGPEIAEATRRCVESTGVKINWDVQECGIEVIEK
FT                   VGKVPESVLTSIRKNKVALKAPITTPIGKGFRSVNVFLRQELGLYACVRPCKTYKGVRS
FT                   YFSNTPVDLVVVRENTEDLYAGVEFQAGLPATKELIEVINRLATGKKIGTGLDTTGVSI
FT                   KPMSYEGTRDIANYAFQYAVDNGRKSVTSVCKANIMKFTDGLWYDESRAVAKAYNAKFE
FT                   QPELAKDADPVLAGKVADGSHLHYMERLIDNMCMQLVQKPELYDVILLPNLYGDILSDL
FT                   CAGLVGGLGVAPGANIGPDSAIFEATHGSAPKYKGQNKVNPVALILSAKLMLEHLGEKS
FT                   AAERLEKAVAAVIEEGKDVTYDMKANRNDPTAVGTQQMADAICRKVQSL"
FT   gene            109938..110912
FT                   /locus_tag="Plim_0080"
FT   CDS_pept        109938..110912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0080"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: glo:Glov_1948 PSP1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65933"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML3"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADG65933.1"
FT                   /translation="MDMSAPPSQAWVVRYGVTRLLGEFVIRGPHIPVSRGTQVIVRSDR
FT                   GTEWGEVLCAASESTREWLGIDKETGRILRLPTLDDERHKDRVAQLEVEEFNSCKQLIG
FT                   EMSLQMQLVDTEHVFGGERIVFYYVSEQRIDFRELVKVLAKRHQSRIEMRQIGIRDEAR
FT                   LLADYGDCGKPVCCNTHLKEMPPVSMKMAKLQKATLDPSKISGRCGRLKCCLRYEYDTY
FT                   EEHRKELPPIGATVVTKLGQGRVVAQELLAKKLMVAYEGQRTVLTDQKEIITVVGKKGL
FT                   PAAVEREIEEEEAEEFMQSESSRPPRPQRPPRNPSENRNQPDR"
FT   gene            110971..111582
FT                   /locus_tag="Plim_0081"
FT   CDS_pept        110971..111582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0081"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: gbm:Gbem_3777 nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; TIGRFAM: nicotinate
FT                   (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65934"
FT                   /db_xref="GOA:D5SML4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML4"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADG65934.1"
FT                   /translation="MRIGLYGGTFDPVHLAHLVLAETCREKLQLDQVWFIPAYQPPHKP
FT                   GRVILEPKHRIQMLKLAVVGMPCFKVEPVEIQRGEISYTVDTLRQLQQLHPQHEFFLLM
FT                   GADSLAMLHTWKEPQALFDLATIAVVNRGKEPAPGVEDLGELKSLVGEAALAKILHVRM
FT                   PGMDLSATTLRENVAQRQSIRFLVPRAVEAYIEANHCYRS"
FT   gene            111846..113648
FT                   /locus_tag="Plim_0082"
FT   CDS_pept        111846..113648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0082"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   noc:Noc_2895 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65935"
FT                   /db_xref="GOA:D5SML5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML5"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADG65935.1"
FT                   /translation="MQRLLSLLQYSLLWGILVSGSMCLFQGEALAQGGAVTTAAPSTYP
FT                   PVPGGLFYRGNNPTQPGSAGYYFSLPMLIFSLSLVTLMVWTLGWIADDARSLKVRPEFW
FT                   NTLGLLVAAAAVLILYLGPTPLVAVLGFLICYAGLLGGYAPERNRKVPENSKILTPYHL
FT                   QTIAIRGLARLGIEVGGKKAVHAAMGPPITFIGKSNKGAGEVDRSRQVESSRGYTSARE
FT                   LVYDAILRRATDIHLEPKDDEFAVRLRVDGVMFPAEPFDRPTGESVVNIFKVLGAMDIT
FT                   ERRKPQDGSFRAETEGREIDFRVATQGTQFGEKMSLRILDGGSTVRRLADLGMRKQLIE
FT                   QIVGIVQQPHGLFLSCGPTGAGKSTTLYAALQEINRYENNIITVEDPVEYKMDGVTQIE
FT                   INQKAGQTFAASLRSILRQDPDVVMLGEIRDGETAKIACQAANTGHMVFSTVHANDTIT
FT                   ALSRLIDLGVEPFLLSDSLSAILGQRLCRKLCDDCKESYKPSADQLEKIGLPAEKAGVF
FT                   YRPPKDGTDACPTCSGMGYMGRIGVFELLVINDRIRDLLRESPNMTSVRAEARKQGMLY
FT                   MREEGLRLVLKGTTSLEELLRVVK"
FT   sig_peptide     111846..111941
FT                   /locus_tag="Plim_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.866 at
FT                   residue 32"
FT   gene            113736..114410
FT                   /locus_tag="Plim_0083"
FT   CDS_pept        113736..114410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65936"
FT                   /db_xref="GOA:D5SML6"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65936.1"
FT                   /translation="MIDILLLAILGVVTWCVASDGAWSAVITFLCTLIAGLIAMNFFEP
FT                   VAILLEGISPFFANRADMIALLGLFIAALFALRVGFEQLVKLHVEVAPMAHEPIRWAFA
FT                   FFTGYVSMAFLLTALHTAPLPREFLGFRAERPNFLGLAAPDRQWLGLTQFVSEHALARG
FT                   DGHSFDTARMKVASYPNSEWSSFPIRYATRRERFSTGMGAAAAPAQPVTTPGAPVTTNP
FT                   GF"
FT   sig_peptide     113736..113801
FT                   /locus_tag="Plim_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.595 at
FT                   residue 22"
FT   gene            114747..115634
FT                   /locus_tag="Plim_0084"
FT   CDS_pept        114747..115634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65937"
FT                   /db_xref="GOA:D5SML7"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65937.1"
FT                   /translation="MAETQDTPAPPDQPDPPHRPKSLWQIMRGEPASDSLSHPVETQAI
FT                   DPDALQPQATETALDTEKMIPTARGAPSLRGLWHVMREQKQPQRLPAVPAFRSLQRKPA
FT                   PAINSDSAPLADGQQAAPPATAEKVRQARWYTAGMQFRASRPRVARRYPHVVRRGTSVT
FT                   SPADDMQTGLDVIAPIHTTELEAELLYERLTPVTSAWTWIGRGATSTLAAFLFSPLAQW
FT                   ESLWWELPATIFGFGGLFCACLAMTEAERRYLYSAGPHGDHAARQSTDIQLATAALLIL
FT                   AATTSIFIGPFVWG"
FT   gene            complement(115693..116130)
FT                   /locus_tag="Plim_0085"
FT   CDS_pept        complement(115693..116130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65938"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65938.1"
FT                   /translation="MLYRLSPALLMLILTNVGCQNSGESFVLAPVEGRVVLDSTPVPDA
FT                   LVQFSPTKGPSSQGYTDSNGQFTLMATAGKGAVVGPHSVKVTTGLPKPAEVSSSEANEP
FT                   PKEVSLGNSPPTDYIFESTMSIENNNNVIELDLNKAKKRRG"
FT   gene            complement(116372..117409)
FT                   /locus_tag="Plim_0086"
FT   CDS_pept        complement(116372..117409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0086"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65939"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SML9"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG65939.1"
FT                   /translation="MPKRSGFTLIELLVVIAIIAILIALLLPAVQQAREAARRTQCRNN
FT                   LKQIGLALHNYHDVHRQFPFGTFPQVGTGTTRTKSASWLVRILPMMDQGPAFNALDFSG
FT                   NDFTGQDGVAKNWLQMSTLRIGGINCPSSPLPTTRTQTPNSATQTALGIPATATGIQIC
FT                   DYIGNSGSYNDPANNNNCCPNPSHWGGQGRSNWNGVIISATAFDGSGNPLGIPSVDVAK
FT                   ITDGTTNTVMVAEQSAIDPTCANFNGGQRDCRGFGHAGGMWGAGNGGTDWWGGLTVVRG
FT                   TINQASDIVSNYPYRRHTKVNSTHTGGAHALLADGSVRFFSENMNEPTWANLNSKADGV
FT                   PVGEF"
FT   sig_peptide     complement(117308..117409)
FT                   /locus_tag="Plim_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.951 at
FT                   residue 34"
FT   gene            118033..118106
FT                   /locus_tag="Plim_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            118033..118106
FT                   /locus_tag="Plim_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(118327..120705)
FT                   /locus_tag="Plim_0087"
FT   CDS_pept        complement(118327..120705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0087"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: oan:Oant_3233 heavy metal translocating P-
FT                   type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; YHS domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65940"
FT                   /db_xref="GOA:D5SMM0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMM0"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG65940.1"
FT                   /translation="MPVPPSRPSSLLTILEPHRETDPVCGMSVDPAHASGSLVHAGTTY
FT                   YFCARSCLIRFRANPEVYLSPDAIRHDCAQSTPAAPGQTYICPMDPEVVQSAPGSCPIC
FT                   GMALEPSQPTFQAGPDPEWMLLSSRLRWAVVLGLPVFVIAMLGMLPSSATMQWLHANMS
FT                   WLNWIQLLLTTPIVFYCGWPFFERAWKSILSRNPNMFTLIALGVGTAYLYSLLATIIPG
FT                   QFPTSFHMQAMNTSPEAPVVEPHFAPVVEPYFDSAAVIIMLVLIGQLMELRARQATGEA
FT                   IRSLLSLTPPKARLWHPSGREEEIALEHVLVGDQLLVRPGETIPVDGFVLEGTSDVDES
FT                   MMTGESLPVEKHPGCSLLGGTTNGSSPLLFEAQHVGTETMLARIIASVSEAQRTRAPIE
FT                   QLVNHVSRYFVGTVVLVALAAWAGHSMLGGPEGWQRGLIHAVSVLVIACPCALGLATPM
FT                   AVTVGMGRGARMGILFRNAEAIETLRAIDTLVIDKTGTLTLGQPELTAIFPETGFDEST
FT                   VLQWAAAVELGSEHPLSKAIVAGARAKNLTIEMAHEIQTAPGLGIAGQVQGHGIQIGNA
FT                   RFLEQAGLKTDQWQKASSQQQDGQIVIHMAIDQQPAATFLLADQVRPSAAEMLSKLRGQ
FT                   GLRIVMLTGDRRSTAAHLANKLGITEVIAEVLPDEKAAAIAELQQQGRFVAMAGDGIND
FT                   APALARANVGIAMGTGTDVAIQSAAVTLVKGDLSGIVRAMELSQATSRTIRQNLILAFG
FT                   YNAICIPVAALGWITPMWASAAMSLSSVSVILNSLRLRR"
FT   gene            121308..121610
FT                   /locus_tag="Plim_0088"
FT   CDS_pept        121308..121610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GD13599 gene product from transcript GD13599-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65941"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65941.1"
FT                   /translation="MFTRMALALAGLAIAISASGCCCSANRCNPCGPCGAAAPSPCSTG
FT                   NCSPSFYPPAGGGGGQFFQGADASGMNLGTSTVATSQPFGGYPATAMAPAQLLPN"
FT   sig_peptide     121308..121382
FT                   /locus_tag="Plim_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.782 at
FT                   residue 25"
FT   gene            121809..122363
FT                   /locus_tag="Plim_0089"
FT   CDS_pept        121809..122363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0089"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   sus:Acid_3876 NIPSNAP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65942"
FT                   /db_xref="GOA:D5SMM2"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMM2"
FT                   /inference="protein motif:PFAM:PF07978"
FT                   /protein_id="ADG65942.1"
FT                   /translation="MSRLISHAPTPNASKSDSNHASAQDDRTIQASQSSHTSPSTFGKT
FT                   LLLWALASLIGGGLGYGYTLKISQAEANRAETKKLYELRTYTALPGRLDALNKRFRDHT
FT                   TQLFAKHGMTNVIYLTPANGDNKLIYLIAHENEAAAAASWKAFREDPAWKAAREASEAD
FT                   GKIVEKVESVYLNATDYSPMK"
FT   gene            complement(122511..124706)
FT                   /locus_tag="Plim_0090"
FT   CDS_pept        complement(122511..124706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65943"
FT                   /db_xref="GOA:D5SMM3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMM3"
FT                   /inference="protein motif:COG:COG1538"
FT                   /protein_id="ADG65943.1"
FT                   /translation="MWSRERILRWRWLSVVVAIITLPGPGCARYQPTPAANIGIDTSHY
FT                   EAMGRKIEYPKIEKVSDEQILEATSAPISLSSETPTEYLDLSLEEVMRLGLAQSKAFRD
FT                   LGGLVLRSPEIVRTKNDPAIAQTDPRFGIEAALSAFDAQVAASAMWEKNDRALNNQFFG
FT                   GGTRLLTQDFNVYQAQISKTAATGSNFAIRNYTQYDANNAPGNFFPSAWTTWYEGEVRQ
FT                   PLLQGAGVDFNRIAGPNAQPGLINGVVIARINSDISLADFEVGVRNYVSDVENCYWDLS
FT                   FAWRDLESKIAARDAALETWRRIRALYEQGRRGGEAEKEAQAREQYFRFQEEAQNALHG
FT                   RLLDGTRTNNGSTGGTFRGTGGVFVCERRLRLLIGMPINDGRLIRTADEPSAAKLSYSW
FT                   ESTLGEALSRRVELRRQKWQVRKRELELQANKNFLKPQLDAMARYRFRGFGKDLLPDGT
FT                   GGEFGDAYSNLTSGNFQEWQLGLEFSMPLGFRQAYTAVRNAELQLARDRALLFEQERSV
FT                   IHDLSNAIADVDRSYQIVETALNRRMAAREQVEAVQAAFDADNATVDLLLEAQRRMADA
FT                   DISYFRAVIEYSLSIKNVQLEKGTLFDYNEISLEEGPWPEQAYCDALERQLRTHPASRF
FT                   DHPKQLAPQVSEGPMIQTLAPALNEPQGMTYPPVEGGSVLYDDQAIDAPGSPEATQLFD
FT                   KVLSSPPQPAGNLPAFIPPAPGANENESNPEFDPAFK"
FT   sig_peptide     complement(124620..124706)
FT                   /locus_tag="Plim_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.745) with cleavage site probability 0.745 at
FT                   residue 29"
FT   gene            complement(125143..125289)
FT                   /locus_tag="Plim_0091"
FT   CDS_pept        complement(125143..125289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65944"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65944.1"
FT                   /translation="MEMPLIGHQQITRENFPDGIDTMREGSVSHRLLLRASPEKGIPNN
FT                   QCC"
FT   gene            125292..127025
FT                   /locus_tag="Plim_0092"
FT   CDS_pept        125292..127025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0092"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: dvl:Dvul_1355 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65945"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5SMM5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG65945.1"
FT                   /translation="MHGLVSILAQLEGVLSGTAGLLALATVCLFQHGIHVLQRQRSDRN
FT                   SARILGEVKSLEREVMHLTRDKMITRLENVVLREILTQNDPERGYAVLLKRFIPDTDSG
FT                   FAAIIRLDRSSGTVFEARGLSDESLEAFHIDTHHLATLASGSPLVLEDQPLRKSQIYAS
FT                   LTPSDKRKASRIFLIPVGVGQELCAVLATTQLLPTAAPQAEQLDLSTRLMSCVAGSLKQ
FT                   LFTLEHHTHQLRSTREMLELRSIADSQSEQPLRMIERFMVRLAQITGSERASLYVLPKE
FT                   GAATCKALIRCGVQLPPGVETRWFQHEDTLSSMGQLYGQVTVFDQLHLKRVGVDTLMQS
FT                   AVTAPIRHKHRYAGLLCLTRRQSAAPLPVDLELITWAADVLSETIQKSINFLQMERQAR
FT                   QDGLTDLANRRTFDLQLAREIDSVQQGLGLECSLLLCDLDRFKSINDQYGHQAGDLVLR
FT                   ETAQILREQMGKIRSGDRALLARYGGEEMAILLPGVGITGALRIAEGIRAAIDSHPFAV
FT                   ESALLTVTISVGVATCPLHASSPEALISAADAALYEAKSAGRNRVCCAQEPTAISATGV
FT                   S"
FT   gene            complement(127138..128703)
FT                   /locus_tag="Plim_0093"
FT   CDS_pept        complement(127138..128703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0093"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: afw:Anae109_1874 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65946"
FT                   /db_xref="GOA:D5SN19"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN19"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ADG65946.1"
FT                   /translation="MTSATKTSPADQIIIFDTTLRDGEQSPGCSMNTDEKLEVAKALVD
FT                   LGVDVIEAGFPIASPGDFEAVRKVAERFGEQATICGLARCRNEDIDRAADAVSAARRKR
FT                   IHLFLATSAIHREFKLKMATEEILKRTAEMVSRAKERCEDIEFSPEDASRTELEFLAQV
FT                   VETAIRHGATTVNIPDTVGYATPSHYFNVISYLKKNVPNIQQAVISAHCHNDLGLAVAN
FT                   SLSAIEAGARQVECTINGLGERAGNAALEEIVMALRTRQDYYKVGTKINTQKLCQASRL
FT                   VSNVTGMIVQRNKAIVGQNAFAHESGIHQHGMLQNRETYEIMRPEDVGFVGQNLVLGKH
FT                   SGRHAFRSRVAELGYTLDDETFQRVFDEFIILADKKKSVYDADIIAIIEHQDRNASDRW
FT                   KLQRFHIAAGTGTIPTATVELHDDQHQVHCDAAIGDGPVDAVCKAIERIMGVSGTLDNY
FT                   QVRSVSEGKDAQGEVMIELITGGRKYHGKAVSTDILEASAQAYLKALNKAAIGQPSEQR
FT                   EPGV"
FT   gene            complement(129287..131785)
FT                   /locus_tag="Plim_0094"
FT   CDS_pept        complement(129287..131785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65947"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65947.1"
FT                   /translation="MIDSTRWTFAACLLSLWALTSDAKAQGPQVAPPISGIYPHLAMFN
FT                   DEGECGTGAVVPFGGKLWVITYGPHLPLRSSDKLYEVTPELQQIVRPESVGGTNANRMI
FT                   HAATNQLVIGSHVIDADGKVRTIPRNKMPGRLTGNATHLSSPQTKVYFATMEEGLYEVD
FT                   LKTLDINCLIRDGNNFKPEQLDIDLSKAISSKLPGYHGKGLFTSQGIVVYANNGDHDPR
FT                   VVKDPTVPSGALGYFDGVAGTDWQLIRRNQFTEVTGPSGVVSNDPNSTQPIWSLGWDAK
FT                   SLLLMVCEKGQWHTYRLPKASHSYDGAHGWNTEWPRIRDIGEESLLATMHGNFWKFPRT
FT                   FSPGNSAGIAPRSNYLKVVGDFCPWNDKIVLGCDDTAKSEFLNKRKAKGEIAGPGQSHS
FT                   NLWFLDREQLDQLGPVIGRGSVWLNESVVANQPSDPYLIDGYTHRQLVIHSPQPLQASI
FT                   RLEVDKAGTGEWTTYKTLTSNGRSTIWESLPRDLQGVWIRLVSDQPIENVTATFGSSNP
FT                   PAESRKNVSDLAQGLSLAGSEKRSGGVIHSRGGNFRSLRYVARTSNGQTGCYDLTTDLK
FT                   TGALTLAKVDDADGMAWTSKNVAIPQNVISRDEASIVYEDASGRWRLPVGDWQAPLASG
FT                   SYGPQRVCREVCTERDLFHAGQTFFELPAENASGMAKIRPVTTHPYSIDDYASHRGLLV
FT                   LSGVADDAAAGPHVVRSTDGACALWVGAVDDLWSLGQPKGSGGPWKNSQVTANVPSDPY
FT                   LLTGYRHRRVELSHDQAEAVNVTIEIDVTGTGLWTEWKTIAVPAGKAVEEQIPDDTVGY
FT                   WIRARATQNGKFTTWLVYGE"
FT   sig_peptide     complement(131708..131785)
FT                   /locus_tag="Plim_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.572 at
FT                   residue 26"
FT   gene            complement(131848..132150)
FT                   /locus_tag="Plim_0095"
FT   CDS_pept        complement(131848..132150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65948"
FT                   /db_xref="GOA:D5SN21"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65948.1"
FT                   /translation="MTTPTDAPGKGVMNFVVYGLIIILLVAVFAQVVFTITAMLGNQID
FT                   PRYLALLQLLAPVVVGTCVITSLLTLLLPPSKLRSNVPKICSLLVVIQVILWAAG"
FT   gene            complement(132217..132702)
FT                   /locus_tag="Plim_0096"
FT   CDS_pept        complement(132217..132702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0096"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sus:Acid_2583
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65949"
FT                   /db_xref="GOA:D5SN22"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN22"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG65949.1"
FT                   /translation="MSTPRPFHVKQIDHVTIVVKDLVRSRWFYHEMLGMAEVSRPAFSF
FT                   QGQWFQAGSTLIHTILEFEGSGPAGQSGGRSSRGHHIAFAVPDVRIAEKFLQQEGVPIV
FT                   VPCKLRPDGALQTFLHDPDGHLIELTSPPESLFRPGASLAVDVSSQVMLDGVFSLLT"
FT   gene            complement(132839..133999)
FT                   /locus_tag="Plim_0097"
FT   CDS_pept        complement(132839..133999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0097"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sus:Acid_1309 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65950"
FT                   /db_xref="GOA:D5SN23"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN23"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG65950.1"
FT                   /translation="MVSQQQQAIARPDDPRFLEIARRVRQGERLTLEDGLFLDREADLM
FT                   AMGRLANEVREKRHGNITFYNTNIHLNPTNVCVYRCRFCAFRADLRDEKAYAFTDDQAR
FT                   ERILEAQSRGATEIHVVGGLHHQKKFDWYVNLIRVLHETCPEIHIKAWTAVEIAWFSFL
FT                   TKKPVDWVLSEMKAAGLGSLPGGGAEIFHDEVRPQICEHKADGENWIRIHRAAHQLGLR
FT                   SNATMLYGHVERAEHRLDHLMRLRSLQDETGGFQTFIPLAFHPDNTKLAHIPKPTARMD
FT                   LRMVSLARLMLDNFDHIKAYWIMLGEETAQVAQSFGADDLDGTVVHELIYHDAGAKTPE
FT                   GLTVSKLHRLIQEAGRVPVERDTLYRRVVREGAKWSIESDGKTIGV"
FT   gene            134115..134246
FT                   /locus_tag="Plim_0098"
FT   CDS_pept        134115..134246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65951"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65951.1"
FT                   /translation="MGEWTDDGRGVVILGVGWDSKHDAERCEDHALSQSLQGRATRN"
FT   gene            complement(134295..134879)
FT                   /locus_tag="Plim_0099"
FT   CDS_pept        complement(134295..134879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0099"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   scl:sce6780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65952"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN25"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADG65952.1"
FT                   /translation="MSIAELPLSPVTRRMTAAEFLALPDEQPCELVKGVIVEMNPPSPR
FT                   HAIVISNLNYLLTTWARTHNSGLAGGHETALQTKSEPDTVRGVDGFYISFARLKGNVLP
FT                   EGPLLPAPELCIEVRSPSNRWTDLLEKAVEYLKIGVEEVWLVEPTLAPADRFIESHRLD
FT                   RDPIRFRMGETLTSPSLQEFQMEVGQAFSGI"
FT   gene            complement(134994..138575)
FT                   /locus_tag="Plim_0100"
FT   CDS_pept        complement(134994..138575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0100"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ade:Adeh_2042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65953"
FT                   /db_xref="GOA:D5SN26"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN26"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG65953.1"
FT                   /translation="MSRSGAASLRHSLLIKASLRYYWRTSLAVWLGVIAATAVVTGALL
FT                   VGDSMRGSLRAMTLRRLGEVDAVITGPRFVREDLASRLQAKLKDQGIEIAPGLILRGGV
FT                   EHQQSSKSGTDSLVRRAGQVMAYGVDERLWPWLDRSAPGTSISSAASRVAPPAGREALI
FT                   TTALAEALQARAGDTITLWVELPSAVPRDTLLGQKDNDSQEVTLTVREILPQEVTPAHF
FT                   GLAPSQLDPVNLFMNLKTLQADLGLGEVRPSRRDPQGSPARVNAIFFHDSKATSPESAL
FT                   ASQEDRAAVEEALRSVISFSDLQLRVIDDSAIGGLSVDSERMLLEDPLAQAIQSAADKL
FT                   KLASSPVMVYLANSIRKVGGEPRQYSMYSTVAGINAKALEPPFGPFPLVEPMAVVGGQP
FT                   VTALKLSGRGVMINTYLAEDLGAKVGDELELKWHQVGAHGELPEESGLFTVEAITKIEG
FT                   PAADRHLTPEVKGITDVDSLSDWDQPFPMKLDLVTTRDDEYWDQYKALPKLFLSLQTAQ
FT                   ELWPSRYGTLTSIRLALPTGTSREAIETELVSQMVEQLDMSAAGLSLQPLKAYGLKTAA
FT                   GATDFTGLFIGFSFFLIVAALILISLLFRLGVEQRTRELGLLAATGFTPTSIRWLLLCE
FT                   GFWLACLGSLMGLVLGTAYARLMIYGLTNWWKGAIRTSAIDLYVLPGSLVMGAAIAIAG
FT                   AMFSVWWALRDLSRIEIRDLLAGQSNLFEDQPSRYSQARWKALTSGGISAVMIVMLVAG
FT                   VVPASEAFGGLSWQIVGFFVSGMLLLATSLWTLSAWLDRPVISVLQGSGLAGVTRLAER
FT                   NVTRARQRSLLTVGMISAATFVIVTVAAGQRNPAADRPMKSSGNGGFALVGESASPILY
FT                   DLNTPAGRQSLQLKFPAGSKEASLLDAMRAYQFRVKPGEDASCINLFQATAPTILGVPR
FT                   SFIERGGFKFVGAREANPWELLLGTSTETIPVIGDINTLLYSLKKGPGATLPAPEAPSG
FT                   APPLKIAGMLDGSVLQGVLLMSEENFLRLYPEQKGFGYFLIELPPADEQPAIDLLESRL
FT                   VEYGLDLEPVGVRIARFLAVQNTYLAAFQALGGLGLLLGTIGLATVMLRNVWERQAELS
FT                   LMRAIGFGNGLITRMILCENALLLIWGLCFGTVAALVSMLPQLLSAGADVPWVTGGVWL
FT                   LLVFVVGMLSALAAVRLAVRLPLLVRA"
FT   sig_peptide     complement(138447..138575)
FT                   /locus_tag="Plim_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.359 at
FT                   residue 43"
FT   gene            138889..140169
FT                   /locus_tag="Plim_0101"
FT   CDS_pept        138889..140169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0101"
FT                   /product="FAD dependent oxidoreductase TIGR03364"
FT                   /note="TIGRFAM: FAD dependent oxidoreductase TIGR03364;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: pfl:PFL_5887
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65954"
FT                   /db_xref="GOA:D5SN27"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017741"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN27"
FT                   /inference="protein motif:TFAM:TIGR03364"
FT                   /protein_id="ADG65954.1"
FT                   /translation="MTLDLTTTMPSADHTDFSPKSADTSGPTFDDIVVGAGVIGLAHAY
FT                   ALARRGRKVLVIERHARALGASVRNFGMIWPIGQTLGTNMNLALDSRQIWAGVLERSGI
FT                   WHHQGGSLHVAHHDDEAQVLREFYELATQAGYELELLDARATTACSRAVNPEGLKLSLY
FT                   SRHEIAVDPREVIAKLPGYLRAHYGVRFEYGQMVRSIDGQKVKTSAGQWSARRVWLCTG
FT                   DETQILYPEILTRQGMFPCKLQMLRTAAQTGDWKIGPHLAGGLTLRHYTSFAACPTLAE
FT                   LKARVAREMPLMDHFGIHVMASQNGRGELTIGDSHEYNPPEEPFGTVSPFNTRQIDDLI
FT                   MSYLKTIMVAPDLEIAERWFGVYLKHPGKLWFEAAAEPHVEILTGIGGNGMTLSMGVSE
FT                   QHVARVLGEAITQDATPADASTKPALV"
FT   gene            complement(140546..141145)
FT                   /locus_tag="Plim_0102"
FT   CDS_pept        complement(140546..141145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0102"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: bra:BRADO4497
FT                   putative Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65955"
FT                   /db_xref="GOA:D5SN28"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN28"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ADG65955.1"
FT                   /translation="MPQDPPISGEQPEEGQSASEQAFPREGCLLGVDYGQKRVGLAIST
FT                   FEQTLAMPMEIYQRKSESVDREWFKATCLDYRVAGLVVGLPLHTSGEESELSREVRQFG
FT                   EWLARCTNLPLRFWDERYTSVSAELLMWQDGVFPRSGNKPASGRTSKKSPGAGHSSPQN
FT                   RAKKKTPVSPVDKLAAHMILTAFLAAENRELWSNSR"
FT   gene            141491..144562
FT                   /locus_tag="Plim_0103"
FT   CDS_pept        141491..144562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3824 organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65956"
FT                   /db_xref="GOA:D5SN29"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN29"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65956.1"
FT                   /translation="MKGYLRLSIWVFIGLVGLLLAITGIGGGAHLWARTTAPQESISLS
FT                   ADWLQEWEQGREHIGLFRGHCQITQGATTWQADKMVVWVESADVDSTVVEDRLVIWLEG
FT                   NVQEISATGHRSDSSRLLKLRTIAGVDLSVRGRVSDQPAIDDALYIRALKQRFAGTPEA
FT                   ALARSELLQTQLTVDPPALTIPPGSGNSGFANPGVMTPQLGQPAPSMNNSPAPAAMRRV
FT                   RIFPRSAVPFDVRSFRNENTLPPEQVVQLTGGVTIIVDGIERVGVIDLSADNAVIWTTA
FT                   LGKEEFSTESLQTGDTPYQVYLEGNIVIRQGENIVRATRAFYDAREDRALILDAELKSI
FT                   IPDQQGLTVRVRAESIRQLSRDTFQARNAYVTTSQLGEPVYRIQSSDIFIDQRTWSPWS
FT                   QPTVDPETGLLKPNTIPWVTAQNNAFVFGSVPLLYAPVISGPAEDPNIPIQGFTFGQDN
FT                   IFGSQIRTRWDAFQIFGLQKPADTRWTLEADYLSDRGPFLATDGKYRGLDNYGNSFFGQ
FT                   GLAAYVNDGGVDNLGLNRRDLAFPNANRGIVDAQHRHQFLNGIELQAEAGYASDRNFRE
FT                   QYYEQQFDTGKDLEMYLGMTQRYDQLAWSIWGRPSVNDFEYTTQWLPRGDLFVLGTPLL
FT                   SNILSYSSHSSVGYAQLDNAAPPPDPNDLFTPLPYYTDANGLVAMTRHAIEAPFQLGEL
FT                   MLAPYAMGEAAFWSDGFTNDSVDRFYGRAGLRANLQMWRVYPYVQSDLYNLNGLAHRMN
FT                   FGADYGYAASSTSLSEIPQWNEFDDNSQERFRERLVVNTFGGILPNVFEPRNYAVRSGA
FT                   ATGVADPYHELVDDQQVLALAWTHRLQTKVGPPERLRIKDWMTLDLGVNYYPDASRDNF
FT                   GESFGLFNARYAWYVGDRTSIHASTLLDFFDDGQKIFNVGVLTQRSVRGSAYVGFRQVD
FT                   GGALLSQILTASYSYQMSPKWISTAGTAYDVGEGQNRGQSLTITRVGESFLVHLGASYD
FT                   ASKNNPGIAISIEPKLGNRKTSPTMISPLMGAGF"
FT   sig_peptide     141491..141592
FT                   /locus_tag="Plim_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.552 at
FT                   residue 34"
FT   gene            144590..145213
FT                   /locus_tag="Plim_0104"
FT   CDS_pept        144590..145213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65957"
FT                   /db_xref="GOA:D5SN30"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65957.1"
FT                   /translation="MNPASLKALANSSGGRPEENHAFAVDSHPREDSPVIARLSASPMP
FT                   GSLPKLAPGSSAIRDQATETVPIDPLKIRIHQSAVDRPEWRQRLVEIEKGLATALRTDS
FT                   TLFMHLFFDSIIMASGAVLGLHLWQWVALTATLMIVLTVELLSQAIRRLALLAHRPHEK
FT                   RTPLTEVTHQTEALCFAASFVTILGGLVITTLIFAQRIYETIPE"
FT   gene            complement(145484..147391)
FT                   /locus_tag="Plim_0105"
FT   CDS_pept        complement(145484..147391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0105"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mxa:MXAN_2483 type II DNA topoisomerase, B
FT                   subunit; PFAM: DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; ATP-binding region ATPase domain protein;
FT                   DNA gyrase subunit B domain protein; SMART: DNA
FT                   topoisomerase II; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65958"
FT                   /db_xref="GOA:D5SN31"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN31"
FT                   /inference="protein motif:PRIAM:5.99.1.3"
FT                   /protein_id="ADG65958.1"
FT                   /translation="MATAYTASDIEVIEGLEAVRRRPSMYIGGVDARGLHHLLWEIVDN
FT                   SVDECLAGEATEITVTLHKDGESCSVSDNGRGIPVDLHPKTKKSALETILTTLHSGGKF
FT                   SKNAYARSGGLHGVGSSVVNALSEEMVATIHRDGFEWQQRFKRGKPTTALKQVRPFRGR
FT                   GTDVFFRPDKEIFARTVFSIETIKAHLEDISYIHAGLKITLIDEAKKETVVLHHPDGLQ
FT                   TYLARLMTEGQRKPVHENLFQFSKDDGSYKVEAVFRWSESTDEHLRSYVNGIRTHAGGT
FT                   HESGLKSAIGKAVRNYMEVHDIKVKGLTIQNDDIREGIVGLLSVFLAEPMFQGQTKEKL
FT                   NNPEMSSVVEGQIRPALENWLSSNKTTADAIVGRIVLAARARAASREAASEVRRKSPAA
FT                   RRLSLPGKLLDCRSTNADESELFIVEGLSAGGTAGMGRDSRTQAVLPLRGKVLNTQNMT
FT                   TAKILDNQEIKDLVETLGTGIGPNFDLHRLRYGKIILMMDADSDGYHISTLLLTFFFGH
FT                   MPVLITQGKLFLAQPPLYRIQSGNQIFYARDDLHKEEFLDSLPANRNPDVLRFKGLGEM
FT                   TPSQLKETTLDPKTRILLRIDIDNQLEADQTFEKLLGKEPAERYKLIMEQANQVDDLDV
FT                   "
FT   gene            complement(147516..149861)
FT                   /locus_tag="Plim_0106"
FT   CDS_pept        complement(147516..149861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0106"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: scl:sce4451 DNA gyrase subunit A; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; SMART: DNA gyrase/topoisomerase IV subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65959"
FT                   /db_xref="GOA:D5SN32"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN32"
FT                   /inference="protein motif:PRIAM:5.99.1.3"
FT                   /protein_id="ADG65959.1"
FT                   /translation="MTENQEDRIQFREISSETRRRYLNYAMSVIQSRALPDVRDGLKPV
FT                   QRRILYVMYEELRLMADAKTRKCAKISGDTTGNYHPHGNQSVYDTLVRLAQDFTLRYPL
FT                   VDGQGNFGSIMGLPAAAERYTEARLTGIAEQLMNELRFDTVEMRPNYDGTRKEPVVLPT
FT                   RFPNLLVNGTAGIAVGMATNMPPHNLKEVLEACIHLITNPEASTKELLKFIKGPDFPLG
FT                   GRMITDRKAMLPIYEEGRGAFKVRAEWRMDKEKRAEVEDRVVIYSVPYGVETGPLLAEI
FT                   GNVIASRKLPQLINAADETDDKHGLRVVLELKKGSDPESVMAFLYKKTPLEQNFNYNST
FT                   VLIPDDQGLLTPARLPLHRLLGEFLKFRLKVVKKRFQFQLDQLQARIHILRGLEIIFNG
FT                   IDKAIKIIRNSNGKRDACDKLMAAFPLDEPQTMAILEMQLYRISQLEIDTVLAELNTKQ
FT                   KEADRITRILAKDDRIWNVIEGELRELSEQFGDKRRTTLGSSDEVTEFDESHYIVRENT
FT                   NVVLSKDGWIKRVGRLQSVESTRVREGDQVLDVLPGSTVDHVIFFASDGIAYTMPISQV
FT                   PVSSGYGEPLTKHYKFKDGVQVIAAVTTDPRFTAVAEETAEGAEPAPPHLFVTTAQGQV
FT                   MRVPLQPFRTASTRSGRKFCKLQEGDVVAKVELIVDQTSVFLVTREARLIHFSLEEIPV
FT                   LSGAGKGVRGIRLEEKEKDLVLGAALMSRPSDVLRLKLANEKELTCGQMKYALTTRGGK
FT                   GVKVSHRSQVGEIVRPEIALVDWNSIEG"
FT   gene            150271..150915
FT                   /locus_tag="Plim_0107"
FT   CDS_pept        150271..150915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF19107 gene product from transcript GF19107-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65960"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65960.1"
FT                   /translation="MQFLKLSVLILPAVICHSAIANDPIYLPAEVVAPAPQAASFGNMP
FT                   VVTAPAEQVPPSPLYAYPTAAESEFAPIPKAPSIHTPVISRQVTPPPAATTTIPQGAVV
FT                   SEAPQSGYVRLGAPLYPSPSPHVPVWTGGSMITNQAFAPHEMLYAHKYKALYPPYYHKV
FT                   KGHWLLTPFGVKSHERWELQGTMVEVNYHSHYPLLPKFTKPHTSQNHGPWR"
FT   sig_peptide     150271..150336
FT                   /locus_tag="Plim_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            151137..151781
FT                   /locus_tag="Plim_0108"
FT   CDS_pept        151137..151781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_3736 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65961"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65961.1"
FT                   /translation="MAQAAEPAPMPTDTAPAVTAPAAVSSQSAGVVRIRKERTQALQSQ
FT                   APVSGPVAPVGFRDAISEGFESFQTPARPVTMTQAYAQPYSSQGYAAQPVAMHGQAHSY
FT                   PVETVYTDCPNGECDRHGYCKERFHEWLKYKFGYFIPTGNGGTGTPLFGKYHRVYPQDP
FT                   GYFDQRDGQLYSAQGYGVPVSVPLAPVVGHQYNYGWGIPSSRLTPISHPAN"
FT   gene            151907..152692
FT                   /locus_tag="Plim_0109"
FT   CDS_pept        151907..152692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Ras association and pleckstrin
FT                   homology domains 1"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65962"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65962.1"
FT                   /translation="MTSQDTRWLALAAVSAATSLCGGLVEPTIASAQEVGLVRISDRSP
FT                   SSVQTTPVGHKHYAHGPVMTTTIPADGSGQYCDNCDRRGGHGGNAWRMHLPPDHGYSVP
FT                   AKFPLQRRGVEYENYFPPQWYGAGLTYQQNYPMVYMPTDTTQLGFYYQHVPFWRPNPNM
FT                   LPPRPVPSQWHIHAPVVYATDFHRMHAGAGSQGWQEVQVLDSTTAPATNGAQPTPIDGN
FT                   GLQPVPAPMVPQVPGSEVPPAPMLDSAASGHIKRAAAQQ"
FT   sig_peptide     151907..152005
FT                   /locus_tag="Plim_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.888 at
FT                   residue 33"
FT   gene            complement(152919..153149)
FT                   /locus_tag="Plim_0110"
FT   CDS_pept        complement(152919..153149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65963"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65963.1"
FT                   /translation="MQTNHEGLCAMLAALGCLLHASSLECSWDAWLGSNVLVCPQVMGR
FT                   NVTGEIVLANVDYQGADADIRPLPPGQEPSP"
FT   sig_peptide     complement(153084..153149)
FT                   /locus_tag="Plim_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.854 at
FT                   residue 22"
FT   gene            complement(153301..154728)
FT                   /locus_tag="Plim_0111"
FT   CDS_pept        complement(153301..154728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0111"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sus:Acid_1336 putative streptomycin biosynthesis protein
FT                   StrI"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65964"
FT                   /db_xref="GOA:D5SN37"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN37"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADG65964.1"
FT                   /translation="MNPANSPSANHASGTSQPPRSNSVVSRRDVLRATGALATTSMIAS
FT                   MAIPQTVYAGEDNTIKVALVGCGGRGTGAAANALSVKNQGPIKLVAMADVFPNRLNSSY
FT                   EGLKGQFKDQVDVPEDRRFVGFEAYKQAIDCLSPGDVVIMATPPAFRWVQFTYAIAKDV
FT                   NTFMEKPVTVDGPSTKRMLQLADESEKKNLKVGVGLMCRHCDARGELFKRIQDGEIGDL
FT                   LLLRAYRMAGPTATAFAKKKPENQKELMYQIQNFHAFLWASGGGFSDFLIHNIDECCWM
FT                   KNAWPVKAQATGGRHFRGDYVDQNFDQYAVEYTFADGTKLLMEGRTMPGCHQEFASYAH
FT                   GSKGSAVISQSGHAPSRARTYKSQDMSSKDNILWQFGAKEPSPYQLEWDHLVEAIRKDR
FT                   PYNEVRRGAEASLVTSMGRMAAHTGQVITYDAMLNCDHEFAPNVDSLTEDGPAPVVADA
FT                   EGKYPVPMPGLKTTREY"
FT   gene            complement(154834..155712)
FT                   /locus_tag="Plim_0112"
FT   CDS_pept        complement(154834..155712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65965"
FT                   /db_xref="GOA:D5SN38"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65965.1"
FT                   /translation="MQPYWKYWRISILLLPLLFLALLVGLDFSQYLQREARQLAVVIVD
FT                   IEREWKVASEAKNLPELKALNDRLEKVMEEFRRLRAQGLACNWVLFALTIPLAWVTWQL
FT                   TRERLSQLEMAGRFASILLPLLSVILMLMPDPGQRWLVVQVLAMLLWLGVTAALQKVAV
FT                   YRMDQSLLEAYAKMAKIINILVIAMLAVRFFPQMIPPAAVPTVIWGFWVAQYVIVFVLA
FT                   QFCWKLAQALKPVESGQLPLLSPAEQTLLIREFERQSADREHETDPGYEEDDAEPSQIP
FT                   REGRNSRINDL"
FT   sig_peptide     complement(155623..155712)
FT                   /locus_tag="Plim_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.576 at
FT                   residue 30"
FT   gene            155893..156120
FT                   /locus_tag="Plim_0113"
FT   CDS_pept        155893..156120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65966"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65966.1"
FT                   /translation="MAGLPVVCLVRRGFKSWGQESFNQQAYPGRLVMLESCVSSRAGSL
FT                   SREEPLRRAVALPRFGLTFPDPPGFKLDSF"
FT   gene            complement(156413..157003)
FT                   /locus_tag="Plim_0114"
FT   CDS_pept        complement(156413..157003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted gene, 675238"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65967"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN40"
FT                   /inference="similar to AA sequence:KEGG:100191037"
FT                   /protein_id="ADG65967.1"
FT                   /translation="MKFAWISAVLLCIAGLNSADAGFHWLKKSDCGCAPEPTCAAPAAC
FT                   APSCAAPAACAPSCAAPVACAPAPAACAPTCAAPVACAPAPAACAPTCAAPAACAPAPA
FT                   ACAPSCAAPVACAPATCAPTCAPACDPCAKKRCHLKEKFAAMKCKLRKACSRKTSCCSV
FT                   APSCAAPAACAPTCAAPAACAPTCAAPMATPCH"
FT   sig_peptide     complement(156944..157003)
FT                   /locus_tag="Plim_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.434 at
FT                   residue 20"
FT   gene            157477..158766
FT                   /locus_tag="Plim_0115"
FT   CDS_pept        157477..158766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0115"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="PFAM: Stage II sporulation E family protein; GAF
FT                   domain protein; SMART: protein phosphatase 2C domain
FT                   protein; GAF domain protein; KEGG: noc:Noc_0206 protein
FT                   phosphatase 2C-like, stage II sporulation E"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65968"
FT                   /db_xref="GOA:D5SN41"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN41"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADG65968.1"
FT                   /translation="MHDITHDHASQHRILALSRMLELVLKLNDVNDLAAVLNAITHGAC
FT                   QAVECDRASLFLYDSQADELYSHSTTELEIREIRLPIDSGIIGHVARERVPLVVAQPHD
FT                   DSRWSPVFDQQTGYRTRNILAVPVVSKSENRLLGVLQLLNKHADCFEDFDVQLMQAFAV
FT                   HAGAAIERQWLQSAARQAEDYRRSMEMARQIQMGFLPKERPRFPQYEVTAWWEPAEYVS
FT                   GDYYDWLVAPDGRLGIAVGDVSGHGMAASLIMASVRAMIHALGRLATTPADMMELLQDV
FT                   VQADLVDGRFLTLLLLTIDPVTHCVEFANAGHAPAIYYQSSKRSCRRLEATRTPLGFPV
FT                   NQSLRLPIYPVMQPGDLLILGTDGLIEVHDEKGKIFGMQRLEELIAKHAHESVETLSQI
FT                   LKREVFDFSTEHPFPDDMTLLIIKRVDEAA"
FT   gene            158867..160249
FT                   /locus_tag="Plim_0116"
FT   CDS_pept        158867..160249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0116"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: ajs:Ajs_0095 L-serine ammonia-lyase; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65969"
FT                   /db_xref="GOA:D5SN42"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN42"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ADG65969.1"
FT                   /translation="MYVSVFDLFKVGIGPSSSHTVGPMKAAQIFAQRLVDQGHLEKLGM
FT                   VQAHLFGSLALTGKGHATDSAVIWGLAGEMPATAQSENLARILDRVQKEHRLPIGGTDH
FT                   EIEFLPDRDIFFHYNEVLPQHPNGMKFVALDKNGLPLAMESAFSVGGGFVIFEGEDQAQ
FT                   TSTSPQVEILFPFTTAAELLEIGIREKKSIAAIVRENERAFRTDAEIDAGLDRIWEVMQ
FT                   SSIDRGCRTEGILPGGLNVKRRAASMCRTLMTSGPRPIDPLQSLDWVSLFALAVNEENA
FT                   AGGQVVTAPTNGAAGVIPAVIAYYKRLLAGATQEGVRTFLLTAGAIGMLYKRNASLSAA
FT                   EMGCQGEVGVACSMAAGGLAAVMGGSNEQIENAAEIGMEHNLGLTCDPIKGLVQVPCIE
FT                   RNTMGAAKAINAARLAVLHGDGTHRVSLDRVIETMRQTGVDMQVKYKETSIGGLAVNVV
FT                   DC"
FT   gene            160405..161856
FT                   /locus_tag="Plim_0117"
FT   CDS_pept        160405..161856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0117"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: tbd:Tbd_1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65970"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN43"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ADG65970.1"
FT                   /translation="MSHHIPTRRSFLTAAVTTTSAGWLLATAQSATAQSATAQSVVANP
FT                   GEFVEPARTLPVQRDADVIVCGAGPAGVTAAITAARLGARVRLFEAHGSLGGVWTSSLL
FT                   GYLLDFDKPGFNVELVRHLRQRGAIRGEGMNGLTYHPEEMKLILEELCTRAGVNLQLHT
FT                   RVTAAYREGIRLSTIITESKSGREAWQAPIFIDSTGDGDLGAQAGCEFEIGRDQACPCQ
FT                   PMTMYALLVVRNLAEIAPYLHGVGNDGQHVGPKAFQELLKSAGVQPSYGKASLFPISGQ
FT                   LVLLMANHEYGINATNAAQVTTATLHARAELHQIVKALAKLGGPWQGTEIVATPEQIGI
FT                   RDGRRIRGRYIMTADDLIRGATQDDAVVRAKFPVDIHALSLEENRKSAYSNAGVKAKPY
FT                   DIPIRALIARDVDGLLMAGRCISGDFISHASYRVTGNAVAMGEAAGTVAALAAETKQLP
FT                   QDIPFPTTQAAIQKSRTIGEATVLE"
FT   sig_peptide     160405..160506
FT                   /locus_tag="Plim_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.777 at
FT                   residue 34"
FT   gene            161969..162136
FT                   /locus_tag="Plim_0118"
FT   CDS_pept        161969..162136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0118"
FT                   /product="CRISPR-associated Csm1 family protein"
FT                   /note="KEGG: msu:MS1651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65971"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN44"
FT                   /inference="similar to AA sequence:KEGG:MS1651"
FT                   /protein_id="ADG65971.1"
FT                   /translation="MIILGDNSGIQGFVFDIAEEGGGQAQRLRARSFMFQLIAEVASIR
FT                   ILNASNCPLT"
FT   gene            complement(162257..166942)
FT                   /locus_tag="Plim_0119"
FT   CDS_pept        complement(162257..166942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0119"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: ppd:Ppro_2598 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   PAS fold-3 domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65972"
FT                   /db_xref="GOA:D5SN45"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN45"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADG65972.1"
FT                   /translation="MTANLDREDVRNSAPSLPLLDLLAAVSEASLDALFVKDSSGRYLF
FT                   CNAAGTKLTNRTREQILDQDDTAVFGSDTARIMRAQDQRVMQSGLPAAETHVVQIGDNL
FT                   RSIQMTTKPYQDQHGTVQGVIVIARDFADAAMGNRSHTVGVAAANHLERSGAEQALRES
FT                   ERQLADAQRIARIGSWVWEPSSGKVWWSRGVFALFGVDPQVVQPSFQAFLQLLHPDDLP
FT                   TAVARVDAMLAGADRFEDDLRIIRPDGQMIWLHSRAVATRDADGNILRVEGTDQDITAR
FT                   KLAAAEVQASQKFVKAVAETSPLTIYVFDLQQQSITYSNYYLMRDLGFTPEAIQGRSWA
FT                   ELAELVHPIDFANVTTLLQRWDTVDDQQVLLAEYRLQDVHGNWRWFVSRDRVFERTPDG
FT                   RVSQIIGTAEDITERKRVEQSLRESEQRFRELADAIPQIVWVAALDGGLTYLNAKATEY
FT                   TGVGMDQLTGWSWEQVIHPEDVPNAIERWTATLEQELPRDIELRIRQTDGAYRWHISRQ
FT                   VPIRDASGAIVRWYGTCTDIDDLKRTQAALQQSESTLEEAMRIGDMGSWIIDLVQNRAT
FT                   WSDEGFRLLGYVPGVDQPSQELFLNGVYPADRDTVRHDLANAIATQTSLNSEFRFVRPD
FT                   GQLRWLHSRARATSDQHGRPIQFVGVTQDITARKQAELARLEVEERYRLAILATNDLIW
FT                   DLDPVAGTVAWSEQYAATLGRTPESSDSLQWWIDRIHPADRERTARSLSAAVDGTATYW
FT                   TADYEFLRADGVWASIHDRAYIARDAAGHARRVVGAMQDVTDRKRAETEVRRTAELLRA
FT                   VAEGTSDAVFVKDRDGKYLLANQAACQFMGKPLEQVLGRDDSEWFDAEGARLVLEVDRE
FT                   VMRSGLVRTSEETLTANYVTRTYLASKAPYRDELGNVIGIIGISRDITARKEAERMLRL
FT                   NQFSVDHAVDSIFWINASSEILYVNNAACRTLGYTRDEMLGKTVPDIDPNFLPEAWPAH
FT                   WEELRCRGSFTFESDHVTKDGRTLKTEVTVNYLQYEGQEYNCAIMRDISERKQAELEMR
FT                   QSLSRMRATLESTADGILVVDLEGRVLDYNRRFISIWRFPEEMIAEANKSDIIASSDQH
FT                   QAVQKMLAQLKDPEGFVRRVQEMYQNREESSFDVLEFKDGRIVERFSQPQWMDGQPVGR
FT                   VLSFRDVSEQRKLEEQLRQSQKMEAVGQFAGGIAHDFNNLLTVINCYCELLLDQKSQPQ
FT                   NWRESVQHIRDEGLRAAQLTKQLLDFSRRSHFQPRVIHLNDVIEGSQKLLRRLIGERIQ
FT                   LILHLDPLLPAIKADTTHLDQVLMNLVVNARDAMPAGGRLTIRTSRLSPQDARQFLTNI
FT                   SLETPYVQLEVADTGIGMSADVQARIFEPFFTTKEIGSGSGLGLAVVHGIMQQHDGQIH
FT                   VTTEPGVGTTFRLLFPGVAEEPPSVTASKQPTIRHGAETILLVEDEPAVRKATRLMLEL
FT                   QGYRVLEAANGREALDLVRTLPDPIDLLITDVVMPGIGGRELAGELRSMHADLPVVYIS
FT                   GYSESFGARGASLQPHEAFLQKPFTQADLLQQVYTSIVRAL"
FT   gene            complement(167057..167344)
FT                   /pseudo
FT                   /locus_tag="Plim_0120"
FT   gene            167574..168923
FT                   /locus_tag="Plim_0121"
FT   CDS_pept        167574..168923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65973"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65973.1"
FT                   /translation="MRVFPLIGYLWLVVAPVLAEDKTSDRVADVVAVPGCVAVWDFVKR
FT                   EPGGERRFLAHVPAFGRPAGGKTGGGNTEKVAAAGDAVPNEYPLDAGNYVRDFWGSGRE
FT                   ATYADFPLLGRGPFGNAIQIRQETDPDFRPLLFVPRERLHDTPLDIKGAGKSVTVVVWA
FT                   IRESGNHALAGIWHEGTDLKQESTAGIQKVQRGQRQYALFAGLNKEGSACGHVSENGAS
FT                   SFLNRYALHKCNSAEVSPKVPANAPPEKLDAAWQCFAMTFDHEKDQLTGWLNGHAGDRW
FT                   LENPQKDNLLSYAANAWKQGHLRREEGLQPGEDPNFPADQFYNPPEETPVAPKVLSEND
FT                   VERIELREYGYTKMKVTLRKAGDEWKLAERELVALRLNPWWYPHDLYTPANDGSGGPFT
FT                   IGRVIHSSRSVGFTGWIGGVAVFDRALSEAELKKLTELGRKPVSTVPSGS"
FT   sig_peptide     167574..167633
FT                   /locus_tag="Plim_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.947 at
FT                   residue 20"
FT   gene            168935..169525
FT                   /locus_tag="Plim_0122"
FT   CDS_pept        168935..169525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_04786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65974"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN47"
FT                   /inference="similar to AA sequence:KEGG:HCH_04786"
FT                   /protein_id="ADG65974.1"
FT                   /translation="MWTAVVEPLKGEAGFRCSLSKAGAVGTWREVATALACDLGCRRLL
FT                   NHTLAEIPCVAFRWECPALTRNRFDQPFECVILEDRSLHRTPDNSPFASYLKQCQTQVA
FT                   VFDNLGGDATLVVPTMATDTNAYGHLASFVRLAPENQQNELWQRVGETQLRKVGAAPVW
FT                   LNTAGAGIAWLHVRVDSRPKYYHYGPYRQEKVG"
FT   gene            169655..170845
FT                   /locus_tag="Plim_0123"
FT   CDS_pept        169655..170845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0123"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding LysM; SMART: Peptidoglycan-binding
FT                   LysM; KEGG: bsu:BSU14040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65975"
FT                   /db_xref="GOA:D5SN48"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN48"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG65975.1"
FT                   /translation="MSPWKHVRLIQALAFWGLSCGFILTSGWAAWQFAKPGTLVEWGFV
FT                   PTGELIGAETPPETPVPYKPLPQAEATAPFASLPHVPGAAEATPEGTALMTAVGEQEHL
FT                   QHSQLGLASERMSGTQEAMPGNLHEIPRRYQRKPLSRDQLSSSLVQQVSFQPPAEDLTA
FT                   QISDSLTTSLAEVDGLLKAGETLKAHKKLSQLYWSEPASRPVFQQRIEATAQVIFEQAE
FT                   PHFVPAYTIQPGDQLRKIAGEHKLSWEYLARLNRIDPRRLQAGKKLKVIRGPFSAHVSL
FT                   SRFELTIHLQSYFVKKYSVGIGKDRSSPQGKLAVLEKIADPQYTDPEGRVIEGKDPRNP
FT                   LGPRWLDLGNSYGIHGTIEPESIGKAASRGCIRLQNDDAIEVYDFLVKGSEVVIEP"
FT   sig_peptide     169655..169744
FT                   /locus_tag="Plim_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.968 at
FT                   residue 30"
FT   gene            171080..171760
FT                   /locus_tag="Plim_0124"
FT   CDS_pept        171080..171760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65976"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65976.1"
FT                   /translation="MKRPARTQSPASADSSAAEQAEGELLEEELLEATPLPELYGEVTL
FT                   PEGSDQHFQWQLVRLPTVWLMGYEISAADEPLALETQLQSALREFLSKQLLRRIPGQQT
FT                   DRVICLAWTARASESEALLEKKILIGAEVDAETPIPQGMAKWAFSRGTSVVMSQQAGAE
FT                   PVEPAVSSSAIEVKPVCLQHAGMFPQWLAQQESLTWREGPLFERHDLNSPGEAKIFLPV
FT                   RLKN"
FT   gene            171841..172326
FT                   /locus_tag="Plim_0125"
FT   CDS_pept        171841..172326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0125"
FT                   /product="metal-dependent hydrolase"
FT                   /note="KEGG: aba:Acid345_1075 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65977"
FT                   /db_xref="GOA:D5SN50"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65977.1"
FT                   /translation="METMITSAQIDAYVAGGAKLIAAFDGLTKADLQAVPVPGTWSLQQ
FT                   IATHIYDSDLIGTDRMKRIAAMPNPLICAYDESAFNTLPGMEAIDALAACKAVANNRQF
FT                   MAEHLRRFSPEMFARTGIHTEVGKVSLADQVIKYIHHLEHHLKFALQKRALLGKPLA"
FT   gene            complement(172487..173320)
FT                   /locus_tag="Plim_0126"
FT   CDS_pept        complement(172487..173320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03967 tRNA
FT                   nucleotidyltransferase/poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65978"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65978.1"
FT                   /translation="MPTRRFSSEDDPGILRAELAREAARLLVRGKVQNFSTARKRAARS
FT                   LSTQRLTAAHQPSNQEIQQEIDLLLKPLQLDSAGHPSFAEQATTSSKICPEDFTSPPAE
FT                   NSIQPDGVAAATHVDPEPSTADFYIRLANVLYRLESVRLDSIEHPEGDALYHSLQVFEI
FT                   GRSIEPYDEEFLIACLLHDVGLTINPRQPILSTFDVLGEWLSERTRWFIEQRPVATAGL
FT                   RQGRFPQSLRKHPDFDLLVELARADREGRVAGAQVPEVEEVIAYLMALDEMCQGE"
FT   gene            complement(173405..174763)
FT                   /locus_tag="Plim_0127"
FT   CDS_pept        complement(173405..174763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0127"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   saz:Sama_1472 ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65979"
FT                   /db_xref="GOA:D5SN52"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN52"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG65979.1"
FT                   /translation="MFFNTIRAVRLALKSLLLHKLRSGLTMLGIVFGVFSVIAMLAIGE
FT                   GASAQAQAQVRQLGATNIIVVSVKPPADSSSNSSRSSGRGPSVLAYGLLRADYRLLSET
FT                   IPTITSTIAIREIQSEVRYLQNTINARVVATTTGYKDMNHLEMAEGRFLTDQDEREMAN
FT                   VAVIGSEVAARLFPYESPVGKTILMRSFRFTVVGVTRSRTASAAIGGSMSGQEFNKDVY
FT                   IPLKTFQTRIGDRVITALSGSFSAEEVQLNQITLQVAETQDVVRTADVVRESLMRNHRG
FT                   KNDYDVIVPLELLKQAEQIKQIFNIVLGSIAAISLVVGGIGIMNIMLATVTERTREIGI
FT                   RRALGARQSDIISQFLTETIVLSGTGGLLGVGLGLCTPLAFMGIQWIVENAVLSGSSGT
FT                   SEISQLFGNMRPQIAFWSLPIAFGISVGIGVIFGIYPARSAARMDPIEALRHE"
FT   sig_peptide     complement(174608..174763)
FT                   /locus_tag="Plim_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.381 at
FT                   residue 52"
FT   gene            complement(174836..176230)
FT                   /locus_tag="Plim_0128"
FT   CDS_pept        complement(174836..176230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0128"
FT                   /product="protein of unknown function DUF1552"
FT                   /note="PFAM: protein of unknown function DUF1552; KEGG:
FT                   sus:Acid_4306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65980"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN53"
FT                   /inference="protein motif:PFAM:PF07586"
FT                   /protein_id="ADG65980.1"
FT                   /translation="MPHTSRWSIPRRTFLRGAGVAVALPWLEAMGSPVKAAELTTPADA
FT                   LEAGKYAPVRFGCLFFPNGVWKDAWIPKQSGKDFELPDSLQPLTNLKEHVTILSQLDKR
FT                   HSHEGDGHYAKTANFLTGLRVEKTTGKNISTGGVSLDQYMAKQVGHLTPLPSLELGIDP
FT                   VISGIDSNVGYTRLYGSHISWQTAERPVAKEINPRTVFDRLMNVQQAGKNRGQAASSRD
FT                   ADRKSLLDFAMSDARRLRQQLGRDDQFKLDEYLDSVRAVEKRIEFFTQPDPRVWHPETP
FT                   QAEMEAPGAPRDYQEHVRLMIDLMILAFQTDSTRVSSFMFANDVSGHNFSFVDGVRGSH
FT                   HELSHHEGKPEKIEQYQKINRWHVSQFSRMLERMSQIREGESTLLDNSMILLGCGMADG
FT                   NAHQPDNLPIVVGGHAGGRFAGGQHIASAPRTPLCNLYVSMLDGMGCPVNQFGDSTGPI
FT                   KEVFSA"
FT   sig_peptide     complement(176120..176230)
FT                   /locus_tag="Plim_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.925 at
FT                   residue 37"
FT   gene            complement(176475..178478)
FT                   /locus_tag="Plim_0129"
FT   CDS_pept        complement(176475..178478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0129"
FT                   /product="Protein of unknown function DUF1592"
FT                   /note="PFAM: Protein of unknown function DUF1592; Protein
FT                   of unknown function DUF1588; Protein of unknown function
FT                   DUF1587; Protein of unknown function DUF1595; protein of
FT                   unknown function DUF1585; KEGG: sus:Acid_5827 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65981"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN54"
FT                   /inference="protein motif:PFAM:PF07631"
FT                   /protein_id="ADG65981.1"
FT                   /translation="MIFSQGWSRRDVVSFRCRLQLLMLIVCFGLFTSIVHGADPVAFDR
FT                   DAKPYLKKYCFSCHDDKKMEGELNLAVYKEPQRVLESLPKWETIIQRVKAKEMPPEGSP
FT                   QPSEEEFQRFLSWYGTLPRPENECRNLATDATQNFYQGYVMSRRLTRAEYANSVRDLFN
FT                   YDFQILSRIPADGAGGEGFDTNGSSLFTSAILAEKYLDVATDVASQLLPESLREQPAAI
FT                   QQRESSQSIDPLETARRKLLAHWPGAALTPREAARLNLEPFVKRAYRRPIHKEDLEPLL
FT                   ALFDQAYQRGDPFPQAMRLPLMAILISPHFLFLAEPEPSQEGVHALPPYPLASRLSYFL
FT                   WSSLPDDELLQLAESGQLLQDDVLKAQVRRMLADPRVRGLGENFGMQWLGLSQFGETTR
FT                   PDAKLFPEFDSDLLQAMRQESIETLTAVFRQNRSLRELLVADYVFVNDRLAEHYGLPKP
FT                   GSNAMVQVSLTDDQKYRGGIVTQGAVMVHTSYPFRTSPVLRGRWVLEEVLGSKVPPPPP
FT                   GVPPLPEHDPNAPPLSLRERLEKHRQDPACSACHNRMDPLGFGLENFDVLGRFRTAEAG
FT                   LAIDASGKLPSGENFSGPAEMKQILLKRKGEFLRNLTKKMLGYALGRGLNKFDQCVIKE
FT                   TLEALKSHDDKSEVLVEQIVLSYPFRHRYTKK"
FT   sig_peptide     complement(178365..178478)
FT                   /locus_tag="Plim_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 38"
FT   gene            178874..179221
FT                   /locus_tag="Plim_0130"
FT   CDS_pept        178874..179221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65982"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65982.1"
FT                   /translation="MSSIGFGGYGSPFVSGAAGIPAAQPQGSQNQRATASSDANRDLSI
FT                   AQLNEKSIGDLAENHGVDDRDADGRMPWTANEEPPVEQPEASESQQPIHKPPLHPLDAD
FT                   GERGTLFDSDA"
FT   gene            complement(179349..180119)
FT                   /locus_tag="Plim_0131"
FT   CDS_pept        complement(179349..180119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65983"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65983.1"
FT                   /translation="MNQLSELWQSSLIANVTCDVFTPPAVKAIIVFLHGMDGNTLVASE
FT                   AWSQEALKASVSIIAPHGLGKVFADQPLDHTTAPYCWWLDAGEMPIHESSSTAQAPISP
FT                   EAWLTDQLQPYLQETGLPYVLAGYEVGGQGALRVAYRHPRKFPIVAAIAPKVDLHNIHG
FT                   LGTSLDRLFPTAEAVRQQEATVWLNPLLRPNHQLILCDPGNDFCYPGCQTLQTKLSSTG
FT                   CPHEISLETTPGTLWNSEPDAAAPRMVAFLSRFA"
FT   gene            complement(180116..180592)
FT                   /locus_tag="Plim_0132"
FT   CDS_pept        complement(180116..180592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0132"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: rce:RC1_0102 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65984"
FT                   /db_xref="GOA:D5SN57"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN57"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADG65984.1"
FT                   /translation="MTDLTHFDSEGHSRMVNVGHKPVTERTATAEGFVTAHPETITRMA
FT                   GGGTAKGNVLEVARLAGIMAAKKTADLIPLCHPLGLDSVEIEFSFTSPDELRIVATASL
FT                   TAKTGVEMEALTAVSIAALTVYDMCKSIDKAMTIGPIRLLSKTGGKSGSWSAPS"
FT   gene            180735..181580
FT                   /locus_tag="Plim_0133"
FT   CDS_pept        180735..181580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0133"
FT                   /product="histidine biosynthesis protein"
FT                   /note="PFAM: histidine biosynthesis protein; KEGG:
FT                   mno:Mnod_6008 histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65985"
FT                   /db_xref="GOA:D5SN58"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN58"
FT                   /inference="protein motif:PFAM:PF00977"
FT                   /protein_id="ADG65985.1"
FT                   /translation="MPGHASVVVPVIDTRNGWAVHAIAGNRALYRPWTDSFQQPRKPQQ
FT                   LAEEFSRVWQPRWLYVADLDGIIDGQPQTSSWPCLPGDGPRILMDAGFREIDDVLTAVN
FT                   LGYEVILGTESLPSMAWLQELIVRLEDSQRLWISLDFRQGQWQAPAEFQQLGLTDFISQ
FT                   LSNWSMTHWIVLDLADVGQGTGGSTAEQIRLLRETLEKSSRNWKHPAESYQSRLAQSCQ
FT                   HGTQVVPTERTPTILAGGGMRTAQDVLQLQTQGVSGVLVATALMTGTITPDQFAPLRMP
FT                   "
FT   gene            complement(181637..182713)
FT                   /locus_tag="Plim_0134"
FT   CDS_pept        complement(181637..182713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0134"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: maq:Maqu_1545 phospho-2-dehydro-3-
FT                   deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65986"
FT                   /db_xref="GOA:D5SN59"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN59"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ADG65986.1"
FT                   /translation="MSTVMQPLQNVNVRDTVPLIAPRYLKSEETISDSAMRTVVEGREA
FT                   IKRILSGEDSRLFVTVGPCSIHDHVAALEYARKLRDLAEKVKSHMLIVMRVYFEKPRTT
FT                   VGWKGLINDPHLNETFDIATGLRAARRILLEVNDMGLPAATELLESITPQYISDLLAFA
FT                   AIGARTTESPTHRQMASGLSMPVGYKNGTDGTLQVALDAMQAARTSHSFLGIDPEGKTC
FT                   IINTKGNPWGMLVLRGGRTAPNYAPENVQEAVSKLRALNLCDRIMVDCSHANSNKDYTK
FT                   QHIVWNDVIQRRLDGETALAGVMVESNLFPGNQPLKNPADLKYGVSITDGCIGWEETEE
FT                   LILSAYEKMNPTPAEVTA"
FT   gene            complement(182998..184221)
FT                   /locus_tag="Plim_0135"
FT   CDS_pept        complement(182998..184221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0135"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   gur:Gura_2501 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65987"
FT                   /db_xref="GOA:D5SN60"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN60"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG65987.1"
FT                   /translation="MPAMTLSPLVEALKPSATLAAAAKARELKNKGVKVLDFTLGEPDF
FT                   NTPEHIQAAAIEAMKAGKTHYTPSGGIAELKEAVCRAYKRDYNLDYAPNQVLISNGAKH
FT                   SIHNVLATLCGPGDEVIIPTPYWVSYGALVELTGAVPVLVETTEASGFVMTAEQFEAAI
FT                   TPRTKLLLLNNPSNPTGAAYTPAQLEALAKVAVARNIPVLSDEIYEKLIYPGSEFRSFA
FT                   SFGPEVKALTIIVSGVSKAYAMTGWRIGWTIGPAAIIKAMDNLQSQETSNPCSISQYAA
FT                   VTALDGPQESVEAMRVVFERRREYSLSRLRPWQERFGVTCPPPGGAFYMFFNISSMLNK
FT                   PLASGKVAKDASEFCTILLEEAHVALVTGDAFGAPGFVRLSFATDDETLKQGFDAIEKF
FT                   LASAGSAG"
FT   gene            184974..185276
FT                   /locus_tag="Plim_0136"
FT   CDS_pept        184974..185276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0136"
FT                   /product="lysophospholipase L2"
FT                   /note="KEGG: pzu:PHZ_c2949 lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65988"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN61"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c2949"
FT                   /protein_id="ADG65988.1"
FT                   /translation="MATKTTTKAAPAKKPVEKKAAPAAKPAAAKPAKSTKPKAEKPAKA
FT                   APAAKPAKATKAAPAAKPAKSTKPKAAPAAKPAAAKPAKAPKAAKPAAPKTPAAS"
FT   gene            complement(185434..186696)
FT                   /locus_tag="Plim_0137"
FT   CDS_pept        complement(185434..186696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0137"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dds:Ddes_2341 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65989"
FT                   /db_xref="GOA:D5SN62"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN62"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG65989.1"
FT                   /translation="MISIADEEQVETRSAPMLRRIETRSISLLTIGHATVDLCQGLVPA
FT                   MVSYLVLKENYTYFMSASLVFATAAMSSIVQPVFGQMADRLKLHWLLPASVLLAGIPLG
FT                   IGAQSPSYGLLLFALALSGFGIAAFHPEAARQAHLAAGDYRTTAMSYFSLGGSVGFAMA
FT                   PALGWWLLESSGRLGMLWVILPAAIVAALLARQFSMSASPSRQRPHIAIAPAKDDWYGF
FT                   GVLTISVVARSIVFFAINTFLALYWRQRWADSADVGSTGAFDLNVILASGTTILSVFLA
FT                   AGIGGTILGGWFADRFSRRATLITGFGLSMLTFPLMVWSPSMEVGAAMVALTAILFFAP
FT                   ASPAVVLGQEYLPNRVGMASGVTIGLAVSVGGMVVPLLGWLGDVYGLGVVFLLMEVMLG
FT                   FCVVSSIALPNPHFSTRLAKS"
FT   gene            complement(186872..187186)
FT                   /locus_tag="Plim_0138"
FT   CDS_pept        complement(186872..187186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65990"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65990.1"
FT                   /translation="MLTTCLIPTTCDNLRGRLKTESSGLHVAGTPQGSVACGESETDVA
FT                   KDRHVQRNWNFLEPARGEVCPAGVIREGLRQETSPCDFLAGSRESSCQVLEPSLDRGTC
FT                   "
FT   gene            187339..188874
FT                   /locus_tag="Plim_0139"
FT   CDS_pept        187339..188874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0139"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   pca:Pcar_1580 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65991"
FT                   /db_xref="GOA:D5SN64"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN64"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADG65991.1"
FT                   /translation="MNKPVIVVLSCDQQLAVELPSALQGRVDVRACDTTEEVQDLLRTV
FT                   TPQGFVADFRRTSHSGMAEARLLSLLQERFPALRIALVTPDRCPEPLQARVNETDLTHF
FT                   KGRVDSQILAQTFRELADRVAPAEPSTLSRGQTSTNADPQYPAARNTPVSTPRAAITST
FT                   SSTRSAVPAHESAMLDTAAGSISRRFETSSPQLQQMLADLEIAARHDVTIMLIGETGAG
FT                   KTYLSRLIHEASPRRTDPFLPVACGALPDDLIESELFGHMKGSFTSAHADKEGKFIAAK
FT                   RGSLLLDEIDVLGLEQQVKLLRVIETGEFEPVGSNQTLRSQARLIVASNLELQPLVEQG
FT                   RFRPDLYYRLNMLKFNIPPLRHRKVDIVPLARRFVRQFVQKHGVTIREIDPGLFEALLG
FT                   YPWPGNVRELEHVIQRAVIYCRDGVLRAEHLPSHIVGGYAGPTNDPSVDLGHQFVTTAT
FT                   PKQSLEGQIALTEKEIIEQALFKNSFSRTRTAKDLGISRVTLYNKMKRYGIGN"
FT   gene            complement(189098..190543)
FT                   /locus_tag="Plim_0140"
FT   CDS_pept        complement(189098..190543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65992"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65992.1"
FT                   /translation="MDYITLGIIASVAIFLYLAFREYFSAGRGGFHDWVTNPDYRKAAS
FT                   DYFAARAALVIPDDISESEIRGMVERLFVEKDQDFNKERLKLVGIKALPFLIEALEDPQ
FT                   TAVKMFSKDGHAFAEKSPFERICNILEPLAPPSAVGALSRYIVHDNEHFRVYAALAMAN
FT                   IGTAECIPHTLKSLTDQNPQVCTFGMYGIHRGITAQRSEKAFLDAVFPTLIELLTRDDL
FT                   STTRTAPELLLAIDRERATEILISSANLAVDNNRSEYNLLALNNAKVKIPHERLLPFLN
FT                   TVKPLIGKYPHSYEYSAALVSYAINPDSKAQEVIQSELNSTEEVVRRGAGEAIAILHGV
FT                   LDAYGYALNRMDDLGFDDLSSPLKLYLAVRIYDSEVNNGGHTQFFSNSSGGHWMEALKG
FT                   LKEMGAHERAKVLEEAIKLFGASGPSRNDENRHKELAKLVSRHRKLFESLDDRYYSCTE
FT                   DVNVLLAKFAVQNKQHFMKNGTT"
FT   gene            complement(190811..191074)
FT                   /locus_tag="Plim_0141"
FT   CDS_pept        complement(190811..191074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65993"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65993.1"
FT                   /translation="MRDLRVVLIVERPKHMLAQSRKHGTNAYNWRADFAGGIRLEESKR
FT                   AFIEMFLVTLSPSPVGWVKALRNPPMILPFDEDAEQYYRMHQ"
FT   gene            complement(191177..192547)
FT                   /locus_tag="Plim_0142"
FT   CDS_pept        complement(191177..192547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0142"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   scl:sce6068 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65994"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN67"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADG65994.1"
FT                   /translation="MAWLIEQAGSTNPTDSAARVANGWQGIRLCALLWLAPWLLSGCGG
FT                   GTKPPAPAAPVAPPPVAIKTVKPAAPEPAENPPGEAAPVEGEATAGPAMAPPGEHPANV
FT                   FDFVAPGSVNSVTSSTPLPHEIDQFVIAQVADQAGATSFVVTEIPATTETGSSIDASGN
FT                   PANLQGNRLPIGFMSVPGTGLSPDGWPKRIICQYDGSLMAYIPPGPARLGSNDGPANAR
FT                   PEATVLLDGYYINVFETTVAEYKRYRDEMKAKNKNSFAAINETADPRQPVLGIPWGVAS
FT                   AYAKWSGRELPTEAEFEKAARGPDGFRAPWGNTRAIWPEPRTTKTLANVGKFSSDQSIY
FT                   GIYDLAGNAHEWVADWHDDNSHAEAAKSRDGVKNWTGAKKPKITSQHTVKGCLSDWDVT
FT                   AREGRLMTDKFPDVGFRTVLRVGGGNPGQPAATPPNTPNTKPANPNRPPNPPRNNAF"
FT   gene            complement(192751..194586)
FT                   /locus_tag="Plim_0143"
FT   CDS_pept        complement(192751..194586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_5635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65995"
FT                   /db_xref="GOA:D5SN68"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65995.1"
FT                   /translation="MTATPPEETIRAATTSSEPVTELAPHPGVASMPRWDLGDLPAPPV
FT                   FKLRNVAGFIGPGIVLGASAIGGGEWLTGPLNTARFGGALLWLSTISILCQTLYNIEIS
FT                   RYTLYTGEPIFTGKFRLFPGPLFWLSFYLLLDFGSFLPYLASNAAIPLLGLYLGYVPDS
FT                   KEYEWYLKLLGCLILVGVMLPMSVGGKVYHSLKAVMVFKLIFVVSFLLILAVWFSTFET
FT                   WREIGTGFFQFGNIPVVAENDLNGNGIQDADEQPLGPNVKNVFIEFFGGRGFPVIDLSV
FT                   IGILATMAAISGNGGLTNTPMSNYTRDQGWGMGRHVGAIPSFVGGHEIALSHVGMVFRQ
FT                   TKENLAHWKGWLKHVRREQLMIWMPACFIGLALPSMLSVQFLPRGTVLVDKWASAGMTA
FT                   NGVAEAVSGVPAARLFPQAAVISKGGTQTPEAAPSSETQAAEDAKLPPITGSQRAWGKT
FT                   FWALTLFCGFLVLATSCASTAEGTLRRWVDVTWTASSHMRKIDPKHIGTLYFIVLWVYT
FT                   GVGIFMLLTIKGDSLLTFAGMLYNYALGVSCFHTLFVNAFLLPKAIRPGIAVLTGLFLG
FT                   GTFFMFIAILATYAEWGNIMKLFSPVKATVAFWFS"
FT   gene            195137..196534
FT                   /locus_tag="Plim_0144"
FT   CDS_pept        195137..196534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0144"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: rpc:RPC_1626 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65996"
FT                   /db_xref="GOA:D5SN69"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN69"
FT                   /inference="protein motif:PRIAM:1.3.99.22"
FT                   /protein_id="ADG65996.1"
FT                   /translation="MTTNTVLPAETLPVLNPESPATGGCDDIQLDPPKAQTTEVGSYFI
FT                   SNYPPFSLWQSSNLPRLKEVMAAPPASKAPLGLYLHIPFCRKRCKFCYFRVYTNQNAKA
FT                   IEQYVEALAREVELVSQLPAIQGRKLKFVYFGGGTPSYLSSKQLRFLREKLSAHISWDD
FT                   AEEVTFECEPGTLHEEKVATLKDIGITRVSLGVENFNDQILEENGRAHKTPEVYRAYEW
FT                   IQKAGFPQVNIDLIAGMIGETDENWAMNIREARKLAAQNVTIYQMELPFNTIISKEMKE
FT                   LGTASPVADWATKRRWVSEAMDALGEDGYHISSGNELVKNPTTDQFVYRDNVWRGCDLL
FT                   AIGVSSFGHLQGVHYQNLDRIEDYLATVERGELPVNRALEPTPHQRLIREWVLQMKEGQ
FT                   VSAAPFIDKFGINPLEEFRTPLANQAARGYLVVEEDRVRLTRKGLLQVDSLLPEYFEPE
FT                   HRAVRYT"
FT   gene            196602..197138
FT                   /locus_tag="Plim_0145"
FT   CDS_pept        196602..197138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65997"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65997.1"
FT                   /translation="MNALHSLDALMNPFRSAAPLFIKAVHLPQAVTPEPYAGLLVHHEH
FT                   MTVAMENFHKDRVDVEVLDRHLEGPILYRKIILRCSTSGVVVQFGLVRFDLRTVSQQVR
FT                   DEIMAEEIPLGRILINHNLLRHVDLNAILELSLGEELAALMEVPAGTTTYGRLATLFCD
FT                   HQPAVDLLEVSRPLG"
FT   gene            197245..198054
FT                   /locus_tag="Plim_0146"
FT   CDS_pept        197245..198054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65998"
FT                   /db_xref="InterPro:IPR041261"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG65998.1"
FT                   /translation="MAIVTWVFEPNIFPETHQPIRKAVRDGGHCLIEWSDAWWTDGVPS
FT                   NVPNSSVVFHGSLGNAARITSELQWTPGAFCSVEAFRCSAWYESARQWLVHRDWTICPA
FT                   SELVANARKLADKLGATDRVFVRPDSPLKPFSGRVVDVASLTLAKLDYGFYYDDETIPV
FT                   VVAPVQSIGNEWRFVIADRSVIAGSAYDPKTRNPVIAALNSAPAEFATIVASSIPEPEI
FT                   VYILDICECNGELRLLELNPFGGADLYACNATKVVEVVSSIAENETK"
FT   gene            complement(198157..198501)
FT                   /locus_tag="Plim_0147"
FT   CDS_pept        complement(198157..198501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0147"
FT                   /product="Arsenical resistance operon trans-acting
FT                   repressor ArsD"
FT                   /note="PFAM: Arsenical resistance operon trans-acting
FT                   repressor ArsD; KEGG: sea:SeAg_B2122 arsenical resistance
FT                   operon trans-acting repressor ArsD"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG65999"
FT                   /db_xref="GOA:D5SN72"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN72"
FT                   /inference="protein motif:PFAM:PF06953"
FT                   /protein_id="ADG65999.1"
FT                   /translation="MSTLQIFDKALCCSTGICGPQVDPVLPQFAADLDWLKSRGVAVER
FT                   FNLAQQPMAFAANEVIRELLATEGPEVLPVTVIDGEIKSRSRYPSRRELGTWAGISSPL
FT                   LTPLPMLSPE"
FT   gene            198769..200559
FT                   /locus_tag="Plim_0148"
FT   CDS_pept        198769..200559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0148"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   scl:sce6207 carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66000"
FT                   /db_xref="GOA:D5SN73"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN73"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ADG66000.1"
FT                   /translation="MGMLGILIGAAILLYAAWRLYGPVLARLLELDNNRPTPAVTQCDH
FT                   LDYEPIEPNALLSQHFSAIAAAGPIVGPIVAGIAFGWLPAILWILVGAIFVGGVHDITA
FT                   LVASIRHKARSIAEVVREHMSRRAFLLFLSFVWLALVYIVVAFTDITARAFVGQLDLGN
FT                   GEVVSGGGIASSSLIYLLIPIIMGVTMRYTKLSLGWATIIFLPLVGLSVYVGQLIPLDM
FT                   ESLMLRFGWATTADEAKWAAIITWDLLLLFYCCLASIAPMWLLLQPRGHLGGYFLYVAL
FT                   IGGAAGLIVGSLLNQQPIQYPMFRGWQPPEAGNFVFPMLFILIACGACSGFHALIASGT
FT                   TSKQLRVESDARVVGYGAMLLEAMVAILSLACVMRLSQTDPLLTSGKLEPNVIYATGLG
FT                   SFLQTFGIPASLAVSFALMAFTTFVYDTLDVCTRLGRYIIQELTGWQGWGGRWFGTIIS
FT                   AAAPAFFVTQQVTNLQGKVVPSWEVFWPLFGASNQLLAALTLLGVTVWLWQTRRAAWVW
FT                   IVTGLPTVLMYTMSLWALGVMTSGTWQQIQKAEKVAPVSYVIITVSSLLIVLALLMLIE
FT                   AIMALTTNNKERAIPVTTPA"
FT   gene            200966..201982
FT                   /locus_tag="Plim_0149"
FT   CDS_pept        200966..201982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0149"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: csa:Csal_0473
FT                   trans- hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66001"
FT                   /db_xref="GOA:D5SN74"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN74"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADG66001.1"
FT                   /translation="MTMSKPPVLDQPIQGGSLLAALDSLLADDLAAVERILWNELESDQ
FT                   PCVKDILQHATRFRGKRLRPILVLLSARACGEVNETHRLLAAVVEMIHIATLVHDDVLD
FT                   EASTRRHVATVNARWNNETSVLFGDYLFTHAFHLASELPTSHACRIIGRATNKVCEGEL
FT                   TQIHERGNLDLNEETYFKIINGKTAELTAVSAYLGAHYADQPAEVVNAVEAYGRKLGLA
FT                   FQIADDLLDILGVEKKTGKTLGSDLKKQKLTLPIIRLLATATSADATIIRELLAHPEDD
FT                   TAGQLREYLHKSDALEYTSQTAHKLVEEACEHLNVLPESQARHWLCEIARFSVERSF"
FT   gene            202173..203240
FT                   /locus_tag="Plim_0150"
FT   CDS_pept        202173..203240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0150"
FT                   /product="exonuclease of the beta-lactamase fold involved
FT                   in RNA processing-like protein"
FT                   /note="KEGG: ppw:PputW619_1135 exonuclease of the beta-
FT                   lactamase fold involved in RNA processing-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66002"
FT                   /db_xref="GOA:D5SN75"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN75"
FT                   /inference="similar to AA sequence:KEGG:PputW619_1135"
FT                   /protein_id="ADG66002.1"
FT                   /translation="MAGRSHNEYLLRPTAAGLYCEKGGFYIDPVAPVAKAIITHAHGDH
FT                   ATRGHASYISSSRGAALVRHRVGAHAKITSWEYGETYRMNDVLVSLHPAGHILGSAQVR
FT                   IEWRSTRGTEVWVVTGDYRREPDPTCEPFEVIRCDTLITEATFARPQFVWPTTQSQLDR
FT                   LEQWWQGNQQRGFASFLYVYALGKAQRILAALNPDCGPIFAPKVVRDISQIYRDAGVAL
FT                   PCERDPFVEMTPELWSRALIILPPSSKRPLMIPTAGSSATAFASGWMLDPEEQQRRQVD
FT                   AGFVISDHPDHLEILRTVEETCARRVFATHGETGWLCETLNSRGIEAHDLDSLRVARGA
FT                   RPGESWWRPVNDQPQ"
FT   gene            complement(203431..204027)
FT                   /locus_tag="Plim_0151"
FT   CDS_pept        complement(203431..204027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66003"
FT                   /db_xref="GOA:D5SN76"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66003.1"
FT                   /translation="MKWAKRLAILSIVVVLSGIAYYRYQYPLGLKKYYYPYGWSHCCDK
FT                   ALMLALFQYAERNEGWYPRGEDSAEASLSLLHLDDPKSADANLLRGKTVDESLVQARLA
FT                   AGQLLTPNTCGWHYIPGLRKDDNHRIALFWDKVGLGHNGERLPEGGHWVCFVGTAIEYI
FT                   PGTQWPDFLAEQERLRSALRRTDVKPEPSDAAESR"
FT   gene            204379..204534
FT                   /locus_tag="Plim_0152"
FT   CDS_pept        204379..204534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66004"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66004.1"
FT                   /translation="MERRNLLGSAVAFVFQRFARFREWYCLSRPSAGWWEDVGVVISDQ
FT                   PLSTGK"
FT   gene            204712..205101
FT                   /locus_tag="Plim_0153"
FT   CDS_pept        204712..205101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0153"
FT                   /product="anti-anti-sigma factor"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bpa:BPP2249 putative anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66005"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN78"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADG66005.1"
FT                   /translation="MNEDLARMTHPNDDFRLEWHGNTVVITPTGNVEGMNWELIEQAAE
FT                   VVLGPIREQHAAPMVVFDLAQMNYFGSVFLALLLRCHKNVRSRGGELVLCGLSETAREL
FT                   LKITALDTVWAIYDSKEAALKAVDN"
FT   gene            complement(205231..206832)
FT                   /locus_tag="Plim_0154"
FT   CDS_pept        complement(205231..206832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0154"
FT                   /product="HTTM domain protein"
FT                   /note="SMART: HTTM domain protein; KEGG: bba:Bd2937
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66006"
FT                   /db_xref="GOA:D5SN79"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN79"
FT                   /inference="protein motif:SMART:SM00752"
FT                   /protein_id="ADG66006.1"
FT                   /translation="MSQLSHDSAIVNSTRSISELLRQQKEQLNEFFFAKESPIGVALTR
FT                   IVICATVFIVMLDRWKYVREIYSTDGAPAQISVNFGFGELFPVFSGSVVAALFAIMLFA
FT                   LLTAMVGWKTRLSLIVANLLFIYFCNIDYVTTLTKYSVIATHILLLLTLSRCGDVFSVD
FT                   AWLKRTAPANPWLGRTIEDLPQGYAWPRRCIQIMIGTVYFGAAITKIHTPTFFSGDQLQ
FT                   WWMLTELNYEHPVGAFISMYPAVIVVMCYIAVIWEIMFIVLAWRGVPRMIFLTLGVIFH
FT                   AATFFTLGLLSFPPVCFACYLAFMNDNDARWLASHGRWIMRKFHLRNWIAPLNATAAIK
FT                   AFSIQSPQVQTSPATGYARVVRQTGLWGACCACLALMGVATEYQVDRYGVRRPEGPMVL
FT                   EPMDQAVAKKFLSPAPKFREVDKFFAIDVGTLLVADQLAIRKQYYQIGETMIVQCQLLP
FT                   PHEDMYLECLILNEEGQIEGVQELVATREMNRANFNWPLCENVQSGRHQIVIRSAGQEI
FT                   ARRTFFVNGETCDVKK"
FT   gene            complement(207004..207669)
FT                   /locus_tag="Plim_0155"
FT   CDS_pept        complement(207004..207669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66007"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66007.1"
FT                   /translation="MAKRLAIGFMSVYFSMLSLGVLAHTFGVGNVSSPLMYYFVWDMFC
FT                   GWSAHEYRYHFIAEGESGTYYDVTHGPWGDVQLFGSPTRATYDSVGNAFGPIAMNVLKH
FT                   TQHEPIQCVHIIEEAWPKKYNIPDYLWASRFEEPKEKFSYHTRRMIVNPDSTVIVDQPN
FT                   YPSWLYAQTVHANPRLQADSRRGKPFYAVNPELRQSAFSYSQGTSDSGIQRTGYSTSE"
FT   sig_peptide     complement(207598..207669)
FT                   /locus_tag="Plim_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(208161..209369)
FT                   /locus_tag="Plim_0156"
FT   CDS_pept        complement(208161..209369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0156"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   afw:Anae109_0728 general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66008"
FT                   /db_xref="GOA:D5SN81"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN81"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADG66008.1"
FT                   /translation="MPEFQYVARELSGRQIVGTLSAQSEREALQSLAAKSLFTVKIAPV
FT                   QSTQVEQRLASRRVPPRMLATLFSQMSDLLRAGVPLLRSIELLERQTKNQALKRVLEDV
FT                   RSRVADGGRLADSMKEHPNAFNKLTVSIVHAGEEGGFLEDSLSRVAVFTEHQEELKSKV
FT                   VAAMSYPLVLMVLGTIVVVGMIVFFVPGFEPMFDSMKQTGSLPWATTVLLAISNILQRW
FT                   WWAVLLAIGAAIAGVQYGLATPEGQILLDKVKLRAPGIGYVTRSLGISRFCRVLGTLLH
FT                   NGVPLLQALNIAKDATGNRVLSDAIAKAAENVSSGKTLAQPLAASKQFPTDVLEMIAVG
FT                   EEANNLENVLIGVADKMEKATNRQLDLVVRLLEPLMLVVMAGAILFLLIALMLPIFQSS
FT                   GVV"
FT   gene            complement(209587..210339)
FT                   /locus_tag="Plim_0157"
FT   CDS_pept        complement(209587..210339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0157"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: kpe:KPK_4783 5-nucleotidase YjjG"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66009"
FT                   /db_xref="GOA:D5SN82"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN82"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADG66009.1"
FT                   /translation="MLKWIFFDIGNVLFNDDQQAFFGYLSLFEALRETNPQQTFSELMS
FT                   AREAEAKRGQQWIISRLAKSRLTPERYSTWSQYVSNELRNRYDEFHLLNPHAFEMLQEL
FT                   RAQYRLGIIANQTTACRPSLERRELMEYFDLIGISDELGCSKPDRQIFEWALNEAGCHP
FT                   GESLMIGDRVDNDMLPASELGMQGLLVHWSSFERKLWQPQDRLAREFLASCTNVPLFPH
FT                   GLVDFDRYPCVNNLGEIPEKIAEMEQSV"
FT   gene            complement(210346..211473)
FT                   /locus_tag="Plim_0158"
FT   CDS_pept        complement(210346..211473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0158"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: ade:Adeh_2613 lipid-A-disaccharide synthase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66010"
FT                   /db_xref="GOA:D5SN83"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN83"
FT                   /inference="protein motif:TFAM:TIGR00682"
FT                   /protein_id="ADG66010.1"
FT                   /translation="MNLSWIHGVQSGADRSLRARLLRSCLWVLSLGYGFVVLCRNVAYQ
FT                   TGWLRSRRLPAFVVSVGNITTGGTGKTPLVGWVVQALHELLLSEKPDNQAQIAILSRGY
FT                   GATQAGSNDEKAVLDRICPGVPHLQNRQRARIAAEWLASLLPAQTLKRPAIVVDDGMQH
FT                   RQLARDVELVVIDATHPFGYGYLLPRGMLREPLSQLMRADWFLVTRSEMVSQQQLSSLR
FT                   EKLLKFVPEDRILEVEFRPSRLINIQGETRSLSDLESVAYLPFCGIGNPTGFVQLLKHW
FT                   LPAASAQMKGTLQIFDDHHHYTPPDLDELGLLANAHGARWLLTTMKDLVKIPQASSHGV
FT                   EFWAVEIAPHFREGDERLRQYLKDRYESLNRSLVD"
FT   gene            complement(211666..213201)
FT                   /locus_tag="Plim_0159"
FT   CDS_pept        complement(211666..213201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0159"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: gsu:GSU0489 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66011"
FT                   /db_xref="GOA:D5SN84"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN84"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADG66011.1"
FT                   /translation="MLARLMTYSLLGIDAVAIDVEVDISPGALPKTTLVGLAEAAVRES
FT                   THRIERALVNSGYQRPVDHTVINLSPADLPKDAASFDLPIALGMLVASGQLESDLLQEF
FT                   DAVGELALDGSLRPVKGVLSMALSCRQKGRRGLIVPAANVQEAAVVEGIQVIPAGSLTE
FT                   AAGFLTGHLTIEPAPFSWTKAQQEYGQYTVDYADVKGQESAKRAVVVAAAGGHHLLMIG
FT                   SPGTGKTLLASRLATILPPLSPDESLETTRVYSSVGRLQPGQPLLMNRPFRTPHHTISE
FT                   AGLVGGGSVPTPGELSLSHHGVLFLDELPEFNRKTLEVLRQPLEEGRVTISRALASLTF
FT                   PASIMLVAAMNPCPCGYRGDPRKQCNCTPIQVERYLGKISGPLLDRLDIHIEVPPVPFR
FT                   DLSDAQPGTSSDQMRSQVISAREIQQERAKQGGQPLNARLAPQQLRKFCKLKKDAEQLL
FT                   QHAMESMGLSARAHDKLLRISRTIADLEGTAQIEAHHLSEAINYRALDRTYWR"
FT   gene            213763..214851
FT                   /locus_tag="Plim_0160"
FT   CDS_pept        213763..214851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0160"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66012"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN85"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66012.1"
FT                   /translation="MKKNRGFTLIELLVVIAIIAILIALLLPAVQQAREAARRTQCRNN
FT                   LKQLGLSLHNYHDVFGTFVFRRGGTGGQWDAVPRNNNERRSGVISLLPYMDQAPLYNRI
FT                   EAGDLTGTTNGGTAVGPGGNQAWTSGPGGGWSVWNVAVNGLQCPSDSFSGSVGCNNYMF
FT                   SLGDSVNNAENLRDVRGLFGYASTFGVRDCTDGTSNTIAMAERCKGNQAPATNSNRRAI
FT                   TGTAMNKTGIAANPLQCRNLAVNGVYAAAENVKERAATCWTDGRLERSGFQTVLPPNGT
FT                   SCAEGGDTNADSATAIITPTSFHTGGVHALMADGAVRFISENIDTGNLATGPATGNPSG
FT                   PSPYGVWGALGTRAGGEVTNEF"
FT   sig_peptide     213763..213864
FT                   /locus_tag="Plim_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.961 at
FT                   residue 34"
FT   gene            215149..216234
FT                   /locus_tag="Plim_0161"
FT   CDS_pept        215149..216234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0161"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66013"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN86"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66013.1"
FT                   /translation="MSRRRRGFTLIELLVVIAIIAILIALLLPAVQQAREAARRTQCRN
FT                   NLKQLGLALHNYHDVFGTFVYRKGGTGAYGATPQQNSGRRSGLVSLLPYIDQSPLYNRI
FT                   EAGDLAGTSYGGTAVAPGGPHGWASWSTWNVSIPGFQCPSDAYATPVSTHNYMFSVGDT
FT                   IQDPNNTGTSNHDLQNVNGLFANRRCLGVRDITDGTSNTIAMSERCRANFGLATNSNRL
FT                   VVEGQAMNKTGLQANPLQCRSIATNGRYNAAEEVKGYSGTRWTDGQIERCGFHTVLPPN
FT                   SPSCAEGNNGNADSPVSVITPTSRHTGGVHALMADGAVRFISDNIDTGNLATGSTIGGP
FT                   SPYGVWGALGTRAGGETTGNF"
FT   sig_peptide     215149..215253
FT                   /locus_tag="Plim_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.960 at
FT                   residue 35"
FT   gene            216796..217887
FT                   /locus_tag="Plim_0162"
FT   CDS_pept        216796..217887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0162"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66014"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN87"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66014.1"
FT                   /translation="MVRLRRGFTLIELLVVIAIIAILIALLLPAVQQAREAARRTQCRN
FT                   NLKQLGLSLHNYHDVFGMFVYRKGGTGGSTNPAPRQNQNRRSGFVSLLPYFDQAPLYNL
FT                   IEAGDPSGTSFGGNPVAPGGVAGWEGWGPWNVSLAGLQCPSDPYPTPLSSHNYMFCVGD
FT                   TIQDPNNTGTSNHDLQNVNGLFANRRCFGVRDVTDGTSNTIAMSERCRADFGYTANSNR
FT                   LVVEGMAMDVPAGTLRTNPLQCRTLATNGRYPTGNSKGRSGTRWTDGQIERCGFHTVLP
FT                   PNSPACAEGTNTNADSPVSVVTPTSRHTGGVHALMADGAVRFINENINSGDLATGSTIG
FT                   GPSPYGIWGALGTRAGGESTGDF"
FT   sig_peptide     216796..216900
FT                   /locus_tag="Plim_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.950 at
FT                   residue 35"
FT   gene            218108..219685
FT                   /locus_tag="Plim_0163"
FT   CDS_pept        218108..219685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0163"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: GMP synthase domain protein; ExsB
FT                   family protein; glutamine amidotransferase class-I; KEGG:
FT                   gur:Gura_3123 bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66015"
FT                   /db_xref="GOA:D5SN88"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN88"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADG66015.1"
FT                   /translation="MTATVQPDAATSLQSELVLVLDFGSQTAQLIARRIRDLNVFCQLV
FT                   RHDISAERVKELAPRGIILSGGPASVYGEKAPKCDPEIFNLGIPVLGICYGMQLTCQAL
FT                   GGVVRAGTTREFGRTELTTLEDHPLVAGLPATSTVWMSHGDQVQQAGDEFIPIASTHSC
FT                   PMAAVRHRSRQIFGLQFHPEVTHSEYGKQLLENFLRKCCGCAGTWQIESLIEQQVTAIR
FT                   ARVGNSRVICGLSGGVDSSVVAALLYKAIGSQLSCIFVDNGLLRKGECEKVRERFQNHF
FT                   KTDLHVVDASHRFLSELAGVVDPQQKRKIIGRVFIEVFRKEAESITDARFLAQGTLYPD
FT                   VIESGGSPDGPAATIKYHHNVGGLPEQLGFELIEPLRDLFKDEVRRMGLALGLSEELIW
FT                   RHPFPGPGLGVRCLGGITSERLHALREADAIVLEELRKAGLYRTIQQAFAVILPVQSVG
FT                   VMGDGRTYEETIAVRAVTTDDFMTADWYPLPYDLMRIISTRIINEVRGVNRVVYDISSK
FT                   PPSTIEWE"
FT   gene            219682..219987
FT                   /locus_tag="Plim_0164"
FT   CDS_pept        219682..219987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66016"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66016.1"
FT                   /translation="MITGSLSLPAQKTALAVFFVYGLKRFFQMKTSGNVLFKPIDGIDS
FT                   FLSANRFNLWVAARPQHSSVRCQFSPFERNHLDFSWGSSQEDVAKSPPRDLAQRLP"
FT   gene            220077..220403
FT                   /locus_tag="Plim_0165"
FT   CDS_pept        220077..220403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66017"
FT                   /db_xref="GOA:D5SN90"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66017.1"
FT                   /translation="MLKTLYGDENGAIISAELVLVLTVLVLGVIVGLSEVAVAVNTELN
FT                   DLSNAIGRLDQSYCFTGFKAYSYGKLKSHVSGSSYKDSIDDCDVNGSCELVCGANSVGY
FT                   SEGN"
FT   gene            complement(220647..221819)
FT                   /locus_tag="Plim_0166"
FT   CDS_pept        complement(220647..221819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0166"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; KEGG: mfa:Mfla_1003 peptidase
FT                   S1C, Do"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66018"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN91"
FT                   /inference="protein motif:PFAM:PF00595"
FT                   /protein_id="ADG66018.1"
FT                   /translation="MARRIKSAIRKPILWINTFKAVEHRWCSRLLIAGVFCWQVDSAWG
FT                   QLPALSVIPGLTQAKVVVTQNGAPFSATPDEEDDLPEFQPEPPVSALAPVYARPLTAPE
FT                   REALQQQVTQLFSQLDHPDFVTRERAEESLAALTPRAVSTLPETWNTASLEAKVRLANV
FT                   LKTWMATADDHSLEQICDLLENLEQVSNSTLAISKAAMRQHEQRTSELAIRQFEKLGGV
FT                   IEKQVGVFGLRGRIQANEADEEDFKRYAVIGRGYKGGDAGLHYLTRIPRLDLVYYVKSA
FT                   AITPRALAELQGDLPGLQIQERGLAYLGVTSNQGETPMRLSIVKAGSPADKAGLKEEDL
FT                   VLRFGGQEVSTFDHLVKLIGEKSPGDKVEVDILRDGQRKQLIVELGEWSK"
FT   gene            complement(222093..223586)
FT                   /locus_tag="Plim_0167"
FT   CDS_pept        complement(222093..223586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan ppg4"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66019"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66019.1"
FT                   /translation="MPASAKSNRTPPATSTSKSGKPKSGQTTAGKAMKGKSSGIRAGSR
FT                   TGTKGAPAAAKSSQEVRNGTKPGSRQSTAKQVSRSTTVKSSTASKPKAVTNTGASLQAT
FT                   GTTQKVKTTPSRSSAKLIPASKSKRSPAAMSSEADSRESSKQVNSKRVAAASRRTANPA
FT                   SSKTAPSSASKSTTQNSTLAVGSSKSSLQSTATSSMAKNKPTPVVAREPKKLSGTTNSK
FT                   LKSASPIHSEVGNGEHECLNSPHDMIEARPLNPQWLQIRWSLSKATLHRAMSAMAESWH
FT                   TAKPTLRLLDVTDNDSVVCSNSIVRDIVVGSRDHLWFTHVDGPGRSYRIVIGFSSGAKF
FT                   HPLAKSSTVHMDEAIAQHGKASESNGNSLLDWPVTTAEGRLNQNELTDSQLASLAAHHS
FT                   RENSAGALLSSFQLNLESELIVHGTTHPLAILTLMGKPTPVSPEGRFQLRMKLLPGRQV
FT                   IPAVAIDPNGGEERTVVLAIDISSRELEPRNYDDPNNAS"
FT   gene            224117..224440
FT                   /locus_tag="Plim_0168"
FT   CDS_pept        224117..224440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66020"
FT                   /db_xref="GOA:D5SN93"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66020.1"
FT                   /translation="MPKTGSTNASSQRGLSPLAVGYLWASRVGNMGLQMALPALAGYWI
FT                   DLQWLTRPVFTISGAVLGFALFMLKLLALAKELSKSSSQAGLGASSSSKSDSQQKAGPR
FT                   NSI"
FT   gene            224631..225104
FT                   /locus_tag="Plim_0169"
FT   CDS_pept        224631..225104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcm:Bcenmc03_3368 protein of unknown function
FT                   DUF395 YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66021"
FT                   /db_xref="GOA:D5SN94"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66021.1"
FT                   /translation="MVVNLSRGVLVGLQVGLLLFAALVGGGLVGGLLQSQGSQNWREVL
FT                   IAGLICLVPSLVSVVWNEWLVVGRHSQNVKAAPSGAASSVQAMSALGGMGLRMGAVAIG
FT                   IVLLPKIFSDWQTKPFFYSVLVVYVLLLVIETSFLLYGLKHFASLPRASSENL"
FT   gene            225203..226222
FT                   /locus_tag="Plim_0170"
FT   CDS_pept        225203..226222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0170"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   ade:Adeh_4340 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66022"
FT                   /db_xref="GOA:D5SN95"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN95"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ADG66022.1"
FT                   /translation="MSADHNDYFHHISDALEFEMPEFVYSFIDRGYFHLPKIFSFQITK
FT                   FMVMQVLAAVLVYLIFRGLAKQVANGEPARGRWWNFWETLAVFVRDEVVRSSISEPHAH
FT                   HDDHGHGQTHAQANYHAQAYVDAGQTHVHGHVQPQLAAVGGHVMATSIDESKDLASTGT
FT                   HYADRFLPFIWSLFFYILFCNLLGAFPLFGTATASTSVTGVLALSVLVVTIGAGIKQSG
FT                   AVGFWKSLVPSMDIPGIIGPPLKALIFVIELAGLFIKHTVLAIRLFANMLAGHVVIAVF
FT                   LSFIAATANSGILWYAVTPASIFGQLAIGALELFVAFLQAYVFSLLASLFIGAAVNPH"
FT   gene            226377..226667
FT                   /locus_tag="Plim_0171"
FT   CDS_pept        226377..226667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0171"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: ank:AnaeK_4475 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66023"
FT                   /db_xref="GOA:D5SN96"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN96"
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /protein_id="ADG66023.1"
FT                   /translation="MQVLSLMTRILGAFCVLAVPAMAQDGGAASGPIVVKAIGVGIVIL
FT                   GAGLGIGKIGSSAVESIARQPEAAGAIQTAMIIAGALIEGATLFGLIICML"
FT   sig_peptide     226377..226448
FT                   /locus_tag="Plim_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            226971..227687
FT                   /locus_tag="Plim_0172"
FT   CDS_pept        226971..227687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0172"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   afw:Anae109_4485 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66024"
FT                   /db_xref="GOA:D5SN97"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN97"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ADG66024.1"
FT                   /translation="MYAQACQVTFQSSTARRSGWLWSLCFCAMAGLLLQGSISVADEKA
FT                   KPDHGSETASTTGHGHSEDAHSSQGSTIPSGMIPKPDLMVWSLITFVAFVFLLSKFAWK
FT                   PLAAGLDQREARIRNDIQEAESARLKAQQLLAEHEARLAKTEETVRELIAEAKRDAEKV
FT                   RVDLTAAAEADVQTMKKRAVSEIEQARDVALQQLFDTLSTHVMDATSRIVGRSLNSDDH
FT                   QRLVQEALAELNVRRN"
FT   sig_peptide     226971..227096
FT                   /locus_tag="Plim_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.737 at
FT                   residue 42"
FT   gene            227768..228397
FT                   /locus_tag="Plim_0173"
FT   CDS_pept        227768..228397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0173"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: afw:Anae109_4498 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66025"
FT                   /db_xref="GOA:D5SN98"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN98"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ADG66025.1"
FT                   /translation="MQEPLVTRIPSVLDDPSSLGVARVYAEALLGAAGDQASEVVEELE
FT                   LFTKTLLNGSTGLEEVFANQALGRDEKLAFVEKTFTGRASEVLVRFLQVLAQHDRLDLV
FT                   RAVSHVAALELQKKLGRKQVQVTSAAPLSPQEYEAVVNRLKETLGLEPQVEVKVDPELV
FT                   GGLVVRVGDMVYDGSLRTRLEQLRAQLRERCLNEIQRGRDRFCYSA"
FT   gene            228354..229865
FT                   /locus_tag="Plim_0174"
FT   CDS_pept        228354..229865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0174"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: sfu:Sfum_2584 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66026"
FT                   /db_xref="GOA:D5SN99"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D5SN99"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ADG66026.1"
FT                   /translation="MKFNADEIASVIQREIQDFRGQIQTNEVGTVVEVGDGIARVYGLT
FT                   NAMSGEMVEFSSGVRGQVFNLEENSVGVIILGSYLKISEGDEVRATGQLLSIPVGDALI
FT                   GRVVDPLGNALDGRGPIIAESSRPLETTAPGVAARQPVKQPMQTGIKAVDAMTPVGRGQ
FT                   RQLIIGDRKTGKTAVAIDAIINQKGGDVICIYVACGQRASSIGGVVEALKAAGAMDYTI
FT                   VVAAGASDPAPLQYIAPYAGAAIAEYFMYQGKHTLVVYDDLSKQAVAYRQLSLLMRRPP
FT                   GREAYPGDVFYCHSRLLERAAKLSDELGGGSMTALPIIETLEGEVSAYIPTNVISITDG
FT                   QIYLEPDLFFAGVRPAINVGISVSRVGGNAQTKGMKKVAGSLRLDLAAFRELEAFAQLG
FT                   TELDAATQKQVDRGYRMVELLKQPQYVPLAAADQIVSIYAGTRGYFDSVPVNQVAEAEK
FT                   QLLEYVRLEHAAFRENLISSKTLDDAQEAQLKTILEGFKKRWQPK"
FT   gene            230003..230896
FT                   /locus_tag="Plim_0175"
FT   CDS_pept        230003..230896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0175"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: mxa:MXAN_6925 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66027"
FT                   /db_xref="GOA:D5SNA0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA0"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ADG66027.1"
FT                   /translation="MAKARAIVKRLKAVRNIKKITRTMELVATAKFKKAMERALEATAY
FT                   TRKLAEIVADVSASLGESGEESAVSHPLLAVRPQVKKRLLLVITSNRGLCGGYNAGVLR
FT                   VAGQLLRSRDLAVSLDMEVSGKRGINFYKFQRQPVVRTYTQFEDKPTFAQIEEIANRIM
FT                   DQYIAGEIDQFDVAFMQFQGIAKQKPVVETLLPIGNLESESTATEADATTDYEFLPSPE
FT                   EILGEIVPASFKARLFKCFLDAAVSEQVFRMVAMKGATESANDMIKSLKQRYNRARQSQ
FT                   ITSELSEIIGGAAALE"
FT   gene            231038..232483
FT                   /locus_tag="Plim_0176"
FT   CDS_pept        231038..232483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0176"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: ATP synthase F1, beta subunit; K02112 F-type
FT                   H+-transporting ATPase subunit beta; TIGRFAM: ATP synthase
FT                   F1, beta subunit; PFAM: H+transporting two-sector ATPase
FT                   alpha/beta subunit central region; H+transporting
FT                   two-sector ATPase alpha/beta subunit domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66028"
FT                   /db_xref="GOA:D5SNA1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA1"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ADG66028.1"
FT                   /translation="MSTAVANHVGRVTQVIGSTFDAEFAEGSLPPIYNAVKVDVEIKGT
FT                   RVKVVGEIQQHLGGGRVRCVALGSTDGLARGVEVIDTGAPLSVPVGKGTLGRVFNVLGE
FT                   PIDGRGEVAAEDHWPIHRDPPKLEDLSSKTEIFETGIKVVDLLIPFVRGGKAGLFGGAG
FT                   LGKTVILQELIARIASTHGGYSVFAGVGERTREGNDLWLEMQETQIGSTGRAVIEQTCM
FT                   VFGQMNEPPGARLRVALSALTMAEWFRDTTGADTLLFVDNIFRFSQAGSEVSALLGRMP
FT                   SAVGYQPTLSTELGALQERITSTKRGAITSVQAVYVPADDPTDPAPATAFSHLDAFIYL
FT                   ERKIAEKGLYPAIDPLASSSRILDPQIVGERHYACARRVQKILQRYRELQDIIAILGVD
FT                   ELSEDDKLVVKRARRIERFLSQPFFVAEAFTGKKGSFTTLADTIRSFEEICDGKWDDLP
FT                   ESAFMYVGAIEEAVAQAEKMAKA"
FT   gene            232627..233028
FT                   /locus_tag="Plim_0177"
FT   CDS_pept        232627..233028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0177"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: dal:Dalk_3625 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66029"
FT                   /db_xref="GOA:D5SNA2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA2"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ADG66029.1"
FT                   /translation="MALGDSLRLTVVTPEKPVIDQVVRSVQFPLADGMTGVLPGRAPLI
FT                   GRLGYDELVFIDDSGESRYFVDGGFVQIAQNVVTILTSSCRPLASLTRDEASKVLDAAL
FT                   TKKATSDNEVSQRQKEQNRARRMLALADQ"
FT   gene            complement(233232..233597)
FT                   /locus_tag="Plim_0178"
FT   CDS_pept        complement(233232..233597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0178"
FT                   /product="ribosomal protein L19"
FT                   /note="TIGRFAM: ribosomal protein L19; PFAM: ribosomal
FT                   protein L19; KEGG: bsu:BSU16040 50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66030"
FT                   /db_xref="GOA:D5SNA3"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA3"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ADG66030.1"
FT                   /translation="MQHKLLQAAEASSLRTDALEFEIGDTVDVHQRILEGDKERIQIFN
FT                   GVVIARRHGGTRENFTVRRIVAGEGVERTFPIHSPKVAKIVVKRHGKVRRAKLFFLRDR
FT                   VGKATRLTERLTKKGDE"
FT   gene            complement(233685..234422)
FT                   /locus_tag="Plim_0179"
FT   CDS_pept        complement(233685..234422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0179"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="KEGG: tRNA (guanine-N1)-methyltransferase; K00554
FT                   tRNA (guanine-N1-)- methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66031"
FT                   /db_xref="GOA:D5SNA4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA4"
FT                   /inference="protein motif:TFAM:TIGR00088"
FT                   /protein_id="ADG66031.1"
FT                   /translation="MRFDVLTLFPGIFAGYLQQSLLNKAIEAGKVGVHLWNFREWTTDN
FT                   HHSVDDKPYGGGPGMLIMCPPVFDCVEHVQAQGDAPGQLIMLTPAGRKLDQRLVEELST
FT                   HKRLVLLCGRYEGFDERIAEGLKPMEVSVGDFIANGGEVPAMLLIDTVIRLIPGVLGDE
FT                   TSHKYESFAQSGQLEYPQYTRPREYRGMKVPDVLLEGNHQAIAAWREQQSQERTATRRP
FT                   AVELQRASVQAMRSSSEILPLPK"
FT   gene            complement(234528..234887)
FT                   /locus_tag="Plim_0180"
FT   CDS_pept        complement(234528..234887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0180"
FT                   /product="ribosomal protein S16"
FT                   /note="TIGRFAM: ribosomal protein S16; PFAM: ribosomal
FT                   protein S16; KEGG: amc:MADE_01705 30S ribosomal protein
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66032"
FT                   /db_xref="GOA:D5SNA5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA5"
FT                   /inference="protein motif:TFAM:TIGR00002"
FT                   /protein_id="ADG66032.1"
FT                   /translation="MAVRIRMKKIGRKHRPFYRICVMDSRVHREGKAIEEIGWYDTAID
FT                   DKSKRVKINLERVDYWVSVGASLSDRVATLVKKIKTNKFGVKAAPPALIAPKVKEAAPA
FT                   EGGEAPAEGGESTEG"
FT   gene            complement(235097..236572)
FT                   /locus_tag="Plim_0181"
FT   CDS_pept        complement(235097..236572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0181"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: dvm:DvMF_2888 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66033"
FT                   /db_xref="GOA:D5SNA6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA6"
FT                   /inference="protein motif:TFAM:TIGR00959"
FT                   /protein_id="ADG66033.1"
FT                   /translation="MFESITQGLQGALTGIFRSGKLTEANIREGLKQVRQALLEADVEY
FT                   NVATQFIEKVTAEAVGEKVLKSLRPDEQLIGIVHQQLIALMGPTDHSLHLRRDGINKIM
FT                   MCGLQGAGKTTTCGKLARKLKAEGWKPLMVAADMQRPAAIEQLKTLGQQLDVPVYAEAP
FT                   GGNPVAVCKNGLAHAKTAGANVVIFDTAGRLHVDDRLMFELEQIDSRVQPDQVYLVCDA
FT                   MTGQDAVRSAKAFNDALELDGVILTKLDGDTRGGAAISVKQVTGVPIKFVGMGEQLDRL
FT                   EPFHPDRMAGRILGMGDIVTLFERAQEEFDAEEMERQQQRMLKGRFTLEDFRNQMKQVR
FT                   RLGSLGDIMKMIPGMGGLLDQFQNIDAEKDMGRIDAIISSMTLDERQNPDRIDRSRRTR
FT                   IARGSGTDPADVNRLLKDFDNMSSMMQKMSGLGVKDRFRAVQDLAKVGGMNPAAGLQAQ
FT                   KQRSKRGPADADLAAEKKKKARKEAKKQRKKNR"
FT   gene            236983..237336
FT                   /locus_tag="Plim_0182"
FT   CDS_pept        236983..237336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0182"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: gbm:Gbem_0010 multi-sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66034"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66034.1"
FT                   /translation="MRQGCRLAVVADQTDTHAVLDAVLSPQGYEVTRLRRYSDLETRHT
FT                   TADPFDIVVLDADAMPHSTDAESAEKTETPAMRHVVIGTVSINLNPETRLISKPYQMAE
FT                   LLQTIESLLPVRH"
FT   gene            237413..237904
FT                   /locus_tag="Plim_0183"
FT   CDS_pept        237413..237904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66035"
FT                   /db_xref="GOA:D5SNA8"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66035.1"
FT                   /translation="MIHSILAGDSGMVLAQQPLPWLVNLWIAFLSVVFIGVFIVVVIAI
FT                   IKGLRWFERSATNSQARFFQDVTAYVCPPSELEAAPQQLVMVKFHTYSGIMIYVLQYEH
FT                   LFWATPADARKILSRMHWHNLTIGFFAYGILIVPLLSLANYAIQLKSISRQEAEITKQP
FT                   "
FT   gene            complement(237964..239775)
FT                   /locus_tag="Plim_0184"
FT   CDS_pept        complement(237964..239775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0184"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: aeh:Mlg_2710 arsenite-activated ATPase ArsA;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66036"
FT                   /db_xref="GOA:D5SNA9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNA9"
FT                   /inference="protein motif:TFAM:TIGR00345"
FT                   /protein_id="ADG66036.1"
FT                   /translation="MPTATTKSIASGLAPLVEQPPRHLFFTGQGGVGKTSIASAVAIAL
FT                   AESGRRVLIVSTDPASNLDEVFETQLGNRPTPVHNIPGLWGLNLDPHQAAAEYREKMVG
FT                   PYRGVLPESAIASIEEQFSGACTVEIAAFDQFAQLLGDERTTKDFDHVIFDAAPTGHTL
FT                   RLLALPSSWASYLDANTTGTTCIGPLAGLAAQQKLYHATAHALCDGELTTLVLVTRPES
FT                   SAIREAARTSHELQALGVEQQWLVINGLFEATSTDPLAMAMEQRMQAALAALPDELKKL
FT                   PSITVPFQPGGLIGKAALQHLGHSVETVTNSQAASAQGTPTSEEEFPPWKSLQELTSEL
FT                   AQREHGVIMTMGKGGVGKTTIAAAIAIRLAQLGRNVLLTTTDPAGHIVGLVETGELPLL
FT                   SVERIDAHAETERYREEVRQTAGAQLDDAGRALLEEDLRSPCTEEIAVFRAFARTVARG
FT                   KQQIVVLDTAPTGHTILLLDAAMAFHQEAQRLTNQVSEEVAQLLPVLRDHQQTRILLIT
FT                   LPEATPVHEARLLQADLQRAGMEPMGWVVNQSLSLLDMYDPGLVTRKSFERKYIVEVAQ
FT                   AHPSMMTIVPWQATIPTGAAGLLSMTE"
FT   gene            complement(239833..240675)
FT                   /locus_tag="Plim_0185"
FT   CDS_pept        complement(239833..240675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0185"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: gme:Gmet_2992 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66037"
FT                   /db_xref="GOA:D5SNB0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB0"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADG66037.1"
FT                   /translation="MRFTKMHGIGNDYVYVNLFAEKLPLAAPDLARIVSNRYKGIGGDG
FT                   LILIGPSERGDARMQMFNADGSESEMCGNGVRCVAKYVYDHGIAKKPELRIETGRGVLT
FT                   LQMFAGSSGKAERVRVNMGTPILKSADIPTALPGDPPVNQPLVVGDKTISVTCVSMGNP
FT                   HCVTFVDELTDAWVLGLGPQVEVHAAFPRRVNAEFAQVLSRTEIQLRVWERGSGETQAC
FT                   GTGACATLVAGVLSGRTDHQALIHLPGGDLEIEWPDEKEVFMTGPATEVFTGEWFPEV"
FT   gene            240918..242204
FT                   /locus_tag="Plim_0186"
FT   CDS_pept        240918..242204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0186"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: mca:MCA2831 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66038"
FT                   /db_xref="GOA:D5SNB1"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB1"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADG66038.1"
FT                   /translation="MPHVQHRECKLPSISTRLQKTDLPAVFLAMVTLWLGLELPPVFAQ
FT                   PRDPYLAPRHQMVTEFIEREGVKNPRVLSSMRQVPRHEFVLPTQKQQAYFDQAMPIGHK
FT                   QTISPPYIVAYETEAIDPQPTDKVLEIGTGSGYQAAVLSNLVQEVYTIEIVEPLGKTAA
FT                   ERLKRLGYNNVKVKVGDGYQGWAEHAPFDKILVTCSPEDVPKPLVDQLKEGGKMIIPLG
FT                   ERYQQVFHLMEKKDGQMISQKLIPVLFVPMTGAAEDERKVKPDPMHPQLVNGDFETDEN
FT                   NDGMVDHWYYQRQVKLETADVHGGKVAVTLSNSEPGRMAQLVQGMPVDGIRLGTMDVSL
FT                   WAKAKGLRSSRDGNERPELSVIFFDDLRRTVAEVSVPISTGTYEWQEFRKSFAIPTKAR
FT                   EAIIFMSLQGATGDLTIDDLQIRTPFRKP"
FT   gene            complement(242436..243455)
FT                   /locus_tag="Plim_0187"
FT   CDS_pept        complement(242436..243455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0187"
FT                   /product="ATPase"
FT                   /note="KEGG: rpi:Rpic_0439 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66039"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB2"
FT                   /inference="similar to AA sequence:KEGG:Rpic_0439"
FT                   /protein_id="ADG66039.1"
FT                   /translation="MKKYAFWNNKGGTGKTSLLFQSACRYAEQNTKERLLVLDLCPQAN
FT                   LSELFLGGLMGDGSSELTRLQEQSPRRTVGGYFESRLPSPYTIPSINSKAFLSNPSAVN
FT                   SSIPRNITLLAGDPLLELQSNAIATLANAQIPGQNPWLAVADWISDFIQSVANDFDTVF
FT                   IDTNPSFSMYTQIAISAASRLVLPIMADDSSRRAIQNAFTLVHGLQLQSSIYSDYSFTT
FT                   KLKQANRELPKVHLIPQNRLTQYMGPASAYGSVMNKIEEFVGNVLAISPEVFTFSNRAD
FT                   GFVEVRDFQTTGVVAFAKGVPFSRLAVGRHDIGGRETQVNRDYLQSCQQAIDAVVQRL"
FT   gene            complement(243674..245653)
FT                   /locus_tag="Plim_0188"
FT   CDS_pept        complement(243674..245653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0188"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   gme:Gmet_3167 helicase C2"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66040"
FT                   /db_xref="GOA:D5SNB3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB3"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ADG66040.1"
FT                   /translation="MELTAENVLGQEGLLARRLPHYEVRGEQLEMARAVTAAIAAGEHL
FT                   VVEAGTGTGKSYAYLVPAILAATANQGSTVDGGAKRRVIISTHTISLQEQLISRDLPLL
FT                   NSILPVEFSAVLVKGRSNYVSLRRLKGALEKSRSLFPTSEAEDQVRSLAGWARETNDGS
FT                   LASLDFKPLPQVWDEVRSEHGNCLGKNCPTYSDCHYYKARRRVWNADVLIVNHALFCAD
FT                   LALRREGASVLPDYQTVVFDEAHTLEQVAADHLGLGISSGQIEYMLNRLFNEKTQKGLI
FT                   AGYPLEPQRALITRLKHDVYEFFDEIRHRVHDHGPANGRVREPLAIENTLSGDLRKLAT
FT                   SLAEYAAKLKQEEEKIELVSASERLISLAGSISQWVEQGRGDSVYWVETTGAQRNLKVK
FT                   LCCSPIEVGSVLREELFNKVPTVILTSATLAVGQQSFDFIRSRLGLTRSQSLRLGSPFN
FT                   YREQMKLVLPDGMPDPTDSPADFEFAVCEKIQEYVSQTSGRAFVLFTSYKMLQSCERRL
FT                   TNWLIRKNFSLYSQSGELPRSQMLERFRKDPAAVLFGTDSFWQGVDVPGDALQNVIITK
FT                   LPFSVPDHPLLEARVEAIRARGGNPFMEYQVPEAAIKLKQGFGRLIRTKTDRGMVVILD
FT                   PRIRTKPYGRVFLESLPECRIVHS"
FT   gene            245960..247624
FT                   /locus_tag="Plim_0189"
FT   CDS_pept        245960..247624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_2695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66041"
FT                   /db_xref="GOA:D5SNB4"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66041.1"
FT                   /translation="MPVDLKTTPQKSLVPADEPGTAGSQIVTSTQGEFVAQDEASSDAH
FT                   PSVGADVSMLTDKTPPWLRASRRMAIITLLVGVAFWFYSIKPVWHADPWSHIAYGKLIV
FT                   SEGLPATEQLLPLARGMAYWNSSWLFDVLLRNVDRTLGGAGLQGATGIFAGLIVAIFVS
FT                   SLAYTTGRTLLACGMGMALLFLIGHDLSILRSQLAGIVCFLTAWILWQGAIRNAHAWWQ
FT                   LPLLFAVWANLDSSFMVGLIVPVAMMAGRMVDRWVKTGQWKSILRDQHLGKLLLVTQLC
FT                   LLATLLNPYQGRMWWEVLTFSQNPNLSAMVDWSPLTLRSTEGQFFAATILILLGVVRSS
FT                   PRRLGTGEMILLVSLAALGCWNTRQLVWFYPVALWTLAMHASAILSKNGWSKHASPRAG
FT                   KWSVVMVGLVWICFGFSPLGMRVLHGKQPTASRLNVAFAPVELTQYLVKKPPEGQIFNP
FT                   VEWGDYLLVHGPENLKIFANSQVQRLPREVWRDYLTIVDLGSGWSEILDRYSINTVVLD
FT                   KQFREGVIRRMKEETAWKLVYEDGRGAVFTRKLPITR"
FT   gene            247709..248947
FT                   /locus_tag="Plim_0190"
FT   CDS_pept        247709..248947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66042"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66042.1"
FT                   /translation="MSRPSTVKSRFWRSLVLTQLASAVLLLTSLAWAYSPVAPLRQALN
FT                   PVLTAPEVPVPPRTEPLFIAPLYNDPEVVSDEELALVLKKVQPRFPQKALKPNYVEHAL
FT                   RAWTIHAKFKDPEVMSGEQMKEFLTNHGQFLASWGEKIEPILEDRQTGVAIRWGKEQCA
FT                   SVHHDHWLASLTEAGVSLHEPVFLPGGKQRNIGDVLRQSMLDFRVDEIEVEWSAMAFGL
FT                   WLAPQREWVNNQGRQINFDLLAERLVRGHQRFGVCTGTHRVYSLMLLIRLDDEYHILSP
FT                   AGRDVAWKHLEFIRDQITVSQFEDGHWPSNWSDGALALKDPVEDELYKKVIATGHHLEW
FT                   LAIAPKELHPPREQILKAADWVISTTTAQTPEQILGTYTFFSHVGNALALWRNTRPNIF
FT                   FEAWEARESAGGK"
FT   sig_peptide     247709..247810
FT                   /locus_tag="Plim_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 34"
FT   gene            249073..249936
FT                   /locus_tag="Plim_0191"
FT   CDS_pept        249073..249936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0191"
FT                   /product="formyl transferase domain protein"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   csa:Csal_2073 formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66043"
FT                   /db_xref="GOA:D5SNB6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB6"
FT                   /inference="protein motif:PFAM:PF00551"
FT                   /protein_id="ADG66043.1"
FT                   /translation="MQVVITAVGPDNVGLADPIVHYVTGAGANIHEIQMFDHDAEKQFS
FT                   MHLRIEWPGVPSSVAQLRSAMDQIGALKSLAIRVWSRDEHARLPRLAICTTYRPEPALA
FT                   ILRAIRDGRLKAEAAIMLGNREACRGVAEQFEVPFVNIGNAKGEPDDSQFVRVLDDADV
FT                   DYVLLARYMRVLPPNVCWQFAGRIINLHHGLLPPFPGFHPYEDAYARRMLTFGATVHFI
FT                   VPELDAGNQIIHQSTFTVPPGTPLADIKRQGETDHEPQCLLEGVRRVVDREVELHFQRV
FT                   IRRKAD"
FT   gene            complement(249980..251875)
FT                   /locus_tag="Plim_0192"
FT   CDS_pept        complement(249980..251875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0192"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; SMART:
FT                   peptidase M14 carboxypeptidase A; KEGG: spl:Spea_0137
FT                   peptidase M14 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66044"
FT                   /db_xref="GOA:D5SNB7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB7"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ADG66044.1"
FT                   /translation="MNSQLPAKAEFPLKSTLSPSFPRQPGRFLLFSWLWGLLILQPLTV
FT                   LGSDEMTADLPPVLPWSGASEKLIVATDEAWITPTEASGFVETPGYQVTMQWLENLAKA
FT                   SPMIKLVPFGLTAEGRELRAVIATREGIDNLEQLGQSPKPTVLAQAGIHAGEIDGKDAG
FT                   MMLLRDIALRGKAHLLDHANLLFIPILNADGHERTSRWNRPNQRGPLHQGWRTTAQNLN
FT                   LNRDYMKAQAPEMQALLRLITVSKPALYLDIHVTDGVDYQYDITYGFHGYRESFAWSPQ
FT                   IAKWLDQIYRPGLDQSLQAAGHIPGPLVFALDKSDLNKGIVDVPYNPRFSTGYGDLIHL
FT                   PTILVENHSLKPFRQRVLGTYILLESSLKVAGKNAASLQSAMKQDRAYRPELIGMNWSE
FT                   PADTQFTMEFLGIAYEEYFSPASGKNEVRWLGKPITIPQLKVHRVTKPGVQIRPPSAYY
FT                   IPITSREVIEVIKSHGIIMEPLQESVTLELESYRLVNPVVAPRPNEGRQTMTTQVKIES
FT                   QKRVLPAGTLKISTDQPLGNLAIALLEPAHIDSLAAWGFFNEILQRTEYIEGYAIAPLA
FT                   EKLLKENSALKAEFEARLASDPAFAKDATARLQWFYEKSPYFDQKYLQYPVWIER"
FT   gene            complement(251936..252241)
FT                   /locus_tag="Plim_0193"
FT   CDS_pept        complement(251936..252241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS0140 FtsY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66045"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66045.1"
FT                   /translation="METTRELTAEEVGNLANQLQNAYDSIQDSYEYPLDDLIDYLQQSQ
FT                   SEPIHEVEESDGVAARYFLYFSSPPETWEALCGREGIYTVDAKTLRANNFDISVMN"
FT   gene            252419..253309
FT                   /locus_tag="Plim_0194"
FT   CDS_pept        252419..253309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0194"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: nadC; nicotinate-nucleotide pyrophosphorylase;
FT                   K00767 nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating); TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66046"
FT                   /db_xref="GOA:D5SNB9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNB9"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADG66046.1"
FT                   /translation="MAHSFFGSIEKAAAERLILWAFQEDLGERGDLTCQGMIDPTLVAT
FT                   VKIVSRQPGILAGLPIAQMIYQQMDASIQWEAFAVDGDELTAGQVVAEVTGPVSTLLTG
FT                   ERTVLNFVTHLSGIATLTHQFVELAQGTKAKILDTRKTLPGYRSLAKYAVRCGGGHNHR
FT                   MGLYDGILIKDNHLAAWKSSGSIAEAIEHVRAQMGANIDIEVEVDTLEQMVDAMRAKPQ
FT                   IILLDNMTTRELTEAVAYRDQHAAEILLEASGGVNLTTVAAIAATGVDRISIGALTHSA
FT                   PQLDLALDWGAALKK"
FT   gene            complement(253326..255113)
FT                   /locus_tag="Plim_0195"
FT   CDS_pept        complement(253326..255113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0195"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: mgm:Mmc1_3425
FT                   integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66047"
FT                   /db_xref="GOA:D5SNC0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC0"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADG66047.1"
FT                   /translation="MSASSSGSASESSSARNTPQTPSASNVRVNELAAETNLDTQTISA
FT                   HRVQGAQESMGSWRLVSLCTLLSRIFGLIRDAAMAALFGSGPLLDAFTIAFRLPNLARV
FT                   LLGEGVLATAFLPQLLEVEREEGQRSAFRLATALCILLFGGLSLAVLFTQLILLLGVLP
FT                   WLSNPDNQLLCWLTIYLLPYVVFVCAAAQLSTILHAFHRFMAAALIPVVLNLGWLLALA
FT                   LVAWLIESPQIQIQILALLIVVLGFIQCLALVPSLWQVGFRYQSDWWQARSKILATISR
FT                   MGPILGALLVLQFSAVWESAISWLLSADGTSSGQGVAWLGGIEAPLPSGAATFLYLGQR
FT                   LYQFPLGIFGVALGTVLYPLLSRHAQAHDWQAFRSSISLAARLVLAIGVPASVGLFSLA
FT                   LPVTDLLFGRGAFNWPAIEQTARVIQTYSLGIWAMCGLVIAQRAFYALDDRWTPLNIAF
FT                   IGTATGMLTGLCSLWWLGTSGLAWGTTVSAIMQVLWNYRRLYQKIPVINSPTDGNPGSS
FT                   LAVLFMKIAFCNGAMALVCQSLLWVASQYFVLHGSTFDRLMLVMIPMTGSILAFALTSR
FT                   LVRYKDPWIVLQRRVSIEP"
FT   gene            complement(255280..255915)
FT                   /locus_tag="Plim_0196"
FT   CDS_pept        complement(255280..255915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66048"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66048.1"
FT                   /translation="MFKRFLNTPSVVEYGPLLMGGLFASVMALSFWAFAGSQTVHAQAD
FT                   SGSRKGSIENIVRADVYLEYDQLPAGRTCRFAVIFDVQEGWHVNANPPQPENLIPIKVT
FT                   FKSKAGLRMLPIDYPEGEETRVDFSPEPAMCHSGRFAVRGVLEVPCDAGGEVDDLEIQI
FT                   RYQTCNDKICIAPKTVKLKAAPKIALAGAAVRPVNPKLFTPREDEQVE"
FT   sig_peptide     complement(255787..255915)
FT                   /locus_tag="Plim_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.921 at
FT                   residue 43"
FT   gene            complement(255994..259290)
FT                   /locus_tag="Plim_0197"
FT   CDS_pept        complement(255994..259290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0197"
FT                   /product="sigma-54 factor interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   mxa:MXAN_4240 sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66049"
FT                   /db_xref="GOA:D5SNC2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC2"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADG66049.1"
FT                   /translation="MSAARRWVRPVLAALGGCSLVYCMIALVYVATAPDVRLRCLLVDK
FT                   PLQPGKLTSIIIRKTPGIEFKGPRPQPGDELLRIGEQRLGTSLDFFRYMDWLRTAPTPP
FT                   GGRMLAGGDPLEQQLPKLVQEEGGPRWVEIEFYRPEDDKVYVASLAVQGVPLDEIGLTL
FT                   VWFLFQLAIFSVSAIAFWRRPFDHPAQLFFSMCLVTISAFVGGFHWWVIAGNPWLNLPF
FT                   AITAIMVPVVTFHFFLIYPRPKPPIDRYSFETLVGIYAIPIAALVLFLLAEWSIWWLMA
FT                   TTGISVEARALQMFGWLVALKNGVYIYVSIAAFYFAGIIAALVHGFWTTRNPVERNQVK
FT                   WILWAGLIATLLIGYTLLLAGVSRADFALGGGRWPMFFASLVFMLAYAVGISRFKLMLV
FT                   DQVVSRGMLYYVLSFGTTLVVSIAIAMTAVAAVSWREQLTSPQLVVVAAILVVTVGMFL
FT                   WARDVWQRLVDRRFFREKYQLDKVLQRMNRAVGQLADAESLAQRMAGSCQDVIQAERAA
FT                   IYLREGRSTNFRLIAAEGVWPNVSMQISTSADFVMTLAAATTLQAVPAASRDSMNPVQS
FT                   FLRDLQAELIHALEVEGELSGFVVLGPRQTNGVYSAEDITFLTAMGQITGVALHCAKVH
FT                   KDLSRLNEELRLKVDRIEQQKQQILMLQAEINESQEPESPAPVTEFNRGMIRGSSQALM
FT                   EVLEVVRKAAASDSSVLITGESGTGKELLAQAIHANSPRRDGPLVIVHCAALSTGLLES
FT                   ELFGHVKGSFTGAYADKPGRFELANGGTLFLDEIGEIPLETQVKLLRVLQQRTFERVGS
FT                   SETLRCDVRVVAATHKNLEQAIRDSRFREDLYYRLNVVHIALPALRERKDDLYELFRHF
FT                   LKQAANKTGKRVFRIDESALAALLAYQWPGNIRELENVIERAVVLSESNTVTLADLPPA
FT                   LRRLETSAIRRMESAMQPLVVESVSGTEVVAASEERGAMHHVAPLDSSPVSVPDSSSGK
FT                   SFTNSTKTITDRTESKPRATTGHEKSSASRSKGRGRKPLPQSLSVNESVWETASNETGR
FT                   FASDMTESEERQLLIKALEQCQGNKAEAARMLGLPRSTYFSKLKKYRLAN"
FT   sig_peptide     complement(259198..259290)
FT                   /locus_tag="Plim_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.587 at
FT                   residue 31"
FT   gene            259810..260487
FT                   /locus_tag="Plim_0198"
FT   CDS_pept        259810..260487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0198"
FT                   /product="Maf family protein"
FT                   /note="PFAM: Maf family protein; KEGG: oan:Oant_0322 maf
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66050"
FT                   /db_xref="GOA:D5SNC3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC3"
FT                   /inference="protein motif:PFAM:PF02545"
FT                   /protein_id="ADG66050.1"
FT                   /translation="MPDHLANLLRANLCGGCVVRWILGSRSPRRLELLKAFDPRGDIRA
FT                   VPPRSPDEMEFEGLHRWDEIVERSLLIAQTKYEDVWEQVARENLENTLILCGDTTVLCE
FT                   TEPGSWLAIGQPPVDDPQHQVLRKWLGQFLANRTHRVLSSCVLRLASGELRQGSIVTNV
FT                   TFRSDVEQWLDWYLSLNESAGRAGGYAIQGAGSIFVDKIEGSLSNVIGLPLELLAEWTA
FT                   CRR"
FT   gene            260604..261692
FT                   /locus_tag="Plim_0199"
FT   CDS_pept        260604..261692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0199"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   sus:Acid_6679 nifR3 family TIM-barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66051"
FT                   /db_xref="GOA:D5SNC4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC4"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADG66051.1"
FT                   /translation="MPETASSLGRQHPQPSQDLSWWIGRRQIPSRYGLAPLAGYTQRPF
FT                   RVALRELGGMGLATTDLVHAVKLLSNNAFSQQLIATSLLDQPLSVQLFGADPTHVATAA
FT                   RWLEDLGYEGVDLNMGCPMAKVNSQGGGARLMCDPTGATRLVALVVASVSIPVTVKMRL
FT                   GWDAQSLSAPLLARQFEEVGAAAITIHGRTRAQGFSGKVSREGIAATVAAVQSIPVIGN
FT                   GDVRTVEDAISMRRETGCAAVAIGRGAMLDPWIFRKLHDFEMTGQYAEPGPEEQIQFLV
FT                   THFREMVDLFGEQATRLFRKFAGWYGARLGIPQDLEDRLRRVESLSEFEEIVAEIRERH
FT                   GEEPPRIPTALLKVPNGPNELW"
FT   gene            261813..261885
FT                   /locus_tag="Plim_R0002"
FT                   /note="tRNA-Lys1"
FT   tRNA            261813..261885
FT                   /locus_tag="Plim_R0002"
FT                   /product="tRNA-Lys"
FT   gene            complement(262016..262933)
FT                   /locus_tag="Plim_0200"
FT   CDS_pept        complement(262016..262933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0200"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   tgr:Tgr7_2152 phage SPO1 DNA polymerase- related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66052"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC5"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADG66052.1"
FT                   /translation="MTIDRGNPGDQLRRALRQELEIVARSGVSHWSPEILQLLPLLTTP
FT                   ATAPLEPSRVRGASHSAEANTAAARLTDSSRLIAPEELEMAKRSARSQMAPPAPTASGI
FT                   APQPPKLLNLPLAERVHELEKLKKCVANCTRCPELASTRKQTVFGVGNPQAKIMFLGEA
FT                   PGADEDATGVPFVGRAGQLLDGIIAACKLKREEIYICNILRCRPPGNRLPSPEEAGNCR
FT                   EWLDGQISIVNPEYIICWGSTAAKNLLGTTEAIGKLRGKLFEYGRAKVCCTYHPSYLLR
FT                   NPPAKKDVWQDMKWFFGTMGVELT"
FT   gene            complement(262930..264294)
FT                   /locus_tag="Plim_0201"
FT   CDS_pept        complement(262930..264294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0201"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gbm:Gbem_0302 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66053"
FT                   /db_xref="GOA:D5SNC6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG66053.1"
FT                   /translation="MTTALSNQPLLKDRAFWGLNATQFLGAFNDNLFKELVLLICVAAP
FT                   PIFGPNTPDNKGLNQGLATVAFSVPFIFLSGFAGFLSDRFSKRTIAFWCKIAEIGLVLA
FT                   GLIGFYLGSLPLLILILGLMGAHSAMFGPPKYGILPELFHKSELPKANGLLLMTTFLAI
FT                   IFGLALAGFLADLFHGRLWIASIACLFVAITGTITVLLLREPGVADPHLKFTLGSMFIS
FT                   RSTWQLITSKKGLLPVLIASSVFWMVAGMVYPNSINALGKTIHGFSDTQTGLMAATTGL
FT                   GIAVGCVFAGIWCRDKVRGRLVTVGLVGLTGCLILLGMPGAEGFKGKPWLSPIGASIAL
FT                   VGVGLFAGMYSVPLQTFLQAMASDGQKGRIIGVMNLVNWIGIALAGVIYIVSVKILGSF
FT                   GLSEQFTFWVGAGLLVPLLIFFRPPTVNLSELEAATTPLDAVTTTPPVIIPGETA"
FT   gene            complement(264372..264488)
FT                   /locus_tag="Plim_0202"
FT   CDS_pept        complement(264372..264488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66054"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66054.1"
FT                   /translation="METVRKGVACPANTHKNQRRRIDVDAKTFWQDIPPRFS"
FT   gene            complement(264575..265204)
FT                   /locus_tag="Plim_0203"
FT   CDS_pept        complement(264575..265204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0203"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   noc:Noc_0989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66055"
FT                   /db_xref="GOA:D5SNC8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC8"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADG66055.1"
FT                   /translation="MLFHSIARNMIFIGLWLAWPALLAAGEFNTVLSIGDKAPAWSKLP
FT                   GADGKEHSLADLAECKAVVLVFTCLSCPTAVDYEERIEKLRKDYAPRGVEVVAVCVNQV
FT                   PQDRLEAITQRVQKKGYSFPYLYDETQKIAKDYGAIFTPEFYVLDGERKIAYMGAMDDK
FT                   TEAESVEVKYVSAALDAILSGQPVPKAEVIARGCRIRYARERRESK"
FT   sig_peptide     complement(265127..265204)
FT                   /locus_tag="Plim_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.623 at
FT                   residue 26"
FT   gene            265499..265603
FT                   /locus_tag="Plim_0204"
FT   CDS_pept        265499..265603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66056"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66056.1"
FT                   /translation="MGFVSQEISSRGEAMLRVCLQILAEGVSPGCVAD"
FT   gene            265613..266746
FT                   /locus_tag="Plim_0205"
FT   CDS_pept        265613..266746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0205"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: gsu:GSU3069 UDP-N-acetylglucosamine--N-
FT                   acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-
FT                   acetylglucosamine transferase;
FT                   TIGRFAM:UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol N-
FT                   acetylglucosamine transferase; PFAM: Glycosyltransferase 28
FT                   domain; glycosyl transferase family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66057"
FT                   /db_xref="GOA:D5SND0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND0"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ADG66057.1"
FT                   /translation="MKSSRRTPKILFAGGGTGGHLFPGLATAAAIEEICPKAKFLFAGT
FT                   ERPLEREILATSPYEQTTLPAEPLRNLWQSPLRFLSRSFTAWRAALKIVDQFKPTTVVG
FT                   LGGYASVPMLLAARRRKIPYILLEQNTIPGRATRCMATKAHCICVTFDETRAYLPRSCK
FT                   VLVTGNPLRTEICQLAETAYTPERKTLVILGGSQGADRLNEAVALMLEQNGKMLEGWDV
FT                   IHQSGPRQEVALKARYARRSLPCEVHAFIKDMQSVYRRAGIAIARSGATTLSELACAGI
FT                   PSILVPYPESSDGHQLRNAESFAKRQASLVVEQAADVLETSKQLEAALNALVTDYRHRE
FT                   AMSREAKSWARLDAARRIAAEVLELAQLDKNHLKEAT"
FT   sig_peptide     265613..265699
FT                   /locus_tag="Plim_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.961 at
FT                   residue 29"
FT   gene            266746..267804
FT                   /locus_tag="Plim_0206"
FT   CDS_pept        266746..267804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0206"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; dTDP-4-dehydrorhamnose reductase;
FT                   KEGG: dal:Dalk_2037 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66058"
FT                   /db_xref="GOA:D5SND1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG66058.1"
FT                   /translation="MDQRDLPLLLVTGTTGLVGRHVVLWAAKNGYRVRGLVRKPSSCAG
FT                   FFPEELMPVIELVEGDLEDGVSLEKAVQNVNFIVHCAAKVGDWGPTEEYRQVNVEGTRL
FT                   LIEAARKQPAFEKFVHISSLGVFPAKDHYGTDEDVPVSTSGIDGYTLTKRESEQLVSDY
FT                   SQKEKFPAVILRPGFIYGPGDRSVLPRLIERLKTKQFAYLGSPEKLMNNTSVHNLVQAV
FT                   ATVLKHTTPAGRIYHVTDGRLVTKREFVETVARCAKLPLPKKVVPLPVAKVLAKVLERI
FT                   WKLLGKQEAPLLSSARIKFLGLNLDFSSHRLQMELGYQPVIDFQQAMPAAVADLCGAPA
FT                   ETFVEPPQRKIA"
FT   gene            267804..268061
FT                   /locus_tag="Plim_0207"
FT   CDS_pept        267804..268061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66059"
FT                   /db_xref="GOA:D5SND2"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66059.1"
FT                   /translation="MNAVFESDKLRRAAKWFCSWEGFLVWAFIPYALSLGPFFWSWYGA
FT                   IFELRSAWWLGAYVPLQVQIWLCPIYGDLLDWYLHWWITS"
FT   gene            complement(268083..268391)
FT                   /locus_tag="Plim_0208"
FT   CDS_pept        complement(268083..268391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66060"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66060.1"
FT                   /translation="MNNLHGSSRSRTGWRAGHALLLGCTLLGLTLVGCTMTEMKRALYY
FT                   DPEAKDENAMNGVESDKWGFVGQQGRGSKALEDERDPLKNLLMSKEARDIERNLGYK"
FT   gene            268898..270574
FT                   /locus_tag="Plim_0209"
FT   CDS_pept        268898..270574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan 5"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66061"
FT                   /db_xref="GOA:D5SND4"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66061.1"
FT                   /translation="MTPQILPHRSNRSYAATERIQTIRLQFNRKSAVEQIVSKLGCGRL
FT                   ISGRLIASGLILCVVLMSGCAKNPRDSIAKLWDHVPSAPWTAGKSAERKIEQEQPTVAA
FT                   NSAATLSARDAQAADAPVEDPFEVAITPGQSTKSVDKVGSGSGLPEGQHSAIHQTSMTT
FT                   GSGSTDSSTTSDSEAPAVAKTTGAKLKDALPDPLSATPGDWTKAFELANGLEKAKEATS
FT                   QEVSRIGQLRETLEEDAQAVTKRSLSELNEFRLRIESLLSHARRQIEAGELKTAQRFAR
FT                   LANELSEGAGLEYSPTEERPQDLLHRIEDLIALSRPEAGELKLNDMATDQKTAESAPDA
FT                   ITSSTQPSTGAALESEKSGDISEEMAAVPPALQGSVSANRALRAIPKDSPSDFVAEASI
FT                   PSDAVVTAHVVQHDVPEATLQPLYLPGVEQLGTEIRTRGEHVQSVAASKTETLPEVRGH
FT                   DDKQPARSKLNVDAIGEFEQLVVKSDSAELASSQSRSNQLMTWVPWVLGILVALGAGWG
FT                   LARSTGRSVEVVVSSHSASAGHISSSETSGSASRESAPSER"
FT   gene            270787..271152
FT                   /locus_tag="Plim_0210"
FT   CDS_pept        270787..271152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66062.1"
FT                   /translation="MATDPWGRPTLHDLKTVIESFEKLDGANSRNTERIELAVPAEITT
FT                   RRGNLIPAMTREISRYGVGLLHKGSLNPGDVRLKMASETREYTYSVAIEWCTPVENGMF
FT                   ISGGRFLGKPEVSDVEN"
FT   gene            complement(271232..273004)
FT                   /locus_tag="Plim_0211"
FT   CDS_pept        complement(271232..273004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66063"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66063.1"
FT                   /translation="MAAPPFQHLKDSGWCPVVLKWLTVGCFLITSFPQANSADDKPSAK
FT                   LTVQSREVQTAIKRARTFLQTSADDQASLALTGYALLKSGSDLSDKKVADALADVRKRC
FT                   GGNRYLPASHHIYSAAVDAMLLEAAGDLSDKPSLNLIADYLIAQQKAHGGWYYPSQTDI
FT                   YGDTSISQYGVLGLWAAYRAGVTIPTDAWEGAARWHQQTQNADGGSGYHPTATGATETK
FT                   ATMTAAAGGSLQVVRLILFGKTAAGKTRRLDASIGKRFGVLEPVRPEAPPEENQAVVVV
FT                   RPTRLELSVLDASIDKNFRALERLAQRGMPADFPCYYLYAIERYAALSAKEEIAGVDWY
FT                   DAGARWLIQNQATDGSWRDSSGLSPATSLSLLFLGKATESLFKREGAAPGVGGGILVGG
FT                   RDLAAQLVDKPKDPKTSAELADQALKSLSKSLSDQDVAKAQAAIVAQFQLGNRDDLVGK
FT                   LDLLQRLVKDPRDEIRRTACWALGKTGELEPVPLLIERLSDENSDVAFEASRALCTIAS
FT                   EPAGIAGLAIDPTRHTLRRAERSNGTRYRSPREEWQELSTKAWLDWYLTHRPASMRNDR
FT                   LEVGPRDRLVVPPN"
FT   gene            273898..274140
FT                   /locus_tag="Plim_0212"
FT   CDS_pept        273898..274140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66064"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66064.1"
FT                   /translation="MANFRRIQNCCADFSTASRQQPQIGKRPADDWRHLTSDWLADLWR
FT                   KLFPQMIPIPIRTKENPVPTRRPDGVARSGSVVWP"
FT   gene            274281..276314
FT                   /locus_tag="Plim_0213"
FT   CDS_pept        274281..276314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0213"
FT                   /product="DNA primase"
FT                   /note="KEGG: dol:Dole_2153 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: DNA primase catalytic core domain; zinc
FT                   finger CHC2-family protein; TOPRIM domain protein; SMART:
FT                   zinc finger CHC2-family protein; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66065"
FT                   /db_xref="GOA:D5SND8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND8"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ADG66065.1"
FT                   /translation="MSSAGQPTVSWDEIKEQVRARTDIVQLIGETVSLQPARGGRTFQC
FT                   LCPFHDDHNPSMQVNPERQTYRCWVCNEGGDCFSYVMKHDNLSFPEALTLLAEKAGIEL
FT                   PRRSRNEAGFGESSGPKKSDLFDVLVWASREFQQCLKSSALGAPAREYLASRQLKPEIV
FT                   EQFALGYHPDDWHWLQERARGRFSVDSLAVVRLVGARDNGPGHYDFFVDRLLFPICDER
FT                   SRPVAFGGRIIPGRPAKEDAPKYWNSPESPLFSKSRLCYGLDQAREAIRRTETVVVTEG
FT                   YMDCIKAHQHGLKNAVATLGTALTENHVQVLKRLARKFVLIYDGDTAGLNAAERSLPRF
FT                   LAQDVDLRILTLPEGLDPDEFLEAKGLAALEQAIQEAPEALEFKLRRSIERFGTGSVDA
FT                   RQRVTDELLETMALSPGLAGSVRERNLLSRLTSRLGLSESLLQKRLRDLRVEQRFKNVS
FT                   QPPRKVDPAESSIIDDERPLQEQVNSLQRSTAGDDLLESEFFRLLLQSPDDFLWVSQRV
FT                   GSDDFHHPAFRHLWCVCLDVVEHGLLPSFELLLAQTESPALKGLLAWLGESHLSAAELL
FT                   SLQESAGVIASTSELENWAGQPGSAGSVADPGVRRHLLSQLTDRLVLRRELNLHKARRM
FT                   ERGEAGAKLNPSAKDVLAQAMLIHRKRAGGMQNNPHESPSGA"
FT   gene            276985..278637
FT                   /locus_tag="Plim_0214"
FT   CDS_pept        276985..278637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0214"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 region 4 domain protein;
FT                   KEGG: mxa:MXAN_5204 RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66066"
FT                   /db_xref="GOA:D5SND9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D5SND9"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ADG66066.1"
FT                   /translation="MHRLDQGLHELIVRGKKQGFLTYSQINDYLPDEAMNPEKLDELLG
FT                   SIWEEGLKIVTDDQVGMIVEEKKKPRTRAKNGKEVVVEEKSKKIDDPVRMYLTQMGEIP
FT                   LLTREKEISLAKTIEVTRNQFREELLECDYALKMAFDTLSKVNSGELPFDRTIKVSVTE
FT                   SKEKNQILGRMPHNLKTIENLRKQAIGDFEKSIDANASSDERKEAEKQHLKRRRKMVKL
FT                   IEELSLRTQRLQPTMKRLEQISRRMCDLQRQIDSLKHLKSARDERANIHKELHDLMMMT
FT                   LETPEGLRQRVERVRERFAKYEQAMRDLSGGNLRLVVSIAKKYRNRGLSFLDLIQEGNT
FT                   GLMRAVDKYEYRRGYKFSTYATWWIRQAITRAIADQARTIRIPVHMIETMSKLRKVAKK
FT                   LLQEMGREPTLEETAEAAGVSLEETRRVMKISRHPISLDRPVGESEDSYFGDFIEDDNT
FT                   ESPVMAATQEMLKDKIDNVLKTLTYREREIIKLRYGLGDGYTYTLEEVGRIFKVTRERV
FT                   RQIEAKAVRKLQHPVRSKQLKGFLDGLMIAVAK"
FT   gene            278831..279658
FT                   /locus_tag="Plim_0215"
FT   CDS_pept        278831..279658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0215"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mxa:MXAN_5316
FT                   putative daunorubicin resistance ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66067"
FT                   /db_xref="GOA:D5SNE0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNE0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADG66067.1"
FT                   /translation="MATSLDLPQSRTIFWPAVFTLAQREVIRFLRQRSRLIGALAQPIL
FT                   FWILFGAGLRGSFQSNDGASFQAYFLPGVAVMIVLFTAIFSTISIIEDRREGFLQGVLA
FT                   APVSRLAIVIGKLLGGSILAVSQALLFLLIGPLLSFIGLTESVPLGLTISNILPVIGFL
FT                   TLLAFALTGLGYMIAWQMTSTHGFHAIMSVFLMPMWLLSGAFFPAQEGWLKWVLAVNPL
FT                   TYGVAGLRLLLRPESAINLPSWNTCLLVTVLFAVFCVTVACWQTSQRSIRNVR"
FT   gene            279736..281070
FT                   /locus_tag="Plim_0216"
FT   CDS_pept        279736..281070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0216"
FT                   /product="protein of unknown function DUF420"
FT                   /note="PFAM: protein of unknown function DUF420; alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; electron transport protein SCO1/SenC; KEGG:
FT                   sus:Acid_4378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66068"
FT                   /db_xref="GOA:D5SNR3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR3"
FT                   /inference="protein motif:PFAM:PF04238"
FT                   /protein_id="ADG66068.1"
FT                   /translation="MQMMISHPHRSLIKSESRLSKTLMAYGSMTALMIGCLTLLPVGAP
FT                   MALAQESSGTMIKVQPGEGSIIDSSQLTTAPSQGLVDQHGKLIPKDPLTGQNAIWPAEG
FT                   VEPFEFTNQDGEKISNESLKGKPYAISFVFTQCRGPCPMVTGAMRELADRTQKYDVNLV
FT                   TLSIDPARDTPEVLKEYAKTYGADTSRWQFLTGPQNEVHKLIATNFLMPVGEDTSPQRE
FT                   LGKEFEHTTNVMLVDALGVVRGKFNSTNPAEMAVLRRHLITLATGVEPEPLPEEKMIVL
FT                   AGNVRPIPPEDLLPRWVKTLPAINAALNGLATLLLITGYICIRRGQREMHRQLMLSTFM
FT                   TSVVFLVCYLVYHWALHAYTGSSGKKFEGTGIIRPVYFAILVTHVALAALVPVLAIITI
FT                   SRALRGQWERHRQLAVITFPIWLYVSVTGVLIYFMLYHLFPGPQA"
FT   sig_peptide     279736..279885
FT                   /locus_tag="Plim_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 50"
FT   gene            complement(281104..284733)
FT                   /locus_tag="Plim_0217"
FT   CDS_pept        complement(281104..284733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66069"
FT                   /db_xref="GOA:D5SNR4"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66069.1"
FT                   /translation="MNLPVAPSEPLPGQEPPANDMPVASNSETPPKRSGRYLGVLVVLL
FT                   LTAGWLAPTIVGQTSLRQKIPGLLFPHFTGTMTIGEASLGWLNAIELRNVLVKDAQGEI
FT                   IATIPRLTSDATLVSIIRQPAAPGTMTLHQPVIELKLDEASSNVERLLSELLTGESSGG
FT                   PYSYTFKIDQGKVNWKETTSPRAFVIDGLNVSFTTLGDAHSNRLAAQVKSEIKGDRFQT
FT                   PLSIDFDSLSTGGDTPNSQGKLDIQCDALPLEIGEVLAKRSYPEARLAGILSASGKANW
FT                   KFPPEIEKAEWTWNGQIGLTDLAIAGFPQMGNDLPQFKAIVLAGEASQSGPVATFRKLR
FT                   LSTDVGGIDLDGPVPTAALLSAMTGDSNATTALAELGDFRLSAAVDLARLAKLLPATLR
FT                   IREGISIEAGRLEAMAVSSRPAQGQQQWVVSSKLEGLEAREQGRKLSWPEPVSARLVML
FT                   IEQGVAEVESLNVQSPFMVATGRGTIDAGEVRLQANLAKLAEEMGRFLDLGGLTLAGEL
FT                   NGNMALERTTTERVKVTGEFQASQFVLSLPTAEQPAKEFVWAEPDLRIGGEAILYAPAG
FT                   KAPSQALSGTFVVASASDKLTANILQPVLFDGSTGGLDLTLQGGAGRWLTRARSLNLVG
FT                   AYEANGLVEQSATVLWDKSTLNLQGGKLRWSDAQLLGSGIQLVDREIRVDLSSSMDRQS
FT                   GQVKLPELLVRSSAIILDGKNIVYAGNANGIQALAGDVGLKADLATLARWTNSSAVPMT
FT                   TVPVGIVTGTVKVEAQGSSVQLDTQLQSDRIEIQSLTSRPGEPGVWQPLFSETNITSQL
FT                   LVKGTLGQNNWELASFSLQGSGLGMTSRGRLNLDETQPRVELTGELAYDWDRLTPRLAT
FT                   NTSNGSPSRTLRITGKGQRKFQLIGNLPSSGMAMTTPSVNVSTSGVPASDLAWIKSFTG
FT                   EAGIGWDDASYMNLEIGAVELGGRLEDGWLRMTPINTTVNQGRVMLAPAVHLAAPVPVI
FT                   ILPKGEVAQNVQFSQELCETWLKYAVPLLADATRVSGSTSLELAGGQIPLSNMNGADVG
FT                   GVLKIHGAEVAAGPLAMQITGVIQQIRAVIDRGAGTGNGGTLMRMPEQQTEFRLVNGRL
FT                   HHRQLIFETSLATIRTTGSVGLDESLQMVVQIPLLDDWIGDRPVLQALKGQTINIPVGG
FT                   TLSRPQVDGRAIGDLAKRVAGSAVESLIDGKLPGGLDRLLRPR"
FT   gene            complement(284747..284908)
FT                   /locus_tag="Plim_0218"
FT   CDS_pept        complement(284747..284908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66070"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66070.1"
FT                   /translation="MRKGVFRTDLEQSAGYPQTHEVLTKHAGDGLSINSHGCVLIRRVM
FT                   LINDLVVR"
FT   gene            285147..285377
FT                   /locus_tag="Plim_0219"
FT   CDS_pept        285147..285377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_3697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66071"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR6"
FT                   /inference="similar to AA sequence:KEGG:RPB_3697"
FT                   /protein_id="ADG66071.1"
FT                   /translation="MRHPNKHIRAAIEFALSCGWAARSGGGHAFCIIFCPKNNRSGCQK
FT                   SVWSTPRDPEAHARDIIRFVEKCPHSGETDD"
FT   gene            285370..285630
FT                   /locus_tag="Plim_0220"
FT   CDS_pept        285370..285630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66072"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66072.1"
FT                   /translation="MTKEFTLWIDAGEQELLEWSNSVFEAGGDDMSPGVHCGEAYVSVH
FT                   REAETLEEAIRSAHITLAKAGLRVIRCEIDATQSAAMGIAS"
FT   gene            285885..287228
FT                   /locus_tag="Plim_0221"
FT   CDS_pept        285885..287228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0221"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG:
FT                   mmr:Mmar10_1202 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66073"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR8"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADG66073.1"
FT                   /translation="MKQQVFLRGLVVFATALLLTLPGMTNAEDWPQWMGLNRDGRWHET
FT                   GLLREFPADGAKFAWRVPVGMGYSGPAVAGGKVFLTDYVKKTGEIKNDPGARNVLDGQE
FT                   RIRCFNEADGKLLWEHAYDAPYSISYPSGPRCTPTVDRDLVYALGAEGELTCLQVQDGK
FT                   VLWSKNFKKDFGVETPIWGFSGHPLVDGDQLICVVGAKDGLLISFDKKTGTEKWRSLSA
FT                   SEPGYGSPVIIEAGGVRQLLIWTPVEIAAVNPSNGNVYWKEPLQPDYAMSIMAPQKSGD
FT                   FLFASGIGNVGAVYELDRTRPGAKLLWRGTNKTALYAANATPLIVDGVIYGCDCNTSQF
FT                   RAVELSTGKRLWETFAPTTNERRARHGTAFLVQNGDRYFLMSETGELIIAQLSAQKYDE
FT                   ISRTRILEPTGEAFGRPVVWSHPAFANGHIYARNDKELVAVDLRDHAK"
FT   sig_peptide     285885..285968
FT                   /locus_tag="Plim_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            complement(287285..287659)
FT                   /locus_tag="Plim_0222"
FT   CDS_pept        complement(287285..287659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0222"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: bac:BamMC406_6000
FT                   TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66074"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNR9"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADG66074.1"
FT                   /translation="MVEFSLVFPVFMLVMLFFFEAWRVVQCQQTVDQAAFEAARVAIVP
FT                   GKTVADARARANVILASTNSTQASVTISPDPITESTEQVTVRVTLPLSDVGLFFQYFSP
FT                   NYTIESVMTLDHENARIGRL"
FT   gene            complement(287713..288903)
FT                   /locus_tag="Plim_0223"
FT   CDS_pept        complement(287713..288903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0223"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66075"
FT                   /db_xref="GOA:D5SNS0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS0"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADG66075.1"
FT                   /translation="MRKNSSGHRRVIHKPHPRRGAIAILAAFVMVALLALAGFFLSLSY
FT                   VELTRAELRAATDAAARSAVIRLVETQSTTSGRAAARDIASRFEVGGKALSLNDNDIQF
FT                   GRSTRQSNGSYSFAINGTPTNAARVFGRKTKTSAAGPVELPFGGFVGAPEYSTELNAVA
FT                   MRLDYDIVIVLDRSGSMGWDLSGVEFEYPEAVRQRPLVENYFSPPDPTGSRWAILSASV
FT                   NDFLTILNQRQVAARVGLVTYAGDYTFGKYSSVKLTVESDLTSTFSTITSKLTAIGQVP
FT                   LIGGTDIGAGITAAQTMLTTSSQARLKTGQPIIIVFSDGMFNQGTEPVSLAASAYSQSS
FT                   TIIHSVTFGATAQGRATMNSVTATAGKGLSLHANTAAELAESFRSIANAIPIVVTE"
FT   sig_peptide     complement(288790..288903)
FT                   /locus_tag="Plim_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.668 at
FT                   residue 38"
FT   gene            complement(288945..289301)
FT                   /locus_tag="Plim_0224"
FT   CDS_pept        complement(288945..289301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0052 TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66076"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66076.1"
FT                   /translation="MEMALVLPVLILVVFGTIAVSQIIHFRKGVVAATAEGIRIASRRD
FT                   VSSTEVTTLVRQILTGRRISQATITITPTEISNLRPGELIEIQVRANYTALGVEPLGWT
FT                   VPTEIVYRGAVLRE"
FT   gene            complement(289455..290237)
FT                   /locus_tag="Plim_0225"
FT   CDS_pept        complement(289455..290237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_3807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66077"
FT                   /db_xref="InterPro:IPR025193"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66077.1"
FT                   /translation="MKKYCGLLLILVAATWSTMHEACAQAAKNPFNLPKYTAVQKAKSD
FT                   TRSTQFANQVMPTFQQFIDKSLKEASQFKVAPDYVLDPTRLYLPLTTLQPVRVYFVHEG
FT                   AGYRNQLGVSIVDAGHGRSGSSTLIDPLTQGKLIFDDASFEVTQIKDKKGKVTSQSGGL
FT                   KAGDFVEIGTIQAGKQVDFFLCSDGANGTKNLLRNFPELNSDKLQHVIAVYFKDTHPGY
FT                   VMIGFEDIVGGGDLDYNDTLFVIDFGYDISIEKGDLPH"
FT   sig_peptide     complement(290163..290237)
FT                   /locus_tag="Plim_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.732 at
FT                   residue 25"
FT   gene            290633..291445
FT                   /locus_tag="Plim_0226"
FT   CDS_pept        290633..291445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0226"
FT                   /product="signal peptide-containing protein"
FT                   /note="KEGG: DNA-directed RNA polymerase, omega subunit
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66078"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66078.1"
FT                   /translation="MLKKLLFAGVGVLSLGALVFGAELPSYLFTSAKSLRSAVKAEVPV
FT                   EFEIARARELVEKLVPDIRKCMQVIAEQQVDTQQLRNQIASRSGNLDHQKQLILSQKAN
FT                   LSSGQGTFRYAGHTYSANDVQRDLSIRFERFKAAEQTLAADQKVLLAREQTLTANQEKL
FT                   ATMLKSKQDLEVQLEQLTARLETVRAAEAATSVTIDDSNLSRARELITNLNRQLDIKEK
FT                   LIDQSGQISGLIPIEESAIPQTTEDLARQIDNYFQPEAKPQAGVAQAH"
FT   sig_peptide     290633..290698
FT                   /locus_tag="Plim_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 22"
FT   gene            291689..293386
FT                   /locus_tag="Plim_0227"
FT   CDS_pept        291689..293386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0227"
FT                   /product="Serine/threonine protein kinase-related protein"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: bha:BH2504
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66079"
FT                   /db_xref="GOA:D5SNS4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG66079.1"
FT                   /translation="MRFQYAPQSRPLSGYVITRGIQRGGFGEVYEGLSAGGKRVALKLL
FT                   QRGTEIELRGVRQCLNLNHPNLVSIYDILYDNEASAWIVMEYIDGVTLDDVIANHPQGL
FT                   PHEEVAEWFSGIVQGLEYLHSRGIVHRDLKPANIYRTHGVVKIGDVGLSKLMDQVDALH
FT                   TQTIGTVHYMAPEVSHGRYGPSIDYYSLAVILYELLTGKVPFSGETTGEVLMRHLTHLP
FT                   ETTHLPLTLRPVLQKALAKNAAERYPSLQEFHEGVMSALVPAGFERVAAVAGDAVARSI
FT                   PTKTQQPVSFYEVKKDLPPMPALQSPVPITEFLPSGQKSGHRRLAHRKRAESNQLRHWS
FT                   PASDSNGELARLIPGGLLGGWSQAVFLTMVLSMGLAAALAIALPPFVPSPPWQNLTGMG
FT                   LLAAQSALVVLAFQTIFWWSRRESKPAPLTWMSSLLLGGMMGACGYLLMNYLMAENLLA
FT                   APEHAAMVRQLGAQKLRLDGGVPSWLSWVLYFASLVALGNWSQQASLQRDERFSAMTIL
FT                   FSTMAGWMLSFVIWFPPVWGCLFAAWISCVLQLSTPVIQVTTTYRESE"
FT   gene            293491..294666
FT                   /locus_tag="Plim_0228"
FT   CDS_pept        293491..294666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7201 Flp pilus assembly protein
FT                   secretin CpaC"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66080"
FT                   /db_xref="GOA:D5SNS5"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66080.1"
FT                   /translation="MSLTFGFLIIIILAVVVFGALTVGVILALLFFGIGQAVSPSREKN
FT                   QGSSQPRKTTPQALPADRAQDFGRDVSASRKPQKSHAGVIALVSAVLIGAGLLSLIGVR
FT                   TVATSVHITHHSGIESQTGFPRLEPLSGQFSEHVVIQPEHGPWAGPQPVESILTEQLRN
FT                   VPTWKASLPASSPALAPQTNKALNSAKATDAPRPQSTSGLEAHPADATQPENVPAVIVA
FT                   SLPEQAPLASTDFERLSPLPDWAVEISKVPPHHIHLVSGRFPTLAEAEADASQKLSAWS
FT                   ISEIQRRHPDLPPLNRTSIDPSAEVMAAVMQKAVEETEHQFGNATAKMYAVHLLISSSQ
FT                   FVPTVTLHRLHQLHEEQVSSQRLTILGVAGAGLALLAWGMMQYSRRKHSMA"
FT   sig_peptide     293491..293604
FT                   /locus_tag="Plim_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.514 at
FT                   residue 38"
FT   gene            294702..295391
FT                   /locus_tag="Plim_0229"
FT   CDS_pept        294702..295391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0229"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   pca:Pcar_3124 RNA polymerase, sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66081"
FT                   /db_xref="GOA:D5SNS6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG66081.1"
FT                   /translation="MSQEPSPTADENTREQWLIARIRAQEPGAWRELVDQHEPRLFAWM
FT                   KSRTGNRSTAEDLVQEVFLSFLRALPNFDDSRPIEPFINQIAAHLLIDHLRKEGRRQVV
FT                   STGTVVDDSSSGHMPFEKLVPQDSRQLKASSIFRGRETTAAIEACLAQSLKELVLRWQS
FT                   RGEFERLKCCELIIAKGFPNQRVAQLLSISEQTVANHKSYLLQQLRQRLAKAGLAETVL
FT                   SLLIDRH"
FT   gene            complement(295413..296402)
FT                   /locus_tag="Plim_0230"
FT   CDS_pept        complement(295413..296402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0230"
FT                   /product="folate-binding protein YgfZ"
FT                   /note="TIGRFAM: folate-binding protein YgfZ; PFAM: glycine
FT                   cleavage T protein (aminomethyl transferase); KEGG:
FT                   afw:Anae109_2780 glycine cleavage T-protein barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66082"
FT                   /db_xref="GOA:D5SNS7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS7"
FT                   /inference="protein motif:TFAM:TIGR03317"
FT                   /protein_id="ADG66082.1"
FT                   /translation="MNSHFQAMQIPFPVEQYFVRGQHRVRFLQNFCTNDVARLTSNTGV
FT                   EVFFPNVKGRIVGHGWIHALEDSLVMTIGAGTGTSLLPHLERYIITEDVTFTKAALKDT
FT                   WLVGGETANQLWAEISQQQQRDLAAESVHQMIAGVGWRAALMTGWSLPVVAVFMDEHAA
FT                   REELSTLASLAAIRKETPLDFDRFRASVGMGWMGIDYSDAQLAQESGRTAVAISFHKGC
FT                   YLGQEPIARLDAMGHTNKELVRLSTEVSLSDQDKSSWAGAELFADSEPKSVGVITTFCP
FT                   HDDQLGGVGLGYVRTKWQVENQMLHVGTPEGPTINVHVPLIPADERIR"
FT   gene            complement(296512..297303)
FT                   /locus_tag="Plim_0231"
FT   CDS_pept        complement(296512..297303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0231"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="KEGG: bba:Bd1941 ribonuclease III; TIGRFAM:
FT                   ribonuclease III; PFAM: ribonuclease III; double-stranded
FT                   RNA binding domain protein; SMART: ribonuclease III;
FT                   double-stranded RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66083"
FT                   /db_xref="GOA:D5SNS8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS8"
FT                   /inference="protein motif:TFAM:TIGR02191"
FT                   /protein_id="ADG66083.1"
FT                   /translation="MDEAAGQVPLTECEARLGYHFRSPELLMQALSHASAAKTRLESNE
FT                   RLEFLGDAILGAAVCDLLFRKYPKSTEGELTRIKSFVVSRHVCGLLAKELHLDQFVIIG
FT                   KGLCGTPNVPVSILSATFESVIAAVFLDGGFDAAKEFIIRLIEPHVEQMVGAEYGRNYK
FT                   SVLQQYAQKTLGETPRYDLLKEYGPDHLKYFKVSAALGEVVYAAAWGINKKEAEQKAAA
FT                   NALSELEGKPAPHSADELPPEIARLQASTGMNLAQEDIISS"
FT   gene            297818..298828
FT                   /locus_tag="Plim_0232"
FT   CDS_pept        297818..298828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A3383 cobalamin (vitamin B12)
FT                   biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66084"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66084.1"
FT                   /translation="MFIDWSAASVPSPSRPTANAIWIATQLSSRKKPESSYCRTRHEAC
FT                   RLMREIFRQCLKAEKRLLVGIDIALGAPKGLPQALTRRTDADWRDLWKEIEAQLCDDEQ
FT                   NTNNRFEVAANFNSRISPHQSGLNFRKATRSSTSLSSTAVGAISCELAHGIQGPYWGTP
FT                   HARAGSLTPPYSPKFPFRTTSGILLPRQRFVETLAPGTQETWKLCGIGSVGSQSLTGIA
FT                   RLEAFRKDPDFQPHLCIWPMETGWTVPEQRPLILFAEIWPGLLKQEVATQQALEPGRIR
FT                   DELQVLAWCRWAQAMSRNQTLSSYFRVPQGLTESLQSNAVTTEGWILGVTNTKLA"
FT   gene            298915..299328
FT                   /locus_tag="Plim_0233"
FT   CDS_pept        298915..299328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0233"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   atc:AGR_C_1673 hypothetical 15.6 kDa protein in MucR
FT                   3'region (orf5)"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66085"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT0"
FT                   /inference="protein motif:PFAM:PF02657"
FT                   /protein_id="ADG66085.1"
FT                   /translation="MTLNDWALELADLDDRDRMETIVELAETLPPLSADKQAAPLPENC
FT                   RVQECQTPVYLFAEVRDGLLTLEADVPRKSPIVRGLVALVVTSLNQQPIDQLRDLPLDL
FT                   LEKLHLTTALGMTRQQGVRGLMQRIRHAIESSR"
FT   gene            complement(299356..303783)
FT                   /locus_tag="Plim_0234"
FT   CDS_pept        complement(299356..303783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1757 outer membrane protein assembly
FT                   complex subunit YfgL"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66086"
FT                   /db_xref="GOA:D5SNT1"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66086.1"
FT                   /translation="MASDQELLQLVQEKTAEEFTAAEIALLRQRLPFSPELQQALSANL
FT                   SLQEALSTHYASIDLSVEKILLRAADKRQNAASQNVRQLKLLVGFLAIAMLVGAGALFW
FT                   PKVRNPLANNDLLVEEGQPEDRPAEPTPQTQATIDAAKASEAQLLAQNRGEKFDTTSPQ
FT                   GVDPKSATGKSDPAMTTPNQPVEGAMTTAQTVPVVPAAEVVVAAPPPWSEWLPNSSLPD
FT                   PEHPAAIERQPVSYRESVFAADLATMQLDSLQQNRFNDWLGPVAGRRADLHEHNHQKTR
FT                   TVQVNGLARLKAPWFTNSCLRLAMFDVNELSINVWSGKKGIQLRYFPHRQPAMWVAVDV
FT                   KRSGPDEAIDRKAAGEQFLGTDGSAWSRLGQGTIDLTWHEGKLLLIKQRAVLLEVPFEN
FT                   CPEQIELDGQYRLRGLDYLRVTDVPRRDPLGVLATLPDMEAVQPKTLEWEPTKDSRGEL
FT                   QQLESGAVLLTGNSREQPAEHFAKLPYQGFFDVSVQLNSATRGTGIYLGNSAGKPVVTI
FT                   QVHHNRRTGRNVVQLGHPHHGHDEVDYDPQHQPLLHLGEKQWWRLIGHSAGVMLFTSAD
FT                   GRTWSPVPDGYTQDLPLEPVATIGLQCLRGEAARAIEIGQLIIRPAIHIESIVDRSLLA
FT                   KLANEGPRPELTPSLSEAKWSEQVETNCPVGTNPEEWWFANAYWSLTQPIYRELSRKLQ
FT                   SRLINQIVMGRRPAVERLKAMAWLLPLQHAWDEWRARELAGQFGQIAADTVDQPAWPDL
FT                   DESLILWANTPLWTHTTLWNGLVRRDSKALNTAALLGSASEQLKTSHELLARWDLTHPD
FT                   QNPPYQYEMLVKRMRWLQALSSTSGDAPVLSRSWRHPLLLQLSKEGYNASAELQAALDG
FT                   EAFLDGCRVIASLVSTDQGELLPVATDPDLFVSLPAAIDRVMKQYPSLLAVMRDQMGST
FT                   GDVRIRQAMADGNIISIRNITLQFPQTMAAAQAHLWLGDRALSAGQWQDAIEHFAKAGA
FT                   IPDSTLEDAIQLRQWLLGAKLPDRFDPEKTLLRLRDDALQGTSWAGLVQTREFLKQNVW
FT                   GEAETTARNVALQPVPAVANSWESQVVFPFDPPAGKDADRSEYRQGDLWTRQLACLETD
FT                   HQLILHHRSRTVALDRATLNRKWQSDANEEPGSAIAYSHLPFNPVQAGSHLYVRRLVKE
FT                   GVELAALDLESGEIRWTYRGGNEGSEDRKVSVLSDGWYLFSRLGVIVERPVESDAVSIE
FT                   WHVLDARSGKLLESVPLIRIRDVLPGQFSITSTISDQKLWITAPGLSACITHRGEILWL
FT                   RRHVWVPRSIDTREFNKILNPPARVGDLVLVEPPGVSGVIAMHAESGAVQWTLPIDGLI
FT                   GRLGIVNSLWIGRSTDGLIAIDWATGKIVWQTSMNELVDAVALDEEQLLVARRSRTSKG
FT                   KKNLEIVWLDPRSGTILGQGTMEIPQQDEYQLGQLFSLDQRILGWAGVSNKRQRELIEI
FT                   TPQNNSPDSTKASD"
FT   gene            complement(303865..304419)
FT                   /locus_tag="Plim_0235"
FT   CDS_pept        complement(303865..304419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0235"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: sus:Acid_0793 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66087"
FT                   /db_xref="GOA:D5SNT2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG66087.1"
FT                   /translation="MVSAVDQELMQRVLEGDRAAFSQVIELHQRAIYGFLRARLAQAAD
FT                   ADDLVQEVFLRFYEARTRFDSTSLIRPWLLGIARNVLREWTRSVRRRREVGWTELCFDL
FT                   ESLTGGAAGTLDADVLENLPQCLEALGPSARQAIELKYRSEQKLCDIGHVLRRSEGAIK
FT                   LLVHRARLALKSCLERKLKKM"
FT   gene            complement(304469..305206)
FT                   /locus_tag="Plim_0236"
FT   CDS_pept        complement(304469..305206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0236"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   mxa:MXAN_1175 phospholipase/carboxylesterase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66088"
FT                   /db_xref="GOA:D5SNT3"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT3"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADG66088.1"
FT                   /translation="MNDPQAVSFGPLNAVAFSPEKPQWLVVFCHGYGASGTDLVGLAEA
FT                   IEEAAPEVAGRMEFLFPEAPIDMAEWGIPGGRAWWPINMQRLLSLTQAGSLLELVDEVP
FT                   PGIEEASRQLQSGIKARLQALDLPEDRLILGGFSQGAMVSTHLTLTGALQPRWLVLFSG
FT                   ALICRPAWTEYLSSHPDLGQKLNVFQSHGKYDPVLPFAGAQMLGQLLESSGIPLDFWAF
FT                   GGQHEIPGGVIEKLAKRFESLDQ"
FT   gene            complement(305307..307010)
FT                   /locus_tag="Plim_0237"
FT   CDS_pept        complement(305307..307010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0237"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; GAF
FT                   domain protein; Forkhead-associated protein; SMART:
FT                   ATP-binding region ATPase domain protein; GAF domain
FT                   protein; Forkhead-associated protein; KEGG: scl:sce0793
FT                   two-component histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66089"
FT                   /db_xref="GOA:D5SNT4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG66089.1"
FT                   /translation="MRLLDTEVSRTHAAIEREGDKFVLKDRNSSNGTFVNGAQVKSRTL
FT                   KPGDQIQIGRTILQFLQGDHVGSRRAADRVELLHQADGTDRSSIVGQMALTGGLPLKDL
FT                   PAAVSNNTDARLQATMNLQMLYRISEEAVRPSSSMTQILQRMLDLAIETLGADRGCVLL
FT                   RDAETEALQAVAVGFRGQESTIQDESSSLGASFREGTSTKEASAAKDPGEKTTGRIPVS
FT                   RTIVDYVVKSLQAVRTSDARHDSRFETGQSIVRAGIREAMCVPLQARHELMGVVYLDIT
FT                   SSAEEMILLGDQPRFSEEQLRVLAAIGRQAALAVENQRFQEAFVKSERLAAMGQTIATL
FT                   SHHIKNILQGVRGGSYLIDLGLGKTDTELIRKGWGIVDKNQGKIYNLVMDMLTFSKERQ
FT                   PEMKLSQLNDVAQDVVELMQPQAGEVETKLIFQPATQLPTSTFDPEGIHRAILNVVSNA
FT                   MDAVEHADDPRVVVQTGFDEPRDLLWVSVEDNGTGIAPENLSKMFLMFESTKGARGTGL
FT                   GLAVSQKIIREHGGDITVESQIGKGSRFVLTWPRLEDETQMPGMRTLVDG"
FT   gene            307388..307651
FT                   /locus_tag="Plim_0238"
FT   CDS_pept        307388..307651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0238"
FT                   /product="ribosomal protein L27"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: bbk:BARBAKC583_0310 50S ribosomal
FT                   protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66090"
FT                   /db_xref="GOA:D5SNT5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT5"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ADG66090.1"
FT                   /translation="MAHKKGQGSSRNGRDSNAKRLGVKKFGGQLVLAGNILIRQRGTRW
FT                   HAGKNVGMGRDHTLFSLVEGTVFFDQEGRRVNIKPVEVAVAS"
FT   gene            308317..308640
FT                   /locus_tag="Plim_0239"
FT   CDS_pept        308317..308640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0239"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: aba:Acid345_3527
FT                   TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66091"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT6"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG66091.1"
FT                   /translation="MAAVDDAYDAAIRLKNQGDLDGAAKSLEAILVEYPEHVLTYSALA
FT                   VILQKLGRHDEAIAHARKVTELEPHDSFSYTQMSVICQRCGRIAEAEEALARMRMMQAS
FT                   GMH"
FT   gene            complement(308861..311707)
FT                   /locus_tag="Plim_0240"
FT   CDS_pept        complement(308861..311707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0240"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_7497 peptidase, M16B (mitochondrial processing
FT                   peptidase beta-subunit) family"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66092"
FT                   /db_xref="GOA:D5SNT7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT7"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADG66092.1"
FT                   /translation="MIRRTMRLLNQVTAQAVLAPVLSTRMFLTRKGLTSRQSVLSGAAR
FT                   LSLLAMVIVSQIIFCSSSSKAEMPMKVTEIEGISEYKLENGLRVLLFPDPSKPTVTVNL
FT                   TVFVGSRHEGYGEAGMAHLLEHMLFKGTPDVPSVPKALQERGADFNGTTWLDRTNYFET
FT                   LPAQGDNLEFAIRLEADRMMNSHVKGEDLTSEMTVVRNEFERGENSPASILGQRMMAAA
FT                   FEWHNYGKSTIGNRADIERVPVERLKSFYRKYYQPDNAMLVVAGRFEPKEALRIIGETF
FT                   GKLPRPTRVLDNTYTEEPAQDGERQVVLRRVGDVAVVGAVYHIPSGAHPDFVAIDVLES
FT                   ILTMQPSGRLYKALVQGKKAASVSGAAYALHDPGVLRFMAEVAAGNDPQVVLDSMLDVL
FT                   NETASKGVTQEELERARLRLLKQREMGASDSAEIAIELSEWAAQGDWRLYFLYRDRLEA
FT                   VTVEDVNRVAKAYLQPSNRTVGLYIPTEKPERTSVPATPELAKMIGDYKGREETSVGEA
FT                   FDVSPLAIEERTLRTRIDGVQVAMLPKKTRSSTVVLRLTLRYGNEKSLFGLAKACEFLP
FT                   PMMLRGTKSLTRQQLQDALDKNFASLSAGGNAGEATFVLETKRQNLVAVLGLLKQVLRE
FT                   PAFPESELAVIKQQVRANLEQGLTDPQTLAVKTVSKALSPYPAGDVRSVPTVEEELKLV
FT                   EAIEVEGLKLLYNDFLSAQVGQIAIVGDFDPAEVESTLKGVLADWKSDQTYERISRTGS
FT                   VPITAEVKRIQIPDKANAFYFGGAVMPMSDDHPDYPAMIVGNYVLGAGALSSRLGDRIR
FT                   QKEGLSYGVGSAFRAAMLDQRATLSLYAIANPANMEKVNAAVNEELARLLKEGVTQQEL
FT                   DAAKQGYLQAQQVGRTEDPKIARLLEENLYAGRTMQYVAKLETAIGDLTTEKVLEAVRR
FT                   HIHPNQILTVIAGDLAKE"
FT   gene            complement(311933..313867)
FT                   /locus_tag="Plim_0241"
FT   CDS_pept        complement(311933..313867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_7492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66093"
FT                   /db_xref="GOA:D5SNT8"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66093.1"
FT                   /translation="MTIESHSQRRQKSTVKAQSGQNLPEVDLRERVGLMMAWLMCLLAS
FT                   IAAGLDFLVDTWQPNLALLQAGLLLILPFVLNVKGSQTNSPLSPASTPSMFAKWTPLER
FT                   VYPLWFSQTILALIALAMIGSFGTQLLGTPPCYHDEYSYLFGAQTIAGGHWTAPGPPAF
FT                   PALFDQVHVLNEGTPPDGRMASRYYPGTSLWIWPWVMVGIPILGHWLAQVWLVLATNLI
FT                   GRELGAPRTGFLAALMLALSPGLATFGNLLLSHHPTLAGLALFWLMMLRWLRTHQPLDS
FT                   LLAITGLSFTMLCRPATAFAMGLPFAIPVLAWLFRRSTENSPSSTLTRKASSLLAMLIP
FT                   IVAGWGIMLSYNHATTGSAWQSPYQLYTATYTPRHVYGFNNGIRGDQSNSPKIWKAYDQ
FT                   WADNLTWPLALQNLTTRFFGSLLWTFDPLFAWAACLLYWFWSPPDSRWRWLMAGILTIH
FT                   LVHFPYWYPGIMGWHYVFESAPLIALAMAQMAISLADRWAKEQRPVAIHWLLVMCIMAG
FT                   LGANASIPGLWDSRRALAYGSIEYPKVRVYQQFDDWLTRALPDEPVLVLIKQDAGEIAI
FT                   DHVTNEPGWQAKVIRARYRPEILDPQNKAALDELAAAFPGRSFWLADPKERSLQQLRQP
FT                   DMNPAHDGK"
FT   gene            complement(314089..314241)
FT                   /locus_tag="Plim_0242"
FT   CDS_pept        complement(314089..314241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66094"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66094.1"
FT                   /translation="MNFKLVNQYLSRLMVTSRHETTLKLKYRFTQDTVNSLLLLQLERP
FT                   AAPFA"
FT   gene            314407..314736
FT                   /locus_tag="Plim_0243"
FT   CDS_pept        314407..314736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0243"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: ppd:Ppro_3380 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66095"
FT                   /db_xref="GOA:D5SNU0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU0"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADG66095.1"
FT                   /translation="MAGDHVLEITDANFQSEVLDSSTLTLVDFWAPWCGPCRMLAPTID
FT                   ELATEYAGKVKIGKLNTDENPRIPSMHGISSIPTVLMFKGGIIVDKFVGVVPKAKLAGS
FT                   ISTNM"
FT   gene            complement(314896..315156)
FT                   /locus_tag="Plim_0244"
FT   CDS_pept        complement(314896..315156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66096"
FT                   /db_xref="GOA:D5SNU1"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66096.1"
FT                   /translation="MMRAAFFGLGAFVALTGYSFLVVDKFVMSGEHEERAKGFRGMLTS
FT                   PETIHERTKDVFDPPEWSAFVLMSVGCVTMLYAAALPKHGH"
FT   sig_peptide     complement(315091..315156)
FT                   /locus_tag="Plim_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.599 at
FT                   residue 22"
FT   gene            complement(315304..316470)
FT                   /locus_tag="Plim_0245"
FT   CDS_pept        complement(315304..316470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0245"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   mxa:MXAN_5195 tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66097"
FT                   /db_xref="GOA:D5SNU2"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU2"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADG66097.1"
FT                   /translation="MTEQPVPLLAPSAWPELTSQTAGVGGVWKQSPEDFLVEEIPAYLP
FT                   CGEGEHLFLWIEKRNLSSEMLVAQLSKQLAVPRSEIGMAGLKDRQAITRQWVSVPTRAE
FT                   KLVPAVESDDLQVLEARRHRNKLKTGHLKGNRFVAILRGVEPDLSKIDAITRQLQAQGC
FT                   PNYFGMQRFGHQHSTWKLGWQLLLGQISPQDIPAPRRKFLLRLALSAVQSGLFNEVLAQ
FT                   RLRDGLFSTVLCGDLMEILPAGAKFLVTDAAADQPRFDSWEISTTGPIFGVRMRSPGGE
FT                   VHARELAILQKLVLTIEHFQKFSSLMEGTRRPFRFLPAGLTCELLPANSSDHETPRGDL
FT                   RVSVELPAGAYLTVLLHEFQKSPLEAAESPDSAGNSEDADEIASQSAD"
FT   gene            316690..317280
FT                   /locus_tag="Plim_0246"
FT   CDS_pept        316690..317280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0246"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: tgr:Tgr7_0195 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66098"
FT                   /db_xref="GOA:D5SNU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU3"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADG66098.1"
FT                   /translation="MALEIVKYGHPALRHKSTPVTEINSELRKAIAEMFELMYAAKGIG
FT                   LASNQVAIPRQFFILNLTGDAAEKDEEVVFINPVILNRKSSCEGEEGCLSFPGLYGPVK
FT                   RAGEVLIEAFDLDGNCFEMTLSAKEDDLAVRAVQHESDHLDGMLFIDRMTDRARKERQV
FT                   EIDQFEQDFLARQAAGEIESMDVLKRKLATWPN"
FT   gene            317268..317504
FT                   /locus_tag="Plim_0247"
FT   CDS_pept        317268..317504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0247"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: xcb:XC_1016 sulfur carrier protein
FT                   ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66099"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU4"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ADG66099.1"
FT                   /translation="MAQLNAQQSPGEIVVTINSQERSLPAEMNLTQLIEVLKLEPRYLA
FT                   IELNGQVISRKLHATTRLTEGDVLEVVTLVGGG"
FT   gene            complement(317521..318204)
FT                   /locus_tag="Plim_0248"
FT   CDS_pept        complement(317521..318204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Os03g0411500; hypothetical protein; K01358
FT                   ATP-dependent Clp protease, protease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66100"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66100.1"
FT                   /translation="MTKSSKKPSKPSPFRPLPAYPGPSISWSPIVPNPEWEMTIAGDLF
FT                   EQQTELLEKLVELPRRSAGLIYIDSCGGNAYVGLALASIIRLRGLRAAAVVTGECSSAA
FT                   LMPLAACRERYVTPHASLLFHPIRWQSDDQLKLEEAVEWARHFRWMESDQDQLLARLFN
FT                   CSVELITEWSRPGRFLSGRELADAGLAHLLDLFDSHDLWQQIEKHRFEQAHKKGPDRQT
FT                   ELAWA"
FT   gene            318453..318725
FT                   /locus_tag="Plim_0249"
FT   CDS_pept        318453..318725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66101"
FT                   /db_xref="GOA:D5SNU6"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66101.1"
FT                   /translation="MTNSRTVHPANQRPKSARLIFRTGFLWTAVLIFPEMGDLPSAAWA
FT                   QPAAPAQPTAPVARPVATISWLDAGIFAALAGGALFAVCRASNRM"
FT   gene            complement(319067..320371)
FT                   /locus_tag="Plim_0250"
FT   CDS_pept        complement(319067..320371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0250"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG: cps:CPS_4249
FT                   outer membrane protein assembly complex subunit YfgL"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66102"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU7"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADG66102.1"
FT                   /translation="MVCLLTARLRLSASFSSRSLCQFLGVASLLVMLSVSFSKTRVLAA
FT                   DWPQFRGPSGEGLSSETMLPIEWSEEKNIRWKTEIPGRGWSSPALRDGKIWLTTAVDDG
FT                   KQLRAICVDAAQGQILHDVLVFELDDPGAIHSKNSHASPTPWIEDNRIYVHFGAHGTAC
FT                   LDPSGKILWKTKLEYDHRHGPAASPVVVDQLLIISCDGDDKQFVVALDKLTGKEVWRTS
FT                   REGAMAYCTPLLIQVPLPDGTKQAQVVCPGGEWVIAYNPKTGEEIWKVRYPKGYSNVPR
FT                   PVYAHGLVVVSSGYNTPVVFAIDPTGQGDITETHVRWQMKKGAPLNPSPVVVGDEIYFI
FT                   SDGGIASCVDMKTGKVHWQQRIPGNYSASWVFAAGKLYITNEAGLTTVVRPGTEFEVLA
FT                   ENPLPGRTLATLAPVDQSIYLRTDHHLYRIEAPKP"
FT   sig_peptide     complement(320237..320371)
FT                   /locus_tag="Plim_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.606 at
FT                   residue 45"
FT   gene            complement(320819..321142)
FT                   /locus_tag="Plim_0251"
FT   CDS_pept        complement(320819..321142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swd:Swoo_1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66103"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66103.1"
FT                   /translation="MTHLPKVEICMRSVFDESALLKVLQRCRDIVAQSEDSDWSCMDAK
FT                   DILERLDHSIRRLEQSLTVKIDELRFLFVVTGPLQETSMSNGWADEFLVLAERFDEIIG
FT                   ESS"
FT   gene            complement(321126..321509)
FT                   /locus_tag="Plim_0252"
FT   CDS_pept        complement(321126..321509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0252"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: scl:sce2720
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66104"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNU9"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADG66104.1"
FT                   /translation="MNDDIDGEELLRRYSNGERVFVGVCLADGSVLEGANLQGTTFQDG
FT                   FFSDIDARRTNLQGVTFRNMNLKCTDFRGADLTDAVFENVLIEHAAFKGAVVTNTVFTG
FT                   MMFHGQEIKGFRPDEWDWDDSPA"
FT   gene            complement(321506..321892)
FT                   /locus_tag="Plim_0253"
FT   CDS_pept        complement(321506..321892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66105"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66105.1"
FT                   /translation="MKIDWLAASLVSKGRLVRPPLNPSKLTSEHLPDICLRMHLILDSI
FT                   EFTRCEGRLINLEVFEPIDKLYSDLLHKTTNHLGDWMDCIERFGDYYELSGRDVIEVSP
FT                   RSVSDQSYMFEQLSIDLVDGLTRK"
FT   gene            complement(321906..322328)
FT                   /locus_tag="Plim_0254"
FT   CDS_pept        complement(321906..322328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0254"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   mfa:Mfla_2363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66106"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV1"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADG66106.1"
FT                   /translation="MKSHTEYLTFNLPARMAFENITPKIEAIVRASGVQEGLVLVNAMH
FT                   ITASVFINDDEPGLHSDYKKWLENLAPFDASPQRYAHNRTGEDNADAHMKRQIMGREVV
FT                   VAITKGQLDFGPWEQIFYGEFDGRRDKRVLVKVIGE"
FT   gene            322864..325218
FT                   /locus_tag="Plim_0255"
FT   CDS_pept        322864..325218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66107"
FT                   /db_xref="GOA:D5SNV2"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66107.1"
FT                   /translation="MACWTILCGNSLCLIEARGENTTAPEISSAAISGTPARPWATLEV
FT                   GVAGFWQPGIWAPCRLSSSDLLPETTSVQLATPDVDGSPVSLRLARQASLSGKRPVLWS
FT                   GFIKLASPSAAITISQLDEAGKLLKTDRIEAGFAPGFQSGHGLEERLVATIGLPQATRN
FT                   LLNQLKGMAASRTRGPLQVVHLESPAELPQDLAGWSAIDYLLVGGTATFQDVESQKLKA
FT                   WVETGGTLWTSLQLVTDAEATGLSPEARLALVSRGLASWLPADLTTEVTIVRELGSLEK
FT                   LAQSDKRIPQSGRISLPRFRMRQGELLAASRDDQLLVRSAYGLGVVTILALDPAKTPLQ
FT                   NWEAQPRLWQQLAAESVTRSESSLESSRQLVSTGVTDLATQLSGVVETFPGVQRITPGL
FT                   LMATLLVIVLLVGPIDYLIVHRLLKRPALTWITFPAMVVLLVMGMSLWAAKTNGIEATS
FT                   QTISVVDLDPVAQVGRTFSLHAIYGAEPNRLVVKAKSQWPQAQRVTGSEDDLPILSWWA
FT                   PPEGSLGGLLRPGGNFFAAAPYELEPQKSMLNGLPVEHWGTRLLQSESRYRIPEPLFEA
FT                   NLETNGLGKLTGTIRHKLPAPITDWVLVHGNRLYRWLDRGDEERIVPLEANFVWRVDQP
FT                   GITQRELRGFMTGARARTVKGDASGAGGTIAVEQAAYNALGSDPVDIVRMMSFHEDIGG
FT                   AGYTGLTSKLISGADLSMQLRLGKAILVGRIAQPATSLEIDADNYLRPSKGSKGPTQTK
FT                   SGEVITIIRCILPVTSSSGGELAPLPKLNSK"
FT   gene            325343..326269
FT                   /locus_tag="Plim_0256"
FT   CDS_pept        325343..326269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0256"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mxa:MXAN_6475 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66108"
FT                   /db_xref="GOA:D5SNV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG66108.1"
FT                   /translation="MIETKQLTKRYGDLIAVNEINLSLREGDVFGFIGPNGSGKTTTMR
FT                   MLATLLNPDYGEAYVCGKSIYTNQEEIRRLVGYMPDFFGVYDDMTVLEYLEFFAASYRI
FT                   SGPARRKICEEKLELVDMSFKRDAMVNQLSRGQTQRIGLARVLLHEPQVLLLDEPASGL
FT                   DPRARIEIRNLLKRLGELNKTVIVSSHILPELADVCTRVGMIEKGHLIVDGYVDEVMRK
FT                   ARQQILLQIQVRERLEEAAKLLEQHPQISKIEIVKGQIHATLALEVLDYSSIPSTLIEN
FT                   GFKLTLFREEEVNLETAFLSLTRGLVQ"
FT   gene            326315..327367
FT                   /locus_tag="Plim_0257"
FT   CDS_pept        326315..327367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0257"
FT                   /product="H4MPT-linked C1 transfer pathway protein"
FT                   /note="TIGRFAM: H4MPT-linked C1 transfer pathway protein;
FT                   PFAM: Hydantoinase/oxoprolinase; KEGG: met:M446_5788
FT                   H4MPT-linked C1 transfer pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66109"
FT                   /db_xref="GOA:D5SNV4"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV4"
FT                   /inference="protein motif:TFAM:TIGR03123"
FT                   /protein_id="ADG66109.1"
FT                   /translation="MSNSHPAIVGLDVGGANLKAWHAGGQALAIPFALWKSPQELSSQI
FT                   AAMLQQLPAADRVVVTMTGELADCFATRAEGVEFIVRAVEQAVRSVLPDSIIQFWQTHG
FT                   KFVAPNDAVASPLLTAASNWQALASMVGLLFPQDDLLLLDIGSTTTDLIPILQGQASAE
FT                   GRTDLERLAAGELVYTGVRRTVVCHMLPSFQGELGRYGHVSIPLSSELFATSLDVYLLL
FT                   GLIEEEPENCETADGRPATKEFAEARLARQICSDQSELTTHDVIKLAMAAAAAQQQQIV
FT                   QATRRVINCASRPIKKIVLSGSGEFLGRQVAVQACFPMEEILSLKDYWTTAGSEVACAR
FT                   ALVELALQGF"
FT   gene            complement(327445..328707)
FT                   /locus_tag="Plim_0258"
FT   CDS_pept        complement(327445..328707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0258"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG: hne:HNE_0773
FT                   PQQ repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66110"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV5"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADG66110.1"
FT                   /translation="MVRPLTRANISPVKPLFSVGWLSAGLILALGIHANHRLLAEDWRQ
FT                   FRGSSSTAISRSAAPPVEFDSSGKNVAWKVDLPGRGLSSPIIIDDRVVVTASSGPRQDN
FT                   LHILCFKASTGELLWERRFLATGRSLTHPKTCNAAPTPASDGEKIFAFFSSNDVICLDL
FT                   TGQLLWMRGLTLDYPNASNSLGMSSSPVVAGDVLVTQVENDSESLTTGLNTSTGETLWK
FT                   LDRPRRANWTSPLLLADGQTVLLQSSKGADAVDARTGNILWSFGEGAATIPSSAREGET
FT                   IFIPSNGLVALRPANSNTPPEKLWQENKLKPGTATPVVAEGKVYCLSGAGVLLCANVDK
FT                   GELLWQLRLEGPFSASPVIADRKLYCVNESGKCFVVDLTGSKGTIVAESLLDETILATP
FT                   SLSDGALYLRSDAHLWKIATP"
FT   gene            complement(328842..330053)
FT                   /locus_tag="Plim_0259"
FT   CDS_pept        complement(328842..330053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_0259 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66111"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66111.1"
FT                   /translation="MVFRAQSPFCSRTTSQPGDAIKPSIYRIGLTLAALLLFTPLTWAN
FT                   DKTASLADLVARIKSIGLKGEGYPAAVAAQKELSSQGPEALLPLLDAMEGASPLAMNWL
FT                   AGAFDTIADRSLRAGAVSQESGAGIPAVAFEKVLLDRTRSATPRLLAFEWLVKVDPAAQ
FT                   DRLIPGMLDDPSADFRRLAVARLIAAADASKDDAERLDFWKKGLSGATDEDQVKVLVDH
FT                   LKAAGVTVDLARHFGYLLEWNLIGPFDNSGREGFAKTYPPEASRDLAVPLQGREGEVKW
FT                   EPFTSTDKMCEVNLIPIFKNYRDSLAYAVTNYKAAKAGPAQVRLTTPNAWKVWVNGKLV
FT                   FARDEYHRGSMFDQYVIPVTFQEGNNEILLKICQNEQTEDWAQKWFFKVRITDSSGKAI
FT                   LPAE"
FT   sig_peptide     complement(329919..330053)
FT                   /locus_tag="Plim_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.921 at
FT                   residue 45"
FT   gene            330322..330936
FT                   /locus_tag="Plim_0260"
FT   CDS_pept        330322..330936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66112"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66112.1"
FT                   /translation="MKFVHLTPQPSISRVKRSGIRTGQGRRGRGVYAVPLMLLPQVAYI
FT                   DDETFVAADPRSSTTLWTWLASLRSRHRNLAVVTFRTTPDHWPADLYIELKAGVGTDWL
FT                   STVDPELAFIAEEDLQFVREAHSQGFVADLKLSVRNEAALGKILHTVQSHGFRTLDQYD
FT                   ESIEIIFSSPIPSKLIDRVTPLYRTNINFKESRDQDRDIGN"
FT   gene            complement(331071..331706)
FT                   /pseudo
FT                   /locus_tag="Plim_0261"
FT   gene            332137..332634
FT                   /locus_tag="Plim_0262"
FT   CDS_pept        332137..332634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0262"
FT                   /product="regulatory protein MarR"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: aba:Acid345_2954 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66113"
FT                   /db_xref="GOA:D5SNV8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3U2R"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG66113.1"
FT                   /translation="MNERSRPLRFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQ
FT                   YNTLRLLRSVHPEGMATLQIADRLISRAPDITRLIDRLDDRGLVLRTRKPENRRVVEVA
FT                   LTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELARTPHEEPGSRWIADRSR
FT                   PS"
FT   gene            332698..335451
FT                   /locus_tag="Plim_0263"
FT   CDS_pept        332698..335451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0263"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ppd:Ppro_3226 ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66114"
FT                   /db_xref="GOA:D5SNV9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNV9"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADG66114.1"
FT                   /translation="MVPSLPNANTGSKDITPADGQRAEYAQTPEEVLARLQVSLDHGLA
FT                   SEEVARRQARFGPNRISQQHSTPLWLKFIQQFHQPLIYLLLVATIVSLSLHEWVDAAVI
FT                   FGVVFINAIIGFLQETKAEKAIDALGRMVAVQTSVRRDGLRKSVPAETLVPGDIVLIQG
FT                   GDRVPADLRLCLQKNLQVEEAALTGESVPATKQINPLPIQTTLADRRNLAFAGTLVTAG
FT                   FGEGVVIATADATETGQIAGLMSNTVDLSTPLTKNIAQFSRLLMVVILLLALAVFALGI
FT                   LRGEPAADVFMAAVALAVGAIPEGLPAAVTIVLAIGVSRMAQRKAVIRKLPAVETLGST
FT                   SIICSDKTGTLTQNKMTLVEIYAAGTCYHVSGTGYEPSGEFSHRGKSIAPWDHPALIEI
FT                   LRAGLLCNESNLREEAGLWEIEGDPTEAALLVAAHKAGLHHRHREDPWPRHDMIPFESE
FT                   HMFRAVLHETPDENRVIYIIGALERLLPRCDQAVNQASQTVELDAAEIQGQAEAMARRG
FT                   LRVLMVAKVAGEDQQRELEHDHVAGNLIFLGLTGMIDPPRPEVIDAIHECQQARIQVKM
FT                   ITGDHVATARSIAQRIGLGDETLASITGSELEQISNEDLPLLAEKTTVFARVAPEQKLR
FT                   LVQALQSRGHIVAMTGDGVNDAPALKQADIGIAMGITGTEVAKGAAAMILTDDNFATIK
FT                   AAVEEGRGVFDNLVKFIVWTLPTNVGEAMVLFVAILLATELPILPVQLLWINMASSVLL
FT                   GLMLVFEPHEQNLMQRPPRNPREPILTFPLFMRTGLVSLIILLGSFWVFQMEQSRPGST
FT                   LAQARTAVVNVIVMVECAYLLNCRCLHRSIFSIGVFSNPYVPAGIATMLAAQVLLTYLP
FT                   LMQTLFGTASLSFETWLRIVAVGVISFLIVEFEKWVRFHNSKSNQN"
FT   gene            complement(335474..335830)
FT                   /locus_tag="Plim_0264"
FT   CDS_pept        complement(335474..335830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66115"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66115.1"
FT                   /translation="MAKCDQGYLCEVCGEEVEDLSESDLYLRFIIGEVPVRDLLTSPER
FT                   HLKCHPFLAQFILDDRFEPVKLDSPFSKENLDPAERSRMEALVTRGFQRLQELRTLPPM
FT                   PFAHYPLPEFQTAG"
FT   gene            complement(335856..336794)
FT                   /locus_tag="Plim_0265"
FT   CDS_pept        complement(335856..336794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0265"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: gbm:Gbem_2752 undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66116"
FT                   /db_xref="GOA:D5SNW1"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW1"
FT                   /inference="protein motif:TFAM:TIGR00055"
FT                   /protein_id="ADG66116.1"
FT                   /translation="MITPKSDVCKLFPILWFGKTAWLKLTVWLKLTEQWMLLDMSMVST
FT                   HTSLEDAPATLAPNSQLPDSQLAIESAAPVRPRHIAVIMDGNGRWAQRQGLERLEGHRR
FT                   GVQSVRCVVEECVRLGIEQLTLYCLSSENWKRPKSELDFLMALLKEFLIAERPEIIRQN
FT                   LQFSVIGRRTELPEDVLIEIDTTARIAESHTGMRLCLAINYGSRAEIVDAVRWIAHDVA
FT                   SGRLSPEAIDEDLISARLNTREMPEPDLVIRTAGEMRLSNFLLWQISYAELFVTTTLWP
FT                   EFREPELQAALEAFSRRQRRFGGLNQPECHR"
FT   gene            337151..338410
FT                   /locus_tag="Plim_0266"
FT   CDS_pept        337151..338410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0266"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: ank:AnaeK_1273 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66117"
FT                   /db_xref="GOA:D5SNW2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW2"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADG66117.1"
FT                   /translation="MAILATGLTLEQFLSGYAGEFTGFLLAVLIHTLLLFHVFAVSPAF
FT                   FIWLERKVSGRIQDRLGPTRVGGKFGWLQSVADGIKLIQKEDLAPAAADQWLFRLAPYL
FT                   ALVASFTVFMVLPFSRGWAAVVIESSVFLALAIISLEVLGIILAGWSSGSKWALFGSMR
FT                   EAAQMVSYEIPLALCALIPVMAVGTLNFVTIAEVQSGFFLTNWLIFHDPFTFVAFFVYF
FT                   TVAIASVKRAPFDLAEAESELVAGFHTEYSGMRWSYFFLAEYASMLSVSCVAVLLFLGG
FT                   WWSGTGLEDLLAPVRNWGQNFPVQGFSAGNYALNLLGAHIFLFKASLLVTVQIWVRWTL
FT                   PRLRIDQVMTTCLKYLIPISCALFLGASLWPLTLTTILGRPMLLGRPVGDRLYEASHHS
FT                   SSLPAATNLTRTPAAKEVVR"
FT   gene            338407..339279
FT                   /locus_tag="Plim_0267"
FT   CDS_pept        338407..339279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0267"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: afw:Anae109_1283 NADH-
FT                   ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66118"
FT                   /db_xref="GOA:D5SNW3"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW3"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADG66118.1"
FT                   /translation="MTVLQFLFAVFASTTCLGAVMVALTQNIVRMAFWLMVSVASAAGL
FT                   FFLLHADFLAAAQLLVYLGGTVVILVFGVMLTAGGRTKSLSPTGGETILAAALALSLIM
FT                   LLLFTVGSVDWERLNTLAKADQILPSAVQPENHTEPQLTESSPTGDERSPVLGAGRNGD
FT                   TGHALGSAMIGFRPQWNRENQLVLGTGYLLPFEIISVHLLVVLIGAAYLARAKRQLPSS
FT                   RRSTDATSTSLLWDQDSAQLDSSGSANPALSHSSPVRDDLSRSQNLVSGTGFSMFSSES
FT                   PSQNSGEAT"
FT   sig_peptide     338407..338484
FT                   /locus_tag="Plim_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.641 at
FT                   residue 26"
FT   gene            339276..339578
FT                   /locus_tag="Plim_0268"
FT   CDS_pept        339276..339578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0268"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   afw:Anae109_1282 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66119"
FT                   /db_xref="GOA:D5SNW4"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW4"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADG66119.1"
FT                   /translation="MSLGAYLAVSAVLFASGLTCMMTKRHALGVLMGVELILNSACLNL
FT                   IAFARYTTLGIDGQVFALFVIVIAAAEAAVALAIALNYYNNFLTVDVDRGDELKR"
FT   sig_peptide     339276..339359
FT                   /locus_tag="Plim_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.862 at
FT                   residue 28"
FT   gene            339671..341968
FT                   /locus_tag="Plim_0269"
FT   CDS_pept        339671..341968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0269"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: tmz:Tmz1t_1753 proton-translocating NADH-
FT                   quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66120"
FT                   /db_xref="GOA:D5SNW5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW5"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADG66120.1"
FT                   /translation="MLAWLLPLAGCVVISVLRLKLSRLSAVPGWIGTGSLLVAFCLSLI
FT                   SAGVWLMTSPAETAAFQASSVSDVAAHETGNLLQRRLVGHWYSLAKFGEIDFPLGYAID
FT                   ALTVLMFVLVTMISLAVHAYSLVYMADEQTESYQDHHLDHSAGETSERPGRFAHFYAAL
FT                   GLFTFAMLGIVLAHGLLQIFIFWELVGFSSYLLIGFYHERRTARLASMKAFLMNRVGDV
FT                   GFVLGMTILLATCGTLLLYPVHDLNGTSASSVPMALPEAFQAAVEKAVPSQAIHDQANL
FT                   IPTEQGISYALLVAAGLGLLAGCVGKSAQFPLHPWLADAMEGPTPVSALVHSATMVAAG
FT                   VYLAARIAPLLLPEALLLLAYMGVVTLLLGASMAIVARDLKLVLAHSTISQLGLMLLGI
FT                   GVGAWEAAIFHLITHAFFKSLLFLGAGSVIHTTHHEQDLEKLGGLRAHLPLTSLTMLIG
FT                   VIALSGLAVPYVTIFGESLGFSGFHSKDAIVSGTMAFVLKNPHHILLLISVLLGACLTA
FT                   AYSLRLWFKLFARDTPVDPALQQVHEGPWLMTWPLVVLAFFAAFCALGGEEGFVSTLVE
FT                   ESLSPAPAWFSDSTGEVVSIQWTNASDRHAVHGTAGAMALAAAWLGALIAWALYGLQAI
FT                   SSKDLSHQLTPLVRLASHRWYFDTLYRGLLVLPILNLARHTAWIDRILIDPFIDGCARL
FT                   SERVSHASQWFDEAMINRFFDNMASSVWASGLSLRKAQTGHIRQYVLLATMAVIVLFLI
FT                   LFAWMPGDRAGR"
FT   gene            342110..343789
FT                   /locus_tag="Plim_0270"
FT   CDS_pept        342110..343789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0270"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.5.11"
FT                   /note="KEGG: afr:AFE_2618 NADH-quinone oxidoreductase, M
FT                   subunit; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66121"
FT                   /db_xref="GOA:D5SNW6"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW6"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADG66121.1"
FT                   /translation="MFADPQFLMSCALFLPVLWGLGLFGFPSRAVSAIRWYALAGACCE
FT                   LAITVQLAGIALGWIDASPAVNASTTSLRNDILLGMSLPWIPTWNVNYSLGVDGFSLPL
FT                   ILLTSLIFVLSIVASWSIKTHIRGFLFLLLLLETGVMGVFLALDFFLFFVMWEVMLLPM
FT                   YFLIGLWGGPRREYAAIKFFLYTLAGGVCLLMAMLMVYSASGGSFDLLELARMAQGQAP
FT                   KPGMDLDQGIALTAAMGDTSLQWRVFVLLLIAFLIKLPAVPLHTWLPDAHVEAPTPVSM
FT                   ILAGILLKLGGYGFLRIAIPICPLGFAEWAWFMVALGVFCVLYGALAALAQSDFKRLVA
FT                   YSSVSHMGYVLMGLGAFRFQELTGVVLNPDFSTMGLSAATFQMVAHGIVSAGMFFVVGV
FT                   LYDRVKHRDLRQFGGIASLQPHFSAIAAGIFFAGLGLPGLCGFIGEAFSIFSVWHVDRF
FT                   FSVGGALGMILTAGYILWALQRVYLGPTYTGPNREYLTEINFREYTVGYILLAFAIGLG
FT                   VYPAMALNVIEPASRQLVQQISGSQERQLSLNRASIESPLDK"
FT   sig_peptide     342110..342202
FT                   /locus_tag="Plim_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.651 at
FT                   residue 31"
FT   gene            343905..345692
FT                   /locus_tag="Plim_0271"
FT   CDS_pept        343905..345692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0271"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: afw:Anae109_1279 proton-translocating NADH- quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66122"
FT                   /db_xref="GOA:D5SNW7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW7"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADG66122.1"
FT                   /translation="MTLDDLFADFLANGTGRALVLLAPELLLCATIIATLLWRLLNLDR
FT                   YVPVAAIATLGVVVSLGWAGWQLQASILQLQPAEILFTGMIRLDRFALFLRVYLLLFLV
FT                   LQIVLTTLGGIPDQEDSPDFYTMLCGAVVGLLLMTSAHHLLLVFLALEMSSVPGYVLAG
FT                   FLKGRRQSSEAALKFVIFGSASAGLLLFGVTLICGLAGTGDLSLVGSRLEAVISIDGAT
FT                   LANPAVRTLLLALVMIFAGMAFKLSLVPFHFWCPDVFHGAAAEVGAFLSIASKGATLAL
FT                   LVRLVLGMVAGGELEAFWNLLAQGLGVIAAITITFGNLAAFGQTNIKRLMAYSTIAHAG
FT                   YLLIPIAVLAIPALAGVNQIASTVTPAPSTNDVLQTQEMLASSVAVRAVESMLYYIVVT
FT                   LFMNLGVFSCLILVRNQTLGESIDDFRGLASQAPVLAVAMSLSLASLIGLPPTGGFVAK
FT                   LMLFSSLYDAGAKLPLFYAVLIVGVVNILLSLLVYLKLFRAMFFDQPVEGAPPVCIAPF
FT                   SMATMFVVTVSIPVLSSGIDVSGLSRLSRDAAVSLWDQTQDESRKSSSLVPELKKPPVA
FT                   SETVQGNLVSGALSNGDHP"
FT   gene            345689..346147
FT                   /locus_tag="Plim_0272"
FT   CDS_pept        345689..346147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66123"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66123.1"
FT                   /translation="MTANSSAHRKLIHHNRSLSELAVQLKRSFLQYLAYTSPYIPPEAH
FT                   SIWRTLGQLAETQLSHAEAILDLLSDRRFVALDSAFPMEFATHHYVSLNYLLRPLCLDQ
FT                   QQRASLARQAAHELMDDVEARPLLERIASGEALISQEIEKLQQGIAQN"
FT   gene            346571..347695
FT                   /locus_tag="Plim_0273"
FT   CDS_pept        346571..347695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66124"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66124.1"
FT                   /translation="MPLMWDVAPRTALSADSLPELLSSAWPQVASVDLSLGRAAHPPAV
FT                   DVLGPALNAAIRLWNCPAPWFVTGAPEALQKTFISQGISPPHHLSLSWSQQDWWIIPPV
FT                   TEQALEQLASRLSFEADPPKVNHSTETCPSGQPAVVIDHYSQALLLQNVWSATNFHTPL
FT                   SVALSVRLVDRGEGVRIGHDLKDLLLGVGRMPGLKIEAIWGDFSWLPESEVPRGLSLMQ
FT                   LAARQLADVVNINLPSICHELPQKFWPLVDRVENALTIPQCIFSCSFPTWWDMLQKASA
FT                   VPLALLQGVVISRPTIQTAVLNLGSQHFHEIGWGDLTRIDTCPSLRLLQDAGAKCQKWL
FT                   AEKSLWELSPEAGDLRIGHAATCIPIFGAFSSLD"
FT   gene            347798..348280
FT                   /locus_tag="Plim_0274"
FT   CDS_pept        347798..348280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0274"
FT                   /product="protein of unknown function DUF1569"
FT                   /note="PFAM: protein of unknown function DUF1569"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66125"
FT                   /db_xref="InterPro:IPR011463"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX0"
FT                   /inference="protein motif:PFAM:PF07606"
FT                   /protein_id="ADG66125.1"
FT                   /translation="MPVSNIRRRSLRFENLQQALEDAEIILQAPEGYFVTGRWSAGQIL
FT                   DHLAFWVERPVDGFPFQLPWLMRWFGPLMKRTMLEQPMRPGFQWRGQIALLATPQTEIE
FT                   AETGLAHFRRAIERFEAGPLLPRSPAFGPMSREDWTQLQCRHAELHLSFLHSQSAP"
FT   gene            348426..351572
FT                   /locus_tag="Plim_0275"
FT   CDS_pept        348426..351572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce1810 putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66126"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66126.1"
FT                   /translation="MDGGPDQPETTAPQGVFVPFCAVTVRGRMVNSRSLRPLLTLAVLA
FT                   VCGLLEGCKILEAPTFLDGLRTVAGITTPDVSDPEAAAKSPEKSSAASDPKATTTKTPE
FT                   TTESKESTPPTITLPGSKAGQSAVVDDGSASPLILHYRQKFALDAWQKAYDATPVIQQS
FT                   WQLISRNSATDLPVHANLPKNAQLQSGQIHSSHRWPSYFRYMVRDKESAALAATGKSAR
FT                   TLTADVTWLAMRQSGESKAQLPPAVSELPSSTITPAAEASETPVEEQATNQRSDPARLT
FT                   NSELRASLEALKTMLAARELAGVNAAILLSNCEPQRAVELIAPLGEIVVDGRIRLKGEP
FT                   VTMSPRLRAAAAEAWCRMLLEKPGEPELRLAPAGELLKQDSLAGEVKVVLWQLLAQRIL
FT                   PDRLPGLADAINEQQGDLPLRQGAYEACLIFATMQKLEQGLLPQHEMLFVQAAHESDPQ
FT                   LSDWPEGMSLARFDRDPMIRRLYGRWLALLNHDQACAIALAQGQDADLRVADDAILNLG
FT                   LLTAAEAQQALEKFVRSANENQQTLAAMAISLRQPERLAEFLNPPAGQTSTPRFRAAVV
FT                   SQFGRYPSLTNATLLRPSIRDRSLDVQLALAKLLADWPMELASPLLLEILTEGSGPARE
FT                   EAMRSISAHLGYSPVFPIHGPREERIAAVKELSRVQGLPATWLNTANSEAYDFTSRADS
FT                   QSAASSVSQMVNSVPASRNEWSVGELQNELSTIVKLPQGSSERLDRTEFLARSLPVSLP
FT                   VLTDAAMRLPPEQLTEIAREVFAPADEAVKLVLDMNANEVLARRQSASALRQLAASQNP
FT                   GRIAVKLLQEKLRTEQDQQVWQEIMRAIDRESTPEAAALAQMAIHHHWPDIRLCGCQYV
FT                   LKHPAIERGLWLAPVIEDPHRPVRLAAIEAAGVCGNPQLIEGLPVNDGSRVGSLRPLLQ
FT                   STDHELMETALVALVRLRDDQAMAELLRRSRHDNPRARLQAVELIRQTGQPRFVEPLIE
FT                   QLWTEKTDSVIVEILRTLEELVPPHDQPVFDTRLGYPTRQMKIDAWAKWLADQKIRRSE
FT                   "
FT   gene            complement(351609..352880)
FT                   /locus_tag="Plim_0276"
FT   CDS_pept        complement(351609..352880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0276"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   spl:Spea_2294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66127"
FT                   /db_xref="GOA:D5SNX2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX2"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADG66127.1"
FT                   /translation="MPSTVDNLRDQSTVKIVSLLVLSVVMVIFILMFYQVMAPYLMSLL
FT                   LAGVLAILAQPMHSSSLAYCRGWTSLAAAATTTGVVVVIVLPILFAILLTGLELSVFVQ
FT                   DNLSDSSWEQIKSTVSLRIDQFVQRIMPLMPAGADQEAVKEQLLTGIQNQVKQLGVGAS
FT                   EIASSTWGIIGTLINFFIQLTVCLLGLYFFLADGPRILHGAQNLIPIQPEYQQQVFDQF
FT                   TKVTRSVVMGTLVAAVGQGIAMSLAVGVLGIGHIFVIGMVTTVAAMVPMIGAAGVYVPM
FT                   SIYLATQGHYFTAAGLFLFGFLVISSIDNVVRAYTLSSNVQMHPLLGFVSILGGLEAFG
FT                   LWGIFLGPMIASVLYALAKIFNQELKGFMATSSPARGESAGEKPGANFVSDVTATIIAT
FT                   PVSVVATIVDAAPPAPEVPKPPAC"
FT   gene            complement(353021..353200)
FT                   /locus_tag="Plim_0277"
FT   CDS_pept        complement(353021..353200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66128"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66128.1"
FT                   /translation="MEQHDSSHDLTMQEPAFSHKLPSFSEYSPAKQNLRTELISIIRVI
FT                   PTAESIRSLKPAPV"
FT   gene            353294..353884
FT                   /locus_tag="Plim_0278"
FT   CDS_pept        353294..353884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0278"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   dps:DP0780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66129"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX4"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADG66129.1"
FT                   /translation="MPKPYVMTLMATNRVGVMAALTTALDELGGNLREVSQTVTGNYFT
FT                   MLLTADFPDDRPAGVINDHIRAFCDPFGIELTLKPLSSAELSEPTTNGKAAATERYSLT
FT                   VVGPDRRGSLRQVCYRLAHHGIDIADLHATTLPGNDHFVARFALTVPKSIDRGQLQKEL
FT                   FELSETTGSTITLQHHLVGLATQSPIPIRLASQ"
FT   gene            354014..355357
FT                   /locus_tag="Plim_0279"
FT   CDS_pept        354014..355357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0279"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711; KEGG:
FT                   dps:DP0779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66130"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX5"
FT                   /inference="protein motif:PFAM:PF05167"
FT                   /protein_id="ADG66130.1"
FT                   /translation="MQPTLPTTSWMHLDGPAHLFDVRTVTLGISLANCVDRSLHRFCEN
FT                   VYQRITSAASRYVETCHQVSGEMGVPVIQRWLSVTAIDHLADGFTAEDLFHIARTLDGA
FT                   AANVRVDAIGGFSAWMQHGLSGGARQLIESLPQALSQTERVHSAIVAGTSEVGINFSGL
FT                   LPVAQQLLELSRLTKDRPGTAARMSVVANPPSACFGKAGCPDGMPDMQLYSGISAPRII
FT                   NQCLRARMAEDPDCRLEDLAAEVRTATFRATRAAELTGREIARRLGATWGGIDLTVAPS
FT                   LRPGDSIAELMGLMGIERFGAPGTAALIALIDRAVRDGGRFAATRICGSWGVRLPLMDD
FT                   VGLTEALRSGEMSFNQLSLLTGAGAQGLDLVPVPGDTDAETLAAVLADQMSIGHASGRP
FT                   VTVRLVPVQGKTGGDSISMGGMNQSAIVLPMLATGRSNTMARRGGRLP"
FT   gene            complement(355479..355877)
FT                   /locus_tag="Plim_0280"
FT   CDS_pept        complement(355479..355877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66131"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66131.1"
FT                   /translation="MAAAPGHQNYLAATRRVDLSTSPSLAICRVLFMTQDFSRKDASTQ
FT                   ATDALLPLLQHLRQSLQDARHWEEKLESLFVEWREQQLTEYAAIGQKLEQISQRLGSNI
FT                   PPMQEALPKSVRAQLPVFRLHPEGSSLP"
FT   gene            complement(355971..356183)
FT                   /locus_tag="Plim_0281"
FT   CDS_pept        complement(355971..356183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66132"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66132.1"
FT                   /translation="MRRQEVSHFSQARSLFDNYQPDKQLLPMNQFTPASQIDFLSIILT
FT                   TVLLRGDYQRAGRKLAASFLAMIAR"
FT   gene            356254..356631
FT                   /locus_tag="Plim_0282"
FT   CDS_pept        356254..356631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66133"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX8"
FT                   /inference="similar to AA sequence:KEGG:RPB_0347"
FT                   /protein_id="ADG66133.1"
FT                   /translation="MKTFLSLIAAGITAIATSSSNLAEAGPPVVYPVGHHHHGGGYHGG
FT                   GAYGGGYHGGPSRNSLSLSINAGGVGFGYNRGGYYPPVYGRPVYGGPVYGGPGYQPYPP
FT                   IYRPVPPVYVAPRPWYPGCGW"
FT   sig_peptide     356254..356325
FT                   /locus_tag="Plim_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.573 at
FT                   residue 24"
FT   gene            356841..357923
FT                   /locus_tag="Plim_0283"
FT   CDS_pept        356841..357923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0283"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   bph:Bphy_6502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66134"
FT                   /db_xref="GOA:D5SNX9"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNX9"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADG66134.1"
FT                   /translation="MNPPCLVCEYLCAFEGENLPATDSASTAEIRREGAAMLQALTEDL
FT                   AASQIQVAGLVHAGWKESWTGHPGVRWIWTEDDDHSRSLIHSAISGGWKVVIIAPEIDG
FT                   TLAAIIQLCEFLGARVHNSTSAAIQLTSDKLQLAEHLEKHRIPTIPTRLVQHAEELGTH
FT                   SRYVVKPIDGAGSLDVFVVNDWREAPETETCQIVQPYLRGRSASVAVIMPALVDVENRD
FT                   SSGQSSMASIVWPAASQRIIESPGEGHLPASLKYQGGALPADEFSPEERATLEALALKA
FT                   CQSIEGLRGYTGVDLVWPEESAEPLVVEINPRLCMSYLGYRQIFGPQAALVVAGYSEAA
FT                   AMVETSADDGACWKTSRAEW"
FT   gene            complement(358032..359024)
FT                   /locus_tag="Plim_0284"
FT   CDS_pept        complement(358032..359024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_04424 subtilisin-like serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66135"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66135.1"
FT                   /translation="MVFNQFVQRAGLFGTLATSLLFLSACGGSAKPPMSTSQAPGSQTP
FT                   TVQATPAPAATQADTNAATTNSQTPATSQASATPPRKRFQPIQLGAIGSGTDTETIDES
FT                   KIDSVMDALKPLQVLLGRWKGNARKALLDQPEWMWDLTTDPKQPALVIKSPTGKYIREG
FT                   RLTFLVKDQSYQLTTTDADGVTRNWLGSFTKEVQDVAGDDDKLQRTYKLEFLEKAAEPA
FT                   DEIWKLALSQQDNNRYLIELDRQRGSGTYVRVDTINTQREGTSFALNDSDYGEKECIVS
FT                   QGLGTTSVAYLGQTYWVCCSGCKSAFEADPVRWLAKLAERKKMDPAKTN"
FT   sig_peptide     complement(358932..359024)
FT                   /locus_tag="Plim_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.536 at
FT                   residue 31"
FT   gene            complement(359198..359317)
FT                   /locus_tag="Plim_0285"
FT   CDS_pept        complement(359198..359317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66136"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66136.1"
FT                   /translation="MPLPLFFSDLFHFVQSPATFFVPSEVIVKSVDHGRNSDW"
FT   gene            complement(359403..360773)
FT                   /locus_tag="Plim_0286"
FT   CDS_pept        complement(359403..360773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0286"
FT                   /product="protein of unknown function DUF1552"
FT                   /note="PFAM: protein of unknown function DUF1552; KEGG:
FT                   sus:Acid_2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY2"
FT                   /inference="protein motif:PFAM:PF07586"
FT                   /protein_id="ADG66137.1"
FT                   /translation="MNINKLSRWQSAVDRRTMLKGLGVTMSLPVLEAMLPAHLATAEAA
FT                   MASTALNRMAFVFVPNGVVMDSWQPVKEGAGFSLPPSLEPLAKVKEKLNVMSHLAQNNA
FT                   RALGDGPGDHARSAATFLTGVHPRKTAGADIQAGVSVDQVAAAQIGAATKLPSLELGLE
FT                   GGRNAGQCDSGYSCAYSNTISWKSPTTPMAKEIRPKLVFERLFGGGVDEIKNRKKRDHY
FT                   RQSILDMVQADADQLQQKLGKTDRRKLDEYFTSVREIEQRLERAASDSAKIVIPDMDLP
FT                   DGVPKDQIVHTRLMFDLLALAFQTDSTRIATFMLSNEGSNRSYSVVGVNEGHHQISHHQ
FT                   KKAENLEKLRKVDRHLITQFAYFLEKLDSMKEGDGTVLDHSMIVYGSAIGDGDRHNHND
FT                   LPVLLAGGGSGRIDTGRHVVYPKDTPLNNLFLSMLDCMGVSADRLGDSTGKLDKLKA"
FT   gene            complement(360770..363529)
FT                   /locus_tag="Plim_0287"
FT   CDS_pept        complement(360770..363529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0287"
FT                   /product="Protein of unknown function DUF1592"
FT                   /note="PFAM: Protein of unknown function DUF1592; Protein
FT                   of unknown function DUF1588; Protein of unknown function
FT                   DUF1587; Protein of unknown function DUF1595; protein of
FT                   unknown function DUF1585; KEGG: sus:Acid_4307 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66138"
FT                   /db_xref="GOA:D5SNY3"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="InterPro:IPR031768"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY3"
FT                   /inference="protein motif:PFAM:PF07631"
FT                   /protein_id="ADG66138.1"
FT                   /translation="MRIRVTCPACDHAFKVDAKFAGKKAYCPNTDCRQVLRIPVASAPE
FT                   EELEEFGFSSDDLEDYEEAPAAAPPPLKGKGKAGRSTGDSSKPSRSAPLPASRRKGSGN
FT                   RTSRGKSSSSQPVVGIIVGGVAFLGLLGGIVAFLWPRSPSGDASPSTAGVAQAAEHRLP
FT                   SYAENAAPFMQKYCIDCHQGPDAEAGIAFDKYSDTASILKDRKQWERIMQIVEGQIMPP
FT                   DDSPQPTEEERAKLVSFLDSTVYYVDCATNPDPGRVTVRRLNRTEYNNTVRDLLGVDLR
FT                   PADSFPSDDVGYGFDNIGDVLSLPPLLMEKYLDAADKLAQAAIVSIDPNDLPVKKWKGR
FT                   ELQRSKVAHNHGGEDDPSIILVSTGDATIPVDVALSGEYVLKVVAAETPAGTDRAKMAV
FT                   RLDGQELKVFEVSATDRKPETYSLPVTLLQGKRNISLAFLNDFYDEKAKDPKRRDRNLV
FT                   ILSASLTGPSKVLPNSYPASHTRLVKAVPSASGENGAPGKTISEAARENLTPFVTRAFR
FT                   RPPQDEELSKFVGLVEQATAAGETFEFGMQVAVQAVLVSPHFLFRIESDKEPENPKSAH
FT                   IINSYELASRLSYFLWSTMPDDELFEHARVGDLGNELILDAQVRRMLQDPRSSALVENF
FT                   AEQWLQLRILDEVTPDPKAFPQFNDDLRRDMKEETRQFIRAIVQEDRSVLDLLVGDYTF
FT                   VNERLAAHYGLPDVKGNEFRQVSLAGTNRAGVLTQASVLTITSNPTRTSPVKRGKWIME
FT                   TILDSPPPAPPPNVPELEDKKEQSAGLSLRQQMEQHRSNPACASCHKTMDTLGFGLENF
FT                   DAIGRYRKDDGGKPVDTSGTLPSGDSFSGPVEMVNILKTKKQKAFTECLTEKLLTYALG
FT                   RGLEYYDRCSVNRINSELSAQNFRFSVLVKEIVKSEPFRLRRGEGSTL"
FT   gene            363897..366428
FT                   /locus_tag="Plim_0288"
FT   CDS_pept        363897..366428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0288"
FT                   /product="DNA photolyase FAD-binding protein"
FT                   /note="PFAM: DNA photolyase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: afw:Anae109_3007 DNA photolyase
FT                   FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66139"
FT                   /db_xref="GOA:D5SNY4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY4"
FT                   /inference="protein motif:PFAM:PF03441"
FT                   /protein_id="ADG66139.1"
FT                   /translation="MLHQELTSMLSGLPEHLQERTRILSSPLSLSTAANDPDQATTHGD
FT                   FVLYWMHHSLRGHENPALDVAIHLAHWLEKPLLVYQGLSEDHPYANDRRHTFILQGARD
FT                   VHAELAEQKISSVLHVARAEDRGPHLKTLAAHAAVLVTDDVPTAPTIHWRNRLAASIKT
FT                   PIVCVNGACIVPPQLVKRAFDRAFAYREATAWLYKTRNTRPWPVLRYAGKPFPLDQRPF
FT                   QSVDLQQTSIADLLAISQIDHSVGPVQHTVGGSQAGYTRWENFKKQGLRRYADQRNDAL
FT                   KDGVSRMSAYLHYGMVSPFTLVRDCFEVGGASAEKYLDELLIWRELAWCFCHYRTDHEA
FT                   LSALPTWARQALKAGEADTRPALYDEETLARAQTHDPLWNAAQMSLLRQGELHNNVRMT
FT                   WGKAIPLWTRTTEEALRLLFDLNHRYALDGCDPASYGGLLWCLGQFDRPFTPEEPILRS
FT                   IRGRSTAEHARRLNPEKYLAKTSRRLTAEPVKVAVIGAGITGLMAARTLSDHGFEVEVF
FT                   EKSRGLGGRMATRRLPEGGQFDHGCQYITAKSPQFERSLRSWESQGLITPWQGLLAAQR
FT                   TDGSWKELAANGPRYVGLPGMTSMARHLSQGLKVHQEVQIQKVERIANQWQLQSTQGTV
FT                   AGPFDQLILAIPAGQAARLVGEHPLAETLARIPMDPCWTVMATLSDRLNLPFDGYLSHA
FT                   ALAPAVGWAARDTSKPKRPTDAERWVLQATPAWTRSHLDLSADQVATELWHHWCEQISL
FT                   QSHSLQVHRTPELVAHRWMFSTLDPTKVPAEIYQKLSIERALHDPEHGLTVCGDWTSES
FT                   RVEAAYLSGIAAAGFVLRQHLIAKPAAQLLF"
FT   gene            366591..367667
FT                   /locus_tag="Plim_0289"
FT   CDS_pept        366591..367667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66140"
FT                   /db_xref="GOA:D5SNY5"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66140.1"
FT                   /translation="MSDSLLSQDRTVLVIRRTAGAMTKFAILLTVAIFAFKWPIQQLRG
FT                   ETGLAAQVVVNPAAVVGRPEIVERTPGLVAFWKFGEEPGQPRLSTGTPEKHPLVEVGGP
FT                   IGRVAGGPFSGYSIDFNGQQYLMAKHAELGDLDIHGPEAQVSMFAVVKLTEMKRGVTIA
FT                   GIWSEGKGAHDDTGARQYAMLLNMPTYGGPRQLTPHVSSEGGVTRRADGSPFPWCADYA
FT                   ASKSVVPEGKWVTLAFTYDAKYLKAYFNGLLEPRAIEPKTDKRDDPYFMTEGPGGSPRG
FT                   INPYYHGRGIFHFQPELHAQSKPGGPADFTVAARYAVGSMLGEAMKGQLGGLAVFNRAL
FT                   SDDEVLSLHKASAIDKLP"
FT   gene            complement(367710..368645)
FT                   /locus_tag="Plim_0290"
FT   CDS_pept        complement(367710..368645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0290"
FT                   /product="agmatinase"
FT                   /note="TIGRFAM: agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: pmy:Pmen_1797
FT                   putative agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66141"
FT                   /db_xref="GOA:D5SNY6"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY6"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ADG66141.1"
FT                   /translation="MSNSPFCGIASFGRQEICLAPVAGRNVDVAVLGCPFDSSVSYRSG
FT                   TRFGPRAIREQSMMLWGYHNALNIAPFDVLKVVDAGDVDVIPVDIARTHALIEQAARAW
FT                   IDQGTMVLGLGGEHSVALPLLKAAAAKHGPLAVVHFDAHGDTWTEEYPGYPLSHGTPFI
FT                   RAIEAGAIDTQRYFQIGIRGPTYSASDYLDARALGARIISADDVGERGVRSIVDEIRQQ
FT                   VGNQPVYLSFDVDALDPAFAPGTGTPEIGGLTSREATGILRGLAGLRIVGGDVVEVSPP
FT                   YDPSAITSVLGANLAFEMLALIAKSKSSSQ"
FT   gene            369048..371231
FT                   /locus_tag="Plim_0291"
FT   CDS_pept        369048..371231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_00496 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66142"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY7"
FT                   /inference="similar to AA sequence:KEGG:SYN_00496"
FT                   /protein_id="ADG66142.1"
FT                   /translation="MNKLSIELTNCYGIKHLKTEFDFASSKSSRPNVFAIYAPNGAMKS
FT                   SFAQTFKDIADGKASKDRIFPERVCERTVRDENGMDLLPETVVVVSPYDRDCAHAEKTS
FT                   TLLVDHKLRTEYEQLHLEVDRAETAFLDAMKAQSRSKKDIKREISSTFTSDSNSFHLAL
FT                   SRVKDEVVEMASSPWAEILYDVLFTDQVLTLFEQEAVRKDLHTYVAKYNDLLAKSTYFK
FT                   HGIFNYYNAGQIAKSLADNGFFNANHTVSLNAQECKVISSQKELEEVVTKEKEAITNDK
FT                   ALKSVYAKIEKALEKNAACREFQQYISDRPEILPRLENPKSLKEEIWKSYFKANSALYL
FT                   DLIEKIQKVAKRKKEIQEKARTQRSQWEEVIGIFNSRFSVPFTLIAENRVEVCLGQEGI
FT                   LKLGFQFKDGVDSASVERNTLLEVLSTGERKAFYILNIIFEVEVRRKAGVETLFVFDDI
FT                   ADSFDYKNKYAIIQYMQDITDVPSFRQIILTHNFDFFRTLESRFVPYAQCRMAFKTSTG
FT                   LIFKKAEGIQNVFLNDWKKNFFTDQMKKIGSIPFMRNILEYTKGDGDPEYLKLTSLLHW
FT                   KSDTPSITEADLDTIFITMFAVGMGACGGSTTPVVDLLASEATKCLSASDGINFANKIV
FT                   LAIAIRLTAEKYMIDKIADQAFVSSITKNQTQALVSKFKKTFPNDVTTNEVLHRVCLMT
FT                   PENIHLNSFMYEPILDMSDEHLRTLYQDVVALI"
FT   gene            371416..372744
FT                   /locus_tag="Plim_0292"
FT   CDS_pept        371416..372744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0292"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: afr:AFE_1463 dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66143"
FT                   /db_xref="GOA:D5SNY8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY8"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADG66143.1"
FT                   /translation="MSRRIRISGAECVLPSGLWKGDVLIEGGRILDLDPPASARADDVI
FT                   QAAGLHLIPGVIDDQVHFREPGLTHKEDLATASAACAKGGVTTFFEMPNTKPTTTTVER
FT                   LHEKLALAATKSVVNYAFYIGATPTNVEELKLARRTPGIKIFIGSSTGDLLVDEQAALE
FT                   QIFAETTLPICAHCEDEATVRANAARLNGGSKVQDHSLIRDHKAAEIATRRALDLAYRH
FT                   KHRFHVLHVSTAIETEIVADHRGLITAEACPHHLFFNVDDYDRLGTLIQMNPSIKTQDD
FT                   VTALWKALRDGRIQVIATDHAPHTLEEKRQPYPKSPSGLPAVENSLALMLDAAHRGFCT
FT                   IEEVVSWMCDAPARVWDLVGKGRIQPGYDADLVLVDLNKSQTIRNEDQLTKCGWSPWAG
FT                   TTLTGWPVVTLVHGEVVFADGKVDTGHRGKEAIFDHSRGGFWG"
FT   gene            372814..373092
FT                   /locus_tag="Plim_0293"
FT   CDS_pept        372814..373092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66144"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66144.1"
FT                   /translation="MGAGDGTVGALLASQQWHTGNRWQKSAFAVATKKSSVRFSLVFLR
FT                   GKSVNFVATRLMFLVRSMHRINHRGEFADGRREAGRPLLMIWIRDVA"
FT   gene            373089..373793
FT                   /locus_tag="Plim_0294"
FT   CDS_pept        373089..373793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0294"
FT                   /product="protein of unknown function DUF1061"
FT                   /note="PFAM: protein of unknown function DUF1061; KEGG:
FT                   bcb:BCB4264_A3273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66145"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ0"
FT                   /inference="protein motif:PFAM:PF06352"
FT                   /protein_id="ADG66145.1"
FT                   /translation="MTAEEIVAQLQKLGSEGTAKVLRKHGAHDPCLGVKIGDMKPLQKQ
FT                   IKKNYGLSLELYDTGIYDAMYLAGLIAEPELMTKKDLTQWVKTASRPIANFVVGPTAAG
FT                   SPAGWNIALAWIKSRKEIENIAGWATLSAMASIDPDEKLDLTEYQRLLAEVESKIHAAK
FT                   DAVQYQMNSFVISVGSYLRPLTEVAIETGNRIGRLKVDMGDTDCNVPFAPEYIQKVKDR
FT                   GNLGKKRKSAMC"
FT   gene            complement(374251..375015)
FT                   /locus_tag="Plim_0295"
FT   CDS_pept        complement(374251..375015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0295"
FT                   /product="metallopeptidase"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66146"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ1"
FT                   /inference="similar to AA sequence:KEGG:PHATRDRAFT_47502"
FT                   /protein_id="ADG66146.1"
FT                   /translation="MNSHHPWMLAVLIFVSVTASSMRCCVADERAALPAPIAGYTTHEV
FT                   EGWVVRVSERLSQEQPEKTKRALELLAEQLRIVIRVLPAEPLAFVRTVPIWFSPPYAGV
FT                   RPKAEYHSDKEWLEKQGRLKELYQCVEFTTTAIFEREIERMPVIVLHELAHAYHYQVLG
FT                   FDNALIKTAFERARNSGSYEVVLRKDGNKEKAYALTNPQEYFAESTEAYFGRNDFFPFD
FT                   RAELQQHDPAMVKVLQEVWQVEPDASNAVKVK"
FT   sig_peptide     complement(374932..375015)
FT                   /locus_tag="Plim_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.898 at
FT                   residue 28"
FT   gene            complement(375271..376287)
FT                   /locus_tag="Plim_0296"
FT   CDS_pept        complement(375271..376287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0296"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mms:mma_0249
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66147"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ2"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADG66147.1"
FT                   /translation="MLDHSFYRPLGRTGLYVSPICLGCDNFANPTSAEESSSIINCAID
FT                   NGINLIDTANGYANGQSEEIIGRCLKENGRRDDVILATKAYYPVGNKGINDRGNSRKHL
FT                   IKACEDSLRRLQTDYIDLYQTHRVCMQTPLEETLGALTDLQRQGKIRYAGSTTSPSWKI
FT                   TESSMLADYRGLIRMVSEQLPYNLLDRRVENEILPAASAAGLAVFVWSPLAMGLLTGRY
FT                   DSSKPESFDTPRFGRGGIYAERITHRAADAGQQFVRVARDFDISPAHLALLWVKDQPGV
FT                   TAPLCGPRTLAQLEDVLPVMKMSLSEAMRCECDQVVPPGSAIANFLNSAPWMKGRLL"
FT   gene            complement(376281..377036)
FT                   /locus_tag="Plim_0297"
FT   CDS_pept        complement(376281..377036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0297"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ajs:Ajs_2100 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66148"
FT                   /db_xref="GOA:D5SNZ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG66148.1"
FT                   /translation="MTLKDKIIIITGAASGMGRAATEMLCNEGAVVYAADRQQETLEQA
FT                   CETTGACPSVIDISCSSECDALVTRVVQERGRLDGIVNFAGVLKRTGIVDCTDEEFDFV
FT                   MNVNVKGCFYLCRAAARVMKKQGFGSIVNVSSIWSDVGAAGVLAYCASKGAVSQITRSA
FT                   ALDLAGSGVRVNEIRPGETNTPMLASERGRSLTQQEIDEKLKQIAATIPEKRLADPHEI
FT                   VAAALFLLSDASSYMQGSSITVDGGYTAC"
FT   sig_peptide     complement(376974..377036)
FT                   /locus_tag="Plim_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.698 at
FT                   residue 21"
FT   gene            complement(377314..377580)
FT                   /locus_tag="Plim_0298"
FT   CDS_pept        complement(377314..377580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66149"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66149.1"
FT                   /translation="MSTTPSASSLFDEVATLFASAPSQNSILEFRPSQATIERAKQLLE
FT                   LNRANSLDEASRRELDQFEQAELLMRLVKARIRASQNGGLPLQ"
FT   gene            complement(377926..378001)
FT                   /locus_tag="Plim_R0003"
FT                   /note="tRNA-Asn2"
FT   tRNA            complement(377926..378001)
FT                   /locus_tag="Plim_R0003"
FT                   /product="tRNA-Asn"
FT   gene            complement(378243..378686)
FT                   /locus_tag="Plim_0299"
FT   CDS_pept        complement(378243..378686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0299"
FT                   /product="Planctomycete cytochrome C"
FT                   /note="PFAM: Planctomycete cytochrome C; KEGG:
FT                   sus:Acid_6547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66150"
FT                   /db_xref="GOA:D5SNZ5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ5"
FT                   /inference="protein motif:PFAM:PF07635"
FT                   /protein_id="ADG66150.1"
FT                   /translation="MLFNRDRPSQRRWRLWVLSLSFSLWFTSNLPATSGAEPTEKTVFE
FT                   QKIAPIFVKHCVKCHGPEKQESGFRLDRRDDFLNGGDNGPVVVPQQPEESRLMHLVQGT
FT                   DADVIMPPDGNRLSDQQKADLKQWIKQGADWPEKLTVLPGLSK"
FT   sig_peptide     complement(378582..378686)
FT                   /locus_tag="Plim_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.472 at
FT                   residue 35"
FT   gene            complement(378838..379755)
FT                   /locus_tag="Plim_0300"
FT   CDS_pept        complement(378838..379755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Os07g0511100; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66151"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66151.1"
FT                   /translation="MLRSLSKLMLAQGSKALFSTCLAFTVMAGSVPAADESEVKAPAKP
FT                   VKKVNQRPLTKLTYDPSAKEVELFEAMERGEVGVRVIPMNAMGANVLIENKTNEPLNVK
FT                   VPNAVVMVSIHAQFGGGAGFGGGQQGGLGGQQGGGGGQQAGGGGLGGQQGGIGGGQGFG
FT                   GGQQPGIFSIPAEKIASIPMKSVCLEHGKPEPSPKSKYTLVPVERFSTDPLLRELLTYV
FT                   NDPRVNPQAAQAAAWHLTNKMTFAQLAAEQNRSLISPNGQPLFTAQDLFQAQSLLAAAK
FT                   EKAEKNPSPATKGQGTIRSATEAQ"
FT   sig_peptide     complement(379651..379755)
FT                   /locus_tag="Plim_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.543 at
FT                   residue 35"
FT   gene            380360..381256
FT                   /locus_tag="Plim_0301"
FT   CDS_pept        380360..381256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66152"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66152.1"
FT                   /translation="MRLMASRQYSPLLAVVAGLMMAWSNSLCGCAMLRSSSGVPQEKVT
FT                   QTTASEDSSVTRSTSNLESEEKTTKSTSFSSSKRVALTYVAHMPEGGVFISNSAIQQAG
FT                   GNDETTADLVGQQWAMAELRIDLPHPDGRTDVGRATVELKPLSCGERCDSKSLSEVRSD
FT                   RQSERQSRYSMWVNRWLWRAKPQGVELPPNAVATLDLPRSEIEQILSHLEKEGHFRRNA
FT                   ENQGPARLDVLFNQRKITHACGYDEVLDKLVCEVWARGHQELATRRREQQELQLTGYEV
FT                   EKPARTATGSNDSRFQR"
FT   sig_peptide     380360..380449
FT                   /locus_tag="Plim_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.600 at
FT                   residue 30"
FT   gene            381572..381862
FT                   /locus_tag="Plim_0302"
FT   CDS_pept        381572..381862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66153"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66153.1"
FT                   /translation="MLRSWMMSGLFVACLAACLTTEAKAAGEGQPTDWNRFYYYPYVYY
FT                   PHNFQAPVEYNHMYYRYPQERQIPVYRKDWHNFYPSPRPYHMGHHFVLDVF"
FT   sig_peptide     381572..381649
FT                   /locus_tag="Plim_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 26"
FT   gene            382225..382298
FT                   /locus_tag="Plim_R0004"
FT                   /note="tRNA-Arg1"
FT   tRNA            382225..382298
FT                   /locus_tag="Plim_R0004"
FT                   /product="tRNA-Arg"
FT   gene            complement(382487..382885)
FT                   /locus_tag="Plim_0303"
FT   CDS_pept        complement(382487..382885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66154"
FT                   /db_xref="UniProtKB/TrEMBL:D5SNZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66154.1"
FT                   /translation="MNTQRVISIQQLITLFFAPVERQVPDFDKSCAGRTAPSKHAPQIP
FT                   LCTVVFGFDTRDPCVESVPYSRGEAKTILLTTHNFRADRRNLCGRCLQQKRDRGLNSPH
FT                   RGAKLDSGSITRINNLSAHQELKVTRES"
FT   gene            complement(382946..384079)
FT                   /locus_tag="Plim_0304"
FT   CDS_pept        complement(382946..384079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0304"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66155"
FT                   /db_xref="GOA:D5SP00"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP00"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66155.1"
FT                   /translation="MKALRPTCFRSGGAARPGFTLIELLVVIAIITTLISLIAPAVQGA
FT                   RRAARKLECLNNMKNLGIAMHNFASGRGGKLPRLAEDQTVTTTFTTADQSTFSALTPSE
FT                   QHTLRVGWTMQLLPVLDNAALYRSIQSRSAKFTGSGGPYAVLSTNERTWLPFFTCPDDL
FT                   VNHRKALGLSYVVNSGIASDENWGQVTDNTNDPAGGHSSASISWADATLTTASTNDRNM
FT                   GKSTGVIWRDTDMTLDFVGTGDGTENTMMIAENLNSDNWASGNTWDLAFAAKVGSTGWA
FT                   PATSPAFTQGSAPFGVGNMAASTSSPVGDSRPGAPVVDNTRKAPRPSSNHGGSVNVVMV
FT                   SGAGRSIADTIDQRVYLKLLTSNGQQYGETTLNSSDF"
FT   gene            384970..386175
FT                   /locus_tag="Plim_0305"
FT   CDS_pept        384970..386175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0305"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   oan:Oant_2282 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66156"
FT                   /db_xref="GOA:D5SP01"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP01"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADG66156.1"
FT                   /translation="MNWLMTDMDSFFASVEQHLRPELRGLPVGIVPLESDHTCLIAASY
FT                   EAKKHGAKTGTKVRDAREICPGLVLIKARPATYVEVHRAILRSIDKVAPVEKVYSIDEW
FT                   TIKLTAEYKHPDEACRLALRLKQQLAHDFSPFLTCSIGIAPSRLLAKIACGLEKPDGLT
FT                   ILSAADPPGRLEHLPLSKLTGIGKGMLARLELHNIHSVRDLWNISRDEAIRIWGSVTGA
FT                   RWWAGFHGEDEPEQLTRRRMMSHGNVLDPAFRTEAGAHGILQRLVCKLGQRLRQSGYIA
FT                   NALHLRVKDTRSRETRLEVGLPGVDDTHTLMRAFEDLWQTRQPGGAPPKQVEVSVSGLV
FT                   LATQISRPLFDEVQKRQRVSQAMDRINLQWGPSKVYVGSVHNYRQHMENKIAFGRIPRD
FT                   TD"
FT   gene            complement(386228..388711)
FT                   /locus_tag="Plim_0306"
FT   CDS_pept        complement(386228..388711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0306"
FT                   /product="A-macroglobulin complement component"
FT                   /note="PFAM: A-macroglobulin complement component; KEGG:
FT                   mxa:MXAN_5864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66157"
FT                   /db_xref="GOA:D5SP02"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP02"
FT                   /inference="protein motif:PFAM:PF07678"
FT                   /protein_id="ADG66157.1"
FT                   /translation="MHPQVSLNHRAFRRVRREFSPWAMRLIVSIIGLFAGAIPCATVTS
FT                   GAELTAARVLESIDAGREFLLTRQKQDGSFDAGNNLGHRSGVSALCTLALLNSGMEANQ
FT                   PQIRKALQYLRRLPEDEISQTYDISLVIMALVAAKDSSTNDLPRIARLASRLESWQIRE
FT                   GNSGSWTYSSPGGGINLGGDRSNAQYAVLGLREAAEAGVEIDRKTWERIRTHWTSQQNP
FT                   DGGWNYSSDGQSTGSMTVAGVATLSIVEQMLVEDRKIGPDGSPPCCEPAEPNEALDRGL
FT                   RWLANRFTPLQNPGSGTWLLYYLYGVERAGRLSGQRFFGQHDWYREGAEVLLKVQNQRT
FT                   GAWVGVGLYESEPTVASAFALLFLSKGLAPVLVNKLKYGPPNPNRPGHTLTDDWNRHPR
FT                   DARNLTEYLSGRPLWPKLLTAQEVDLSKAVAAKSVASLAQAPVLYITGQDALDLTDAEI
FT                   ALLKEYVEQGGFILGVAGCQSARFEESFRELTPRLFPPGEGVLKKLSFDHPVFRSEFLL
FT                   DPEGLELWGVDAGCRTPVIFCPEDIGCLWHYWSRLESANRNPNLRAKVIRATQIGTNII
FT                   AYATGREPPNKLDSQELANLSSKTDRIERSFLQIARIQHSGQWDAAPAAVRNLLTALDQ
FT                   SAGIGTNPKIRHLPLSDTNLYRYPLVYMHGRSTFELSSAEIEGLRTYLSRGGVLLADAC
FT                   CGAKGFDESFRAAMKKAFPATPLTRIPVTHEVFSAKSGQDVTRIRRRVNSSLPGQAVKS
FT                   QVLEGEPYLEAIEIDGRLAVIYSKYDISCALERQSTVSCEGYVPEDAVKLAINLVIHAL
FT                   SQEVPLPPELANPAP"
FT   sig_peptide     complement(388571..388711)
FT                   /locus_tag="Plim_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.660) with cleavage site probability 0.494 at
FT                   residue 47"
FT   gene            complement(388775..389113)
FT                   /locus_tag="Plim_0307"
FT   CDS_pept        complement(388775..389113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66158"
FT                   /db_xref="GOA:D5SP03"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66158.1"
FT                   /translation="MRLRPQVSSSVGVRSSRWKALLLVAFCEVFCSSSVWACPSCKLLA
FT                   DQQSEQPRAYMLSVFFMLGMIGAVCGTVIFVLYRLHKYECLQLEEAGYYHLFDNAASPA
FT                   PAHEATDH"
FT   sig_peptide     complement(389000..389113)
FT                   /locus_tag="Plim_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.847 at
FT                   residue 38"
FT   gene            389269..390477
FT                   /locus_tag="Plim_0308"
FT   CDS_pept        389269..390477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0308"
FT                   /product="proposed homoserine kinase"
FT                   /note="KEGG: pca:Pcar_1514 cofactor-independent
FT                   phosphoglycerate mutase; TIGRFAM: proposed homoserine
FT                   kinase; phosphonopyruvate decarboxylase-related protein;
FT                   PFAM: metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66159"
FT                   /db_xref="GOA:D5SP04"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP04"
FT                   /inference="protein motif:TFAM:TIGR02535"
FT                   /protein_id="ADG66159.1"
FT                   /translation="MKLVLVIPDGCADEPQPILKGKTPLEAAHIPHMDAVAAIGMVGEA
FT                   DHVPLPMPSGSDVGTMSLFGYDPLLFHTGRAPLEAAAQGITLGPEDWAVRCNLVTTHDG
FT                   LMKSFTAGQIPSDVAASLLKEMQAALPADSPWEFFPGVSYRNLLIFRGAGRTAPFDKAT
FT                   STTPPHDVTDQPFAPHLPQGQGADELLKLMEWSRDFCAKHPANQARGDNAATQIWLWGQ
FT                   GQRPALEAFSSKYGPQGAVITAVDLLRGIGRLIGWKVIEVPGATGYLDTDYAAKGRYAI
FT                   DALKNGVELMVVHVEATDEASHEGHAFEKVKALEEIDRHIVGPVHEYLKSQGEYRLLVC
FT                   PDHPTFLRTKTHSHGYSPFALCGTNVPQDNATHYSEPEATRAGTRLTRGCDLMNLLVNG
FT                   VKG"
FT   gene            complement(390541..393165)
FT                   /locus_tag="Plim_0309"
FT   CDS_pept        complement(390541..393165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0309"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="KEGG: sus:Acid_1640 peptidase M14, carboxypeptidase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66160"
FT                   /db_xref="GOA:D5SP05"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033810"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP05"
FT                   /inference="similar to AA sequence:KEGG:Acid_1640"
FT                   /protein_id="ADG66160.1"
FT                   /translation="MFAVCSMSQKFRQAWCESAITPMFTRLPVLVFLIVFVANPGLTIG
FT                   QDAKIAQQFVANPDLDVPFAKSNPHISSSPATYLGRPVGTDFQLADWKQVAGYYQKLDQ
FT                   ASDALLLQNAGKTTEGRDLLVAVISSPANLARLPEIQREARLIADPRLGTANDRLLALA
FT                   QGTPIVLISLSMHSDEPASTEMGMQLAWLLATSDEAPWREIRENVVVVLIPSLNPDGVD
FT                   HIVSFYRERVGTPYEGAALNKLYQFYTGHDNNRDFFSLTQNEARLMTHLLYHEWKPQVM
FT                   WDAHQYGAGTRERFFVPPYRDPLNPNLDRDVVAAINLMGTRAVADMTRAGHSGIATGIG
FT                   YDNWWNGGNRSVPARHNMVGILTEAASVNIASPVFIKPSELKDPLQRPEYLPSNQFIHP
FT                   WPGGWWRLQDIVNYELAFAKSMLSSVSREPRFWLETTHAAASRAISDGHGNGVRGWIIP
FT                   AQQVDRHAIRRFADILLLSGIELHVATKPLLIDGRSYPAGSIVIRRDQPYGRHAKDLLE
FT                   LKGFPAGEKPYDVSGWALAHLFGLRRVEVLGDLPDDLQPVATADEAIRGMTIDARIAAG
FT                   DRQTLSTRDSGSWKALTASLGRGDAWEVATQGKLTGLMRPANSPFGMDEATEKVTISRL
FT                   PRIGLYAPWTASMDEGWLRWVLDDAGIPFVTVRNEMLKAGELQEFLDVLILPDVTSKTI
FT                   NEGRAPGTIEERYAGGLGPEGILAIDQFVKQGGKLITTEGSAAWAISQFSLPIENVVTS
FT                   KDAEGFSCPGSVLRVTPADDPLTAGLPDSIPMMFSGSAAWQLNEGKSGKANKSQLKTLA
FT                   SYPENNLLLAGFIARPEVLAQKGAWVEAKVDAGKIHLFAFRPHYRAWSQGTFPLLFRAI
FT                   LLP"
FT   gene            complement(393199..393504)
FT                   /locus_tag="Plim_0310"
FT   CDS_pept        complement(393199..393504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66161"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66161.1"
FT                   /translation="MTTATPYESAIPTNVKSLRRHKLGFLRKSQGSLTLVERIHDVPVV
FT                   ASPKVLHPAEENVRIDRNSRWTSPSHAGYPGWVGGGFAPRCKLKEVDRIDSRNVTL"
FT   gene            393769..393966
FT                   /locus_tag="Plim_0311"
FT   CDS_pept        393769..393966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0311"
FT                   /product="carbon storage regulator"
FT                   /note="TIGRFAM: carbon storage regulator; PFAM: carbon
FT                   storage regulator; KEGG: bha:BH3617 carbon storage
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66162"
FT                   /db_xref="GOA:D5SP07"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP07"
FT                   /inference="protein motif:TFAM:TIGR00202"
FT                   /protein_id="ADG66162.1"
FT                   /translation="MLVLSRQRDESIFIGDNIKITIVDIRGDKVRLGIEAPTEVPVHRQ
FT                   EVYEAIQRENQRTVEPVAKS"
FT   gene            393995..394291
FT                   /locus_tag="Plim_0312"
FT   CDS_pept        393995..394291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66163"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66163.1"
FT                   /translation="MIGCVPCCGLQGSQQTMIHPARTVLTKSGVHAHPSLVGLSRQISR
FT                   LPRPVEEIISRRLCSDLVNHTQVFTAGVAAPAGGLEVQKQLSRPSPQVHPIIS"
FT   gene            complement(394667..395278)
FT                   /locus_tag="Plim_0313"
FT   CDS_pept        complement(394667..395278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0313"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: slo:Shew_1425 adenylyl-sulfate kinase;
FT                   TIGRFAM: adenylylsulfate kinase; PFAM: adenylylsulfate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66164"
FT                   /db_xref="GOA:D5SP09"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP09"
FT                   /inference="protein motif:TFAM:TIGR00455"
FT                   /protein_id="ADG66164.1"
FT                   /translation="MTEQKATNVTWHEHKVSRAEREKIKGHKGAVLWFTGLSACGKSTI
FT                   ANEVDYLLNQRGIHTIVLDGDNIRMGLNKNLGFSAEDRAENIRRIGEVAKLFATSGTIV
FT                   GTAFISPYKADRDKVRAILAPGEYVEIYVNASLETCEKRDPKGLYKKARAGELKNFTGI
FT                   DDPYEAPEKPELVLDSDNKGIAELAQEVVAYLEQNGYLKA"
FT   gene            395540..395740
FT                   /locus_tag="Plim_0314"
FT   CDS_pept        395540..395740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66165"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66165.1"
FT                   /translation="MSPVAAGISSRAVMLGKVSSGWKQKWTGAAKRGPKTGSILKSTEF
FT                   KSALFEPRGVLLEVCLVQLSI"
FT   gene            complement(395803..396348)
FT                   /locus_tag="Plim_0315"
FT   CDS_pept        complement(395803..396348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0315"
FT                   /product="PspA/IM30 family protein"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: vsp:VS_1991
FT                   phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66166"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP11"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADG66166.1"
FT                   /translation="MNYFSRLTDIVTCNLSQLLKDETDPVQALEKIIEEMDQGIAGARR
FT                   SVTAARLAVDRMEGEISERRTQIMAWQNRAKTELQGGNESGARLALARKTEVEDLVAGL
FT                   QQQHRAAQNTFEQLQTTERALESKKAEAVRKLASLRAGYATDDAEDFPQEAGISLQQDR
FT                   NERINADLDALRKELLAG"
FT   gene            complement(396621..397259)
FT                   /locus_tag="Plim_0316"
FT   CDS_pept        complement(396621..397259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0316"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: acp:A2cp1_0252 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66167"
FT                   /db_xref="GOA:D5SP12"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP12"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG66167.1"
FT                   /translation="MSSQAPTDDELMLAVQTGETRAFNQLVSRYQGPLMGFFVRQIHDV
FT                   QQAEDLTQETLLRVYNQSWDYLPRGAFRGWLFRIARNLLVDNLRRRSSDALIHTIQPRQ
FT                   EEDELLQNMVGEIGSPEQVADIREIAALVDEFLKELPEEQRLTFILHHYNQLTLPEVAD
FT                   SLEANLPTTKSRLRLAKEKLRQKLQARGILEFPNLLAEADGESRSQELD"
FT   gene            397595..398863
FT                   /locus_tag="Plim_0317"
FT   CDS_pept        397595..398863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dds:Ddes_2379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66168"
FT                   /db_xref="GOA:D5SP13"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP13"
FT                   /inference="protein motif:COG:COG3875"
FT                   /protein_id="ADG66168.1"
FT                   /translation="MSSQSPSNTSPTMSFGASSSWLCSLDASSIVATQTGPAPLADLSQ
FT                   AVANACRMPCDFPALGEALIPDDRVVIVLNHRVPRREVIVKELWQILAERGIAPAQLTI
FT                   IDAPVLSKPSTDPRSLLPTDIASEVQWQIHQPADPHGSGYLGSSLSGERIYLSRALLDA
FT                   DFIIPVSTVEADPVHGLCGAIHAIFPALTNLESLQRLNKASHDELHAEDERPIRQLAEE
FT                   VAGMLGLQFSIELVPAAGGTGVAQVLAGQPDSVHRLGRQAIREHWVLNVDRRSETVVAA
FT                   VTGQTGQPCTWEDVSRAAQNARRLVINGGRVVLLTDLSAELTEGWELVRDCTQPRDAIR
FT                   RVKTVQPVDEISIDQMLRTADFATVYLLGGPEGDILEELFLHPLASLKEVDRLLEGTTD
FT                   CILLGGAQYVRGKARQAQTHVED"
FT   sig_peptide     397595..397693
FT                   /locus_tag="Plim_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.239 at
FT                   residue 33"
FT   gene            398912..399355
FT                   /locus_tag="Plim_0318"
FT   CDS_pept        398912..399355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66169"
FT                   /db_xref="GOA:D5SP14"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66169.1"
FT                   /translation="MSRIPALVAGVLLVLTGAALLLHAWGLSSENPGNSKAISAQQKRA
FT                   RRRIQIAALIILEGLLIPAGDLWMEQRPAAVLMAAFWIGVLLIALWIGLLAVADFFSSR
FT                   AMLHFSLEQLKEQQRVLQQQVDAHRSRKTTTSSTAGDDADPGT"
FT   sig_peptide     398912..398986
FT                   /locus_tag="Plim_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.980 at
FT                   residue 25"
FT   gene            complement(399422..400846)
FT                   /locus_tag="Plim_0319"
FT   CDS_pept        complement(399422..400846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0319"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: sus:Acid_2635 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66170"
FT                   /db_xref="GOA:D5SP15"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP15"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG66170.1"
FT                   /translation="MTRYHWFVLLVAALGWLFDCLDQQLFVLARPAVMESLIPGNSADP
FT                   AVRSAQKMGGDIATSIFIAGWATGGLFFGMLGDRIGRAKTMMITILLYSLFTGLSALSV
FT                   GLWDFAFYRFLTGLGVGGEFAVGVALVAEVMPNNARPYTLGLLQALSAVGNVSAAMVNL
FT                   SLGLAEEQGLPYSPWRIMFLIGAIPALLALVVRRYLKEPEQWTAASTSELKEKQLGSYT
FT                   ALFKHPVWRKHALLGLVLGCAGVVGLWSVGFYTPDLTREIQKKPITAQVLEEFKAVHGS
FT                   ETMDRVLAQPQEGSAPRNPDDQKILESFEKTVKGRLSRWPSYSSIMLNIGAFFGMFGFG
FT                   ALSQKIGRKPTFAIALVAAFSSTVIVFLFLTELWQIFVFVPIMGFCQLSLFAGYAIYFP
FT                   ELFPTWLRSTGTSFCYNVGRFVAATGPIAKIGLDSIYAGSEHATRYTGATMCFVFLIGL
FT                   VVLPFLPETKGKPLPE"
FT   gene            400879..401010
FT                   /locus_tag="Plim_0320"
FT   CDS_pept        400879..401010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66171"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66171.1"
FT                   /translation="MTIEPVYQCGAYQLGFLANLIVQKQHPPECKAARNQWETRQQV"
FT   gene            complement(401421..402032)
FT                   /locus_tag="Plim_0321"
FT   CDS_pept        complement(401421..402032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0321"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   scl:sce0085 isopropylmalate isomerase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66172"
FT                   /db_xref="GOA:D5SP17"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP17"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ADG66172.1"
FT                   /translation="MVQAITQVTGSAVPLLLDDIDTDRIIPARFLRCVTFDGLGEHAFE
FT                   DDRIQDPSHPFNQAQFQGSKILVAGRNFGCGSSREHAPQALMRWGIQAIIAESYAEIFF
FT                   GNCVSLGIPCVRASRADLEALTKLINADPRTSVAIDLLAQTVTAQSESGQQVKATVEIP
FT                   PGARQSLTTGGWDFLGQLLDGEPKVRAQVARIPYLQKFAV"
FT   gene            complement(402139..402747)
FT                   /locus_tag="Plim_0322"
FT   CDS_pept        complement(402139..402747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0322"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66173"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP18"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADG66173.1"
FT                   /translation="MAQALTTQQKAETQLWVDDLFRQLEGIEGKAEIVDGGIFLMSPAG
FT                   AWHTIVSTRIGQLIEHYSQATRHGIAVSDNGTFRCVLPHRQSFSPDAAYYVGPPARFEP
FT                   FPIPPVFAVEIRSRDDYGPRAEVRLADKRHDYFAAGTLVIWDVDLRSPQVVRVYRSSHP
FT                   EEPTIYRDNEQAEAEPALPGWSVRVKDFLPDDWEVEASL"
FT   gene            complement(402845..404251)
FT                   /locus_tag="Plim_0323"
FT   CDS_pept        complement(402845..404251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0323"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: scl:sce0086 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66174"
FT                   /db_xref="GOA:D5SP19"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP19"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ADG66174.1"
FT                   /translation="MTDIRNLFNKVWDLHACQTLPSGQDQLFIGLHLIHEVTSPQAFAI
FT                   LRERNLTVAYPERTVATVDHIVPTQSTARPFVDLLAEEMMSAIEKNCRDFGIRLFDLVD
FT                   NRQGVVHIVGPEQGLTLPGMTIACGDSHTSTHGAFGSIAFGIGTSQVADVLATQTLALA
FT                   RPKVRKIEVTGQLKPGVYAKDVILHIIRKLGVQGGVGYAYEYAGDVFDRMSMEERMTVC
FT                   NMSIEGGARCGYINPDQTTVDYIQGRPFAPQGEEFERAAKWWLSLASGKDAQFDDVVVF
FT                   KAEEIEPTVTWGITPAQSVGVKETLPTISSFPADDQKVISEAFQYMDLKEGQPIQGLKI
FT                   NVAFIGSCTNGRISDLREAARIVKGRHVAAGVKALVVPGSQLVRKQAMEEGLDKIFEEA
FT                   GFEWRGAGCSMCLAMNPDKLQGNEVCASSSNRNFKGRQGSPTGRTLLMSPAMVAAAAVT
FT                   GAVTDVRELD"
FT   gene            404657..405778
FT                   /locus_tag="Plim_0324"
FT   CDS_pept        404657..405778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0324"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   pca:Pcar_1923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66175"
FT                   /db_xref="GOA:D5SP20"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP20"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ADG66175.1"
FT                   /translation="MWTFDQYLLKNFFYVFFVCFVAAFGLVVTIDLLENLDEFMLNNQS
FT                   GGALSLLVSIGTYYGYQAIFFLDRGGASLMVIAVMVVLVLFQRSGELHPMLAAGVPMYR
FT                   VLRALMIGPVLVTAVLVANQELVVPVIAHAAHGGRGIQTGEGGQVEPIYDYSTKISING
FT                   EKVSLADSQLEGAQFVLPAPLIVHDLTIIRGTTAIFRKAAGQRPDGWVIFGAAPQFEEL
FT                   ALTPRGQEIVRKVGRSGELFIASPVSCDQLFKRKSSSNYLSTSELLGRIRNEAYGPLAV
FT                   QKFVTQVHGRLTQPLINLIAVLLSLPLLVRRESAGLVMDSGVCAVAQGILFGMMQLSAY
FT                   LSTSGIIAADLAAWFPVFIGGAMAAWTRDMIRS"
FT   gene            406032..406105
FT                   /locus_tag="Plim_R0005"
FT                   /note="tRNA-Asp1"
FT   tRNA            406032..406105
FT                   /locus_tag="Plim_R0005"
FT                   /product="tRNA-Asp"
FT   gene            complement(406262..406651)
FT                   /locus_tag="Plim_0325"
FT   CDS_pept        complement(406262..406651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66176"
FT                   /db_xref="GOA:D5SP21"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66176.1"
FT                   /translation="MVIAALIAGGIGWIDSLSIKEGKAGWILPYDNSRVDLGTQIAYLA
FT                   YSTSALAGFGAVTLFSPRYRRILGFATLVAMIFASIIAIASIRELAKFIDFVTLFMIMG
FT                   MFATLMGILLITLFPTPNEDQLENQ"
FT   gene            complement(406645..407052)
FT                   /locus_tag="Plim_0326"
FT   CDS_pept        complement(406645..407052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66177"
FT                   /db_xref="GOA:D5SP22"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66177.1"
FT                   /translation="MPDNPHSSDHGVAATVDRLDSTASSRSPTWLWQTTGALVGAIPGQ
FT                   LLLFLPVNQRIALSIAGALIGLMAFYEGIGLLRLLALSLFPLLGNGAVVVLDEVGVEQK
FT                   KVSVRRQETRSKSGLRPLKGLADHGWCCSLW"
FT   gene            complement(407220..407717)
FT                   /locus_tag="Plim_0327"
FT   CDS_pept        complement(407220..407717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0327"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR; KEGG: ade:Adeh_2627
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66178"
FT                   /db_xref="GOA:D5SP23"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP23"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADG66178.1"
FT                   /translation="MSFSLPNEGTSRPLWTNPEVFDRIAERLRILAHPHRLRMVEMLLA
FT                   GKYSVGELAESCSIPSHMASEHLRLMQHCGLLGSEKEGRYTYYRIAEPNLQRLLSCLKD
FT                   QQFGLDEPGMVSHNPVSVTSNSVESESPDATDGLKCSKDAVASNGESQYIEKLHTPTEL
FT                   NG"
FT   gene            complement(407949..408428)
FT                   /locus_tag="Plim_0328"
FT   CDS_pept        complement(407949..408428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0328"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   mxa:MXAN_2377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66179"
FT                   /db_xref="GOA:D5SP24"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP24"
FT                   /inference="protein motif:PFAM:PF04241"
FT                   /protein_id="ADG66179.1"
FT                   /translation="MKPQWWLIIGAMICGTSVGTGAFAAHSLTDHFAVVYAGQTREVAG
FT                   EVIPLARKYLQDFKTGAEYQMFHGLALLAVGIWALVKQQSGQTASRLLNWAGWMFLVGV
FT                   ILFSGSLYTLTLSGVRVLGAVTPLGGVAFLAGWAFLAVAAFADQRSSITEKSAAS"
FT   sig_peptide     complement(408354..408428)
FT                   /locus_tag="Plim_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.788 at
FT                   residue 25"
FT   gene            408700..410106
FT                   /locus_tag="Plim_0329"
FT   CDS_pept        408700..410106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0329"
FT                   /product="putative polysaccharide-degrading enzyme"
FT                   /note="KEGG: mxa:MXAN_6236 putative polysaccharide-
FT                   degrading enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66180"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP25"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6236"
FT                   /protein_id="ADG66180.1"
FT                   /translation="MSVVFLWSILFSAITVFSPHASAKDYVVGPQSPLKELEEVPWESL
FT                   EPGDKVLIHARPEPYRSKWVICRRGTTDQPIVVMGIANSSGQRPVIDGRDALTRSSLNF
FT                   WSEGRGIIKIGGANRPADLTPAHITIANLEVRSARPPFQFKGREGVTPYPENAASIFIE
FT                   KGEDITISNCVLHDSGNGFFTSPQTRRILVEKCAIYGNGIEGSILEHNNYTSSEGITFQ
FT                   FNQFGPLREGCLGNNLKDRSAGLVVRYNWIEGGNRMLDLVDGHWKEPTLPEANYRETFV
FT                   FGNILIKQNDRGNNQVVHYGGDSGRLDQYRMGTLYFYNNTVISERPATTVLFRLSSMQE
FT                   SVDCRNNIVWTTAPGRSLAIFDGNGTVNLYHNWLKKDWRKTHSTGKGEIHELGVLQTGD
FT                   NPGWVDIARQDFRLQTDSQPLRTGSPLPDAAIQKHQLKFYYKPQREFENRPADHQHDFG
FT                   ALPILPHAAK"
FT   sig_peptide     408700..408771
FT                   /locus_tag="Plim_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.944 at
FT                   residue 24"
FT   gene            complement(410141..410731)
FT                   /locus_tag="Plim_0330"
FT   CDS_pept        complement(410141..410731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0330"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: maq:Maqu_2946 PfpI family
FT                   intracellular peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66181"
FT                   /db_xref="GOA:D5SP26"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP26"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADG66181.1"
FT                   /translation="MPKILIIAGDFVEDYELMVPYQMLQLLGCEVDVVCPDRRAGDFIK
FT                   TAIHDFEGDQTYSEKPGHRFTLNAELDEAATQQSTYDGLYLPGGRSPEYLRLDQRVLDL
FT                   VKHFFEAAKPVAAICHGIQILTAARVMSGRRCTAYPACGPEITLAQGQYVATPVNEAYV
FT                   EGNLVTAPAWPAHAALIGEFAKLLGITISHSKA"
FT   gene            complement(410761..411444)
FT                   /locus_tag="Plim_0331"
FT   CDS_pept        complement(410761..411444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0331"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: pmy:Pmen_1853 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66182"
FT                   /db_xref="GOA:D5SP27"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP27"
FT                   /inference="protein motif:TFAM:TIGR00017"
FT                   /protein_id="ADG66182.1"
FT                   /translation="MSGGHVVITIDGPAGTGKSTAARKLAQLLGFSFLDTGAMYRAIAW
FT                   GCLQQGMDLTRHDLVTNFARQADLQIEDQTIRLNGQDVTQAIRLPQVTLVASQVAAIEG
FT                   VREQMVALQRRAAEGQNIVTEGRDQGTIVFPEAPCKFFLTASPLERAKRREAQLRSSGQ
FT                   TVPLEEILEQQQLRDERDENRTIAPLRPAIDATIVDTTSTSLEEVIDYLQRVVITKISS
FT                   PRTTA"
FT   gene            complement(411574..412761)
FT                   /locus_tag="Plim_0332"
FT   CDS_pept        complement(411574..412761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0332"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: aba:Acid345_4208
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66183"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP28"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADG66183.1"
FT                   /translation="MGMFSLSDVQAAIREQGVDGWLLYDFRKSNVLAERVLGLDKKTSR
FT                   RWAYFIPKEGTPRKLVHRIETGVLDALPGDKRIYLKWSEFEEGMAALVAGSKKIAMEYA
FT                   PRNGNPYISRVDGGTIELIRSFGVEVVSSGDLIQLFESVWDDEQIAMHLEASKVTDAAY
FT                   VVAWKTIANDINSQGHSDELRVQRAILDHFEAHGVTTYSPPIVGVNAHSGDPHFETGSL
FT                   PDTIIREGDFVLVDLWGKLDKPRAVYSDLTRTGYVGTSVPEKYTKVFHVVAAARDAAIQ
FT                   YVVDAFAAGRRVEGYEVDDACREVIEKAGYGPYYVHRTGHNIGQEVHGNGAHIDNLETH
FT                   ETRALIPRTCFSIEPGIYLEEFGVRSEVDVLIHPNGRVEVTGGALQTEIVPILAQ"
FT   gene            complement(412883..413506)
FT                   /locus_tag="Plim_0333"
FT   CDS_pept        complement(412883..413506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0333"
FT                   /product="metal-dependent phosphohydrolase HD sub domain
FT                   protein"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: tmz:Tmz1t_0356 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66184"
FT                   /db_xref="GOA:D5SP29"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP29"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADG66184.1"
FT                   /translation="MMGTMVSPLYSMVIEKALRVAAVAHHGQLRKATNVPYLSHLAGVA
FT                   LILQRAGFADDELIAAAILHDIVEDTEVTIADLEKQFSPAVIQAVIASTEEKEDPTGAA
FT                   IPWRVRKEKHLAQMRMASHAARAITLADKLHNLGATWFDLQENPRALEKFSATPAEWLW
FT                   YHREMVTAASGIDSDLQILSSACRQMIHQIQEFIDPQPPETSPS"
FT   gene            413821..417093
FT                   /locus_tag="Plim_0334"
FT   CDS_pept        413821..417093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0334"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; MGS domain protein; ATP-grasp domain
FT                   protein; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: dal:Dalk_3481 carbamoyl-phosphate
FT                   synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66185"
FT                   /db_xref="GOA:D5SP30"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP30"
FT                   /inference="protein motif:TFAM:TIGR01369"
FT                   /protein_id="ADG66185.1"
FT                   /translation="MPRRDDLKKILIIGSGPIVIGQACEFDYSGTQACKALRECGYEVV
FT                   LVNSNPATIMTDPNTADSTYIEPIHWQYVAKIIENERPDAILPTLGGQTGLNTGMELFR
FT                   RGILEKYNCEMIGARADVIEKAEDRQLFKEAMQKIGLDVCRSRIVNSMEEARDVLKEIG
FT                   LPIIIRASFTLGGMGGGIAYNREEFEEKVRKGIELSPINEVLLEESIIGWKEYEMEVMR
FT                   DKADNVVIICSIENLDPMGVHTGDSITVAPAQTLTDREYQRMRDATIAVMREIGVETGG
FT                   SNVQFAIHPQTGRMVVVEMNPRVSRSSALASKATGFPIAKIAAKLAVGFTLDEIPNDIT
FT                   RETLACFEPTIDYVVTKVPRWTFEKFPEADPELTVQMKSVGETMAIGRTFKESLQKALR
FT                   GLEIGHFGLGGGKKDLWDSDHRPTIEEIEGKLATPNDMRIFYLRYAMKAGLSNSEIHDL
FT                   TKIDPWFLENIRDIVRMEDRLRCHERLDQVSDELLREVKRYGFSDKQIGDWLDVSDMEV
FT                   RRERKRRGILPTFKQVDTCAAEFEAYTPYYYSTYESEDEAPGPRTDGRQRVIILGGGPN
FT                   RIGQGIEFDYCCCQASFALRELGIESVMVNSNPETVSTDYDTSDLLFFEPLTTEDVLNI
FT                   CDRLQPDGVIVQFGGQTPLNLARGLEQAGVKIIGTSPSMIDAAEDREIFKGILDKLGLH
FT                   QPPNGMATDAARAVQIASEIGYPVLVRPSFVLGGRAMQICYDERMVREYMTEAVNVSPD
FT                   RPVLIDKFLEDAVEVDVDAISDGEITVVGGVMEHIEEAGVHSGDSACVLPPYSLPDAIV
FT                   DEIKTATYALAKELQVRGLMNIQFAVKHQGGEPVVYVLEVNPRASRTSPFVSKATNVPL
FT                   PKLAAKIMVGKTLKELGFTKEVVPPYVSVKESVFPFTRFAGVDIILGPEMKSTGEVMGI
FT                   DSTFPAAYARSQLGAGNKLPSSGAVFISLAGRHKEHIISSARRLIDMGFKILATSGTSR
FT                   VLREAGIEVETVRKLQEGRPNLLDYMANNQVQLVFNTPSGKGARSDEGRIRAAAVMNGI
FT                   PCVTTLPGCIAVVQALESIQESPEPSVTSLQQWIAQLPASKA"
FT   gene            417237..418658
FT                   /locus_tag="Plim_0335"
FT   CDS_pept        417237..418658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0335"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   sus:Acid_6548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66186"
FT                   /db_xref="GOA:D5SP31"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP31"
FT                   /inference="protein motif:PFAM:PF07394"
FT                   /protein_id="ADG66186.1"
FT                   /translation="MTHCLNFQSSPTNRREYLSQLACGFGGVALAGLAAERGYADVAGA
FT                   PVLPATHHAPKAKNIIFLYMDGGPSQMDLFDPKPRLTKEHGEPMKMKVQATQFDNNGKI
FT                   MKSPWEFTQHGESGLPFSSLIPHIASKADDLCVIRSMTSAFSEHTNANYFLHTGHGLQG
FT                   RPSMGAWVSYGLGTECQNLPGFLVLNGGLIPPGGVDCFHNGFLPATHQGSILKSQKMPI
FT                   SDLEPAPGPLAAQKRKLDLLKQLDQAASNRAGRPDALESAIANYELAFRMQTTVPQLVD
FT                   LATESEATQKLYGLDSDFAPTRVYARQCLLARRLVESGVRFIELTCPGVGVDRWDQHGG
FT                   LKNGHELNCKAVDQPIAALLTDLKSRGLLDQTLVVFAGEFGRTPQAQGADGRDHNPFGY
FT                   TVWMAGGGVKGGMSYGQTDEYGYYAIDKKLEIHDLHATMLWLMGIDHTRLTVRFGGRDM
FT                   RLTDVFGHVVHDVIA"
FT   gene            418814..421288
FT                   /locus_tag="Plim_0336"
FT   CDS_pept        418814..421288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00815 dolichyl-phosphate-mannose-
FT                   protein mannosyltransferase proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66187"
FT                   /db_xref="GOA:D5SP32"
FT                   /db_xref="UniProtKB/TrEMBL:D5SP32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66187.1"
FT                   /translation="MSRKRSGSQKPPPPAASHSSSLEAPHTPDLSRTVRWVIACLWLVL
FT                   ATIFFYWTGLPNNGNVSRLDYWSLVPFQLMDLVDPEFESRLPHGFFYLFERIGYSLVSA
FT                   ALIIGSAGWGWLLILGSSRLFKADVFAKQESINQVTLANNESRFQTGNLLFFSGALGLA
FT                   TTSTFVLIVGLMGQLSTILLVAWLVVGSAGTFVGLAQPALRLGQLAWLSIANAWHSRDL
FT                   WTLLGWVSALLFLWTIWLGGLSPTTDFDVKEYHLGGPKEYFLKGHIEFLPHNVYTSFPF
FT                   LTEMLSLAAMVLMNDWLAGSYVATLTLAFFGPLTALGLWSLCEKWFPQAALLSAWIWIT
FT                   IPWTYRLSTIAYVEEAFSCYLLAAFLAAIYGRSLNLPEVSHSASSAAHANFWWWISGLS
FT                   AGAAFGCKYPALLFVVIPIGLATIIRFPRFHKTDSSASENPSARSRSTWWVWPLVFSAG
FT                   VLVFAGPWLIKNFWQTGNPVYPLLYSVFGGLDWNAALNEKWRRGHAPPHYSPLSFVTDV
FT                   YDILARSDWQSGLILLGLPLCWILPAARKKNHEQPEDSPGVLLLALLFLAWFYATWWLF
FT                   THRIDRFWAPMLPLLCLISAAGLTRFSQSVPHAVRQSLMVLLGASAVFNFSINTGPVGN
FT                   YNSWLTKLSAASDFTARTTCPEIAAINQAIEEGALPQDIRVLMVGEAEIFDARFDLRYN
FT                   TVFDVCLLEEWCTHPDGQWRTADEIRARLAQAGITHLFVNWREILRYRTSYGYTDFANP
FT                   RSIEKLQQMQLIGDPLRWPEGIGERNADDLSVTDRQLIENWAPQLIQGLGSNQKLITAQ
FT                   LFPVMTRPIEAK"
FT   gene            complement(421520..422464)
FT                   /locus_tag="Plim_0337"
FT   CDS_pept        complement(421520..422464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0337"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   efe:EFER_0738 putative acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66188"
FT                   /db_xref="GOA:D5SPF8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPF8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG66188.1"
FT                   /translation="MEFRSFRNHDVPVIAELWNSAELGRGAVIMHGTDELDFFVLSQPH
FT                   FDRHGLILAFVDGQPAGFVHAGFGVGSNRASVDSTTGVICALVVHPAFRGRGIGRALVQ
FT                   QAEGYLLSHGAQVLLAGPADPFNPYWSGLYGGSEASGFLESDVLAKPFFTSLGYRPQSM
FT                   IGVFQRVIGQRDPINVRLMRVRRSTELRLLDDPVPRDFWTLTNRGRLETARLGLVLKKQ
FT                   DLPVGWVTICGLDMYSSKWQQRAIGLHGIHVAPEHRRQGYGQALLCDVSKQLKDDQVDL
FT                   MEAHANMEDPAAMAVLISSGFQLIDTGIVYRKA"
FT   gene            complement(422646..423605)
FT                   /locus_tag="Plim_0338"
FT   CDS_pept        complement(422646..423605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0338"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: sus:Acid_2452 transketolase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66189"
FT                   /db_xref="GOA:D5SPF9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPF9"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADG66189.1"
FT                   /translation="MTIGQAAGLKLGKAVRDAFGTALKELGNEFPTVVTVDGDVGNSTR
FT                   TEVFAKAFPERGFNVGIAESNMVGVAAGLAAAGKIPVVSSFAAFLTCNAYDQIRMCVAY
FT                   PHLNVKMVGSHAGISIGEDGASQMAIEDIALMSALPGVAVVVPADAPSTKHLVKGMLEH
FT                   HGPVYLRCGRIDVPEIYGPDSVLTIGKANQLRDGKNLTIIANGLMVGIALDAAVALEAK
FT                   GITARVLDLHTVSPIDQEAIVKAVKETGRLVVAEEHLPHGGVGSAVASVTAQLAPCPIE
FT                   FVNIGNTYAESGDPEGLLKKYGLTAEAIVAAAEKVCSR"
FT   gene            complement(423679..424521)
FT                   /locus_tag="Plim_0339"
FT   CDS_pept        complement(423679..424521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0339"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   gur:Gura_0491 transketolase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66190"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG0"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ADG66190.1"
FT                   /translation="MAIFKPLSLDEMKAKTKVLRRHIVRMTTEAGSGHPSSSMSAVEMV
FT                   TALFFGGFMQHDPAQPRWNNRDRFILSKGHAVPVLYAALAECGYFPVEELMTLRKLGSR
FT                   LEGHPNMKRLDCIEASTGSLGQGLSVGIGHALACHMDGLSAHTYVMLGDGEMGEGQVWE
FT                   ALASAEKYKLANLTAIVDQNGYQQTGATKDVLKLTEFQPKIEAFGWHVQTINGNDIEQV
FT                   IAALKIARSVKDRPTAIVSQTQKGFGILPILAPTGDLNYHGKPLSKELAEKALALLAD"
FT   gene            425058..425480
FT                   /locus_tag="Plim_0340"
FT   CDS_pept        425058..425480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66191"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66191.1"
FT                   /translation="MTLRHPTVTNPEPTDEELLAWLDETVSLPRSAQIEHLVRQSTELQ
FT                   SRLNGLRQTRQSGALTLGEIWRSHRVGCFSREILARYARNEGGAGLSEQIRFHLETVEC
FT                   VWCQAVWESLSEDDLSRTDRVFQTSAGQWNHQDGTH"
FT   gene            425734..425952
FT                   /locus_tag="Plim_0341"
FT   CDS_pept        425734..425952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0341"
FT                   /product="carbon storage regulator"
FT                   /note="PFAM: carbon storage regulator; KEGG: cbg:CbuG_0954
FT                   carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66192"
FT                   /db_xref="GOA:D5SPG2"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG2"
FT                   /inference="protein motif:PFAM:PF02599"
FT                   /protein_id="ADG66192.1"
FT                   /translation="MLVLSRKKLESIVIDEQIIITVVEIRGDKVRLGIEAPRDISIKRC
FT                   ELEDRHQSEPPVAGEAAVNGGQPVPDH"
FT   gene            426152..426224
FT                   /locus_tag="Plim_R0006"
FT                   /note="tRNA-Glu1"
FT   tRNA            426152..426224
FT                   /locus_tag="Plim_R0006"
FT                   /product="tRNA-Glu"
FT   gene            426494..427582
FT                   /locus_tag="Plim_0342"
FT   CDS_pept        426494..427582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_0219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66193"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG3"
FT                   /inference="similar to AA sequence:KEGG:Pmen_0219"
FT                   /protein_id="ADG66193.1"
FT                   /translation="MTTLPPTTFSPDYATARQRFQQSASRLGWRLESYSIGLHGPTGEE
FT                   LEFDVALSHGEVTDKVLVVSSGLHGVEGFFGSAVQVACMEHWLSTEAPSVKCLFLHGLN
FT                   AYGFAWLRRFDESNVDPNRNFLLPGEHFEGAPDGYQQLDRFLNPRHSPSPWEPFTLKAL
FT                   WLIARYGMPALRQSIAGGQYTFPQGLFFGGKGPSRSQQILREHMPLWLNGCRQVAHLDF
FT                   HTGLGRFTTHKLLIDYPLSEAQRNWFSHWFGADSFEAIDSAEMAYEARGGFGRWCVSQR
FT                   LAANYLFACAEFGTYGGIQVLAGLRAENQAHHWGSPQDPSTIRAKRRLMELFCPASPTW
FT                   RSQCVTSGQRLIEQALQGLLQS"
FT   gene            428102..428521
FT                   /locus_tag="Plim_0343"
FT   CDS_pept        428102..428521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66194"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66194.1"
FT                   /translation="MADRFRDKRWRNFRRRADYAPQNVYRHRTHGWEYIPVHPFGDEPE
FT                   VLARLGLRPEDCRTADAWWGIDGDATLLESGVVGTLPGPARLFAKPMPHADERWVYLVA
FT                   VFDAPFVTRVEFEAVMVRFVEAGFPDATQFDWRVG"
FT   gene            428663..429262
FT                   /locus_tag="Plim_0344"
FT   CDS_pept        428663..429262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0344"
FT                   /product="AAA-4 family protein"
FT                   /note="PFAM: AAA-4 family protein; KEGG: ajs:Ajs_2526
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66195"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG5"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ADG66195.1"
FT                   /translation="MTPISTLPYEQSLLALIRKGESVELELKTTVPSPTALAQLISGFA
FT                   NASGGTIIIGVQEPDTVVGCDWQTVSRAFERAQQQLNPVPDCYLHQATISGKIVGVLNI
FT                   AKSSKPVVSSGGAFVREGDRTRPITAPEIEQRLATPGAIDTSAISKALADNTATIERLT
FT                   AAISRAQSLHGQWLGYAIGFVLGILLLSLQASSTPS"
FT   gene            429396..430064
FT                   /locus_tag="Plim_0345"
FT   CDS_pept        429396..430064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66196"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66196.1"
FT                   /translation="MRTSLPVLIACVLVAASGKAQDKDERQVDVPKLINALASENPAPT
FT                   ERSGPDLKFPSGYDRKKQAPVRSAKSQLKALGPAAFKSLIENWGDQRYCLTYSVGINGY
FT                   MKNATVGKMCRVIVYDQIQPYGIWPRTEGDPRGKPKRPSYPGVFLNDQKAATRWLEEHK
FT                   DKSLFEIQLMVIDWVIARESESPKDFTDEERAVMREIREKLVESKKPMTRGNYYMDDYD
FT                   "
FT   sig_peptide     429396..429458
FT                   /locus_tag="Plim_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.975 at
FT                   residue 21"
FT   gene            430229..430852
FT                   /locus_tag="Plim_0346"
FT   CDS_pept        430229..430852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66197"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66197.1"
FT                   /translation="MYVCDGTFYEVAAYIQGFAAAMTESPFGGENRFAFNEYVTLACGF
FT                   PAKLAWPFVLKKATQTDEDAIAKLHTLLTAYIEAVDGNRVAQLLSTERMNGSVRDAEPQ
FT                   VICWRLFSRALHRGDQIEIEKHALQRDDIQILWSSSYPADLIPKMDEIAESYSIPVLFV
FT                   SDDGMLSRVMTPDFGEIELEMLDGSWKIDPSPIIRQRIYANTKT"
FT   gene            430904..431485
FT                   /locus_tag="Plim_0347"
FT   CDS_pept        430904..431485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66198"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66198.1"
FT                   /translation="MENLFATARSSVALRPNNNSVVMIPDYSMELCFSESGKALVRSRV
FT                   ADLCDDESADIVRELPFDDAKVAVEICLLAPPNAPHEMLDGFSVQNGVSSCGIVDLEYS
FT                   PTSQYSQINGSFSLEFWPRTRRLQYIFFASMTFRTQITKLLAECGGTWGAIIFESSLPI
FT                   EFWSRERGRFNDDRPDRQDGKLLLPSELKS"
FT   gene            431591..431920
FT                   /locus_tag="Plim_0348"
FT   CDS_pept        431591..431920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0348"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: amc:MADE_03304
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66199"
FT                   /db_xref="GOA:D5SPG9"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPG9"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG66199.1"
FT                   /translation="MKLGKPEISLAVSDIKASLVFYEALGFKRVEGAEEEKWVVVAQPD
FT                   LRIGLYEGHVDANSLTFFGGDIEAISVKLHEAGFELKQGPETEEDGSIGAKAVDPDGNL
FT                   IYFNT"
FT   gene            432083..432634
FT                   /locus_tag="Plim_0349"
FT   CDS_pept        432083..432634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbc:SbBS512_E3877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66200"
FT                   /db_xref="InterPro:IPR029082"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66200.1"
FT                   /translation="MLSRDGARLQVFLDLQRHGPRRGPEELVILDEHTIERPWGWVFFF
FT                   TTRGCRDGDLTYAVGGNAPYMVNRDGSIRLAGTGRPIEDYIREYESELERQSGAWELVI
FT                   SEPSPCSTTAAKSIRAALGLSIAEVGAIRHRLPGLVSAGAYADLEPLYGRLVDAGIRAE
FT                   IRKAKVNEAEQDAAPDRGGG"
FT   gene            432833..433366
FT                   /locus_tag="Plim_0350"
FT   CDS_pept        432833..433366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66201"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66201.1"
FT                   /translation="MATLWLCSLETVRRIPSQGHPIPMSIFDTIKGWLNIGGVKVALQL
FT                   DNKQIACSGNEIAGSVELSSKGEKEILRLTYRFLTRHITGTGQARSVVDKIIAETVEEV
FT                   PFQMTAGEIKTLRFAIPYVIPPEFYETGGVLGALGKAGALVVNARRSWHVMVVCDVRGT
FT                   ALDPMSMVEVKLVE"
FT   gene            complement(433827..434222)
FT                   /locus_tag="Plim_0351"
FT   CDS_pept        complement(433827..434222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xylH; xylose ABC transporter; K10544 D- xylose
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66202"
FT                   /db_xref="GOA:D5SPH2"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66202.1"
FT                   /translation="MSWKQIIAWDGILPGIMATLPLFVQMLARGNDLAVISVVVLVPII
FT                   AALVRSSIGYRQFRRLGISTPPLWRQFFLGCAIALLMLCEGTVAIFNFANDEPAEAWVF
FT                   PAVVYGTYLICIFFAFLKPPEGPQLSD"
FT   gene            complement(434424..434987)
FT                   /locus_tag="Plim_0352"
FT   CDS_pept        complement(434424..434987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_3135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66203"
FT                   /db_xref="GOA:D5SPH3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH3"
FT                   /inference="similar to AA sequence:KEGG:Pmen_3135"
FT                   /protein_id="ADG66203.1"
FT                   /translation="MIRITMSDYRRNYNGRTFFFTVVTERRRPILTTDTARHHLRQAIR
FT                   TVHRKHPFEIVAIVLLPDHLHTVWTLPRNDVDYSRRWRLIKMYFTKAWLQEGNADVTPS
FT                   TSRQSRGEQAIWQRRFYEHTCRDEEDLKRCIDYIHANPLKHGLVNRVADWPWSSFHRFV
FT                   QAGEYTLEWGRTISWDNDEFSDFE"
FT   gene            435356..439528
FT                   /locus_tag="Plim_0353"
FT   CDS_pept        435356..439528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0353"
FT                   /product="membrane-bound dehydrogenase domain protein"
FT                   /note="TIGRFAM: membrane-bound dehydrogenase domain
FT                   protein; heme-binding protein; PFAM: blue (type 1) copper
FT                   domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66204"
FT                   /db_xref="GOA:D5SPH4"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR006585"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR013428"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH4"
FT                   /inference="protein motif:TFAM:TIGR02604"
FT                   /protein_id="ADG66204.1"
FT                   /translation="MYQSVWPSLTFSLCLLASTSANAGEAVLVEAPPEKSAGIVVANLE
FT                   QTPAKQPAQTAAAKQPPAAPVKQPVRFVRIELPGEKRILTLAEVEVFSAGKNIAREGKA
FT                   TQSSTHGDGVASRAVDGNKHPDWSKGGQTHTSDDGEQQPWWELDLGKPANIEKIAVWNR
FT                   TGFENRLSGFSLILLDADRKELFRKADIAAPQGLEIDLGKSGELRYLAYDGKPGKAMPK
FT                   GGDSSSGASAEPPLANVPADYRDPVPFALQKDDVVAILGNGLADRMQHDGWLETLLQSQ
FT                   LVGKNVRIRDMSASGDRPYSFPRSSGQISITSYLQHVKPTVVFAFFGYNESFDTKPEEY
FT                   KRQLLEFVKKTRGAKPDGKDFPRIVLFSPIAQEDTGNPNVPDGRAQNVRLAALTRATQE
FT                   AAQEAGVAFIDLFHPSLKLYEKASQPLTINSVHLTEEGNRQLAEVIASELLGKPVSSSQ
FT                   ASEKLRQAVLDKNLHWWNRYRASDGNDVWGSRSTLTFVNNQSNADVLKPELEMLDVMTA
FT                   NRDEVVWARAAGKDKAVDDSNVPPAVPVISNVGGGSKSSSAMKEGTLSYISGEEGLKQL
FT                   AVAKGFEVSLFADEQRFPQLVNPVQLQFDTKDRLWAAVWPTYPKWEPHQEMTDALIILH
FT                   DDNGDGVADRSTEFAKVQNPLGFEFWNDGVIVTCQSELLFLQDTNGDDLADRRITLLQG
FT                   LDSSDTHHGANNLIYGPDGGIYWQSGVFMVHNHEHPWGPSLQSTASAMYRFDPRRFTIS
FT                   MHAINSPNPHGTSFDYWGYQYATDGTGGNAYQVRPEGNGFKMHQLLKKEVRPVTASEIV
FT                   SSSHFPESMQGDFLICNVIGFLGIKHYDLERNPETGTVWGEPAGDQLTVTVTNANGSKT
FT                   EDKSRGLLMSGDKNFRPSDAIFAPDGTLYFADWHNAIIGHMQHNVRDPNRDHSHGRIYR
FT                   VKAVDRPLQKPVPIDGQPIAKLLDNLKSPVDGIRHRTRVELSERDSKEVIAATKEWIKQ
FT                   FDPNKREDAHHLLEALWLHQQHNVKDLQLLEMVLNSPEPHARNAAKTVKHFWFNVEKTL
FT                   RGGIVAGAELASSQKSGILSDTPELTTIRIATIPEKMMYDVKELTVKPGKKVRLKFANY
FT                   DFMPHNILLVKPGTADDVGIAAINLGARGFDKGFVPESTDILWHSSLVDFGQEQVIEFT
FT                   APTEEGAYPYICSFPGHHRLMRGMLFVTNDLKAFLAKNPQQEIKVTEWKLDDFAADLKR
FT                   VSQHRNFAEGKKHFTTLGCVQCHRLGKDESTATPALDGIAQAVGPNIDEVVKKYKRDPN
FT                   VLLREILESSRNIDEKYRQVVVVLDDGKSYTGVVAAEDNNTLTLLAGSPPKRVDIPKKS
FT                   IDDRVASPVSIMPSGLLNTLDKEQILDLMAYLLAAGNAHDSAFHHGH"
FT   sig_peptide     435356..435427
FT                   /locus_tag="Plim_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            439671..441152
FT                   /locus_tag="Plim_0354"
FT   CDS_pept        439671..441152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0354"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: sus:Acid_2580 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66205"
FT                   /db_xref="GOA:D5SPH5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032158"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH5"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADG66205.1"
FT                   /translation="MPLYLAMTLLILLIGSPWVQAAPPNIVILYADDMGYGDLHIQNPE
FT                   SRIPTPHLDRLARQGTRFTDAHSSSGICTPSRYALLQGRYHWRKFHGIVNSFDPPVLDD
FT                   EKLTIAELLKTKGYRTACIGKWHLGWDWNAIKKQGVKPTDKAGFAADAFDWSQPIPGGP
FT                   RSHGFDYYFGDDVPNFPPYAWFENDRVITTPTVTLKTTAPTAEGSWEARPGPAVQDWDF
FT                   WAVMPTLTQKAEQWISEQKADQPFFLYFPFTSPHAPIVPTSDFTGKSQAGGYGDFMFQT
FT                   DDTVGRVLAALEKHGFSENTLVIFTADNGPERYAYDRIRNFGHRSMGPLRGLKRDIWEG
FT                   GHRVPMIVRWPGVVPAEKVCDELISQIDLFATIAAVVDAEIAPGSAEDSYNQLELLKGT
FT                   GSSARQTLVHNTNPKGYALRHGDWVLIDAKTGAVSQVPKWFDEANGYTSHSLPGELYNL
FT                   KDDLAQRQNLYAENPEKVAELKALLGKIQAQGQVR"
FT   sig_peptide     439671..439736
FT                   /locus_tag="Plim_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            441394..442077
FT                   /locus_tag="Plim_0355"
FT   CDS_pept        441394..442077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0355"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: ppu:PP_1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66206"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH6"
FT                   /inference="similar to AA sequence:KEGG:PP_1102"
FT                   /protein_id="ADG66206.1"
FT                   /translation="MAEPTSATKGDLQLLVAGETLRLLPEKAIYWERCSTLLVADTHWG
FT                   KAASFRAASIPIPQGTTQADLERLSQVIERTHATRLIVLGDLLHSREGRSAATFEKVTQ
FT                   WRRRHENLRIELIQGNHDLQAGLPLADWKIVVARPPVIELPFVWQHEPMPHAEGFVLAG
FT                   HIHPSIVLKGLARQTLRLPCFHLQQNQLTLPAFSSFAGGYNIKPGRGDRIFPVADTGVV
FT                   EIPCN"
FT   gene            complement(442584..442925)
FT                   /locus_tag="Plim_0356"
FT   CDS_pept        complement(442584..442925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0356"
FT                   /product="ribosomal protein L21"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: ilo:IL0475 50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66207"
FT                   /db_xref="GOA:D5SPH7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH7"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ADG66207.1"
FT                   /translation="MVFAIFEDGSRQYRVSVGDVLVVDYRKEANLGDVLTFDKVLLANG
FT                   GADSLIGTPALSGATVTAEVVNSLFKGPKLEIQKLRRRKSSKRHTGHRQKHTQIKVTAV
FT                   NVPSLAVAE"
FT   gene            complement(443034..444647)
FT                   /locus_tag="Plim_0357"
FT   CDS_pept        complement(443034..444647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0357"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: gsu:GSU0921 ribonuclease, Rne/Rng family
FT                   protein; TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; SMART: RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66208"
FT                   /db_xref="GOA:D5SPH8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH8"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ADG66208.1"
FT                   /translation="MRKEMLMNVLQPEESRIAILEDGVLEELYVERNSLENYVGNIYKG
FT                   RIVNIEPSIQAAFVDFGVGRNGFLHVSDVEYQYYKHLVDGPDESFDDDDDEEDEKPRGR
FT                   PRAPRGLDRTSRGKPPIQEIFRRGSEVLIQVIKEGIGNKGPTLSTYISIPGRYLVLMPG
FT                   LQRVGVSRKIGDDSIRRRLRQQLKELSPPEGLGFIIRTAGIDRSQKDLQRDMNYLLRLW
FT                   NVIVKRIRKFPAPVDIYEESDMMIRTIRDIYNSEIENIWIDEPRAYERAKEFMKIVLPR
FT                   AVDRVQLYDGKEPLFHKHGVEEEIARIQRRHVPLKGGGSIVIDQTEALVAIDVNSGSFR
FT                   QDENAEENAYQMNLRAAEEIARQIRLRDLGGVIVNDFIDMREERHRRGVERALADAVAR
FT                   DRARTKILRTSPFGLVEMTRQRIRPSLRRSVYEDCPCCAGTGQVKTAESMAIEVMRLLM
FT                   FHANHQEVTRIVVDVQERVGAYLNNKKRREISQLEEQYEVAISINSLSNVTPEHLRFFC
FT                   TSESGTEIRFSSPEDSKARR"
FT   gene            complement(444676..445374)
FT                   /locus_tag="Plim_0358"
FT   CDS_pept        complement(444676..445374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66209"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66209.1"
FT                   /translation="MALVRTTGPKKVIPLVSPHVNNLSLQSPADDDAPALCDVQRKVPT
FT                   GCYVSLRNGCLPAHGIGVASAYGRPAKAALISVHCPSNLCSNCTSLRLWTASGQGPVVF
FT                   ALCSFRSDCNRRNRPVLLRDNLHHQQPFGNSSSVFYSTKPVSILPALQMQQFPMDFESS
FT                   HKRDTVPDIRQYRLRRFEARIGQMALRWQESAGSLGIQGYPGWTGRNRTWLSVEESRQC
FT                   CRGLMVGLSC"
FT   gene            complement(445544..447292)
FT                   /locus_tag="Plim_0359"
FT   CDS_pept        complement(445544..447292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0359"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region; KEGG: phosphoenolpyruvate-protein
FT                   phosphotransferase; K08483 phosphotransferase system,
FT                   enzyme I, PtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66210"
FT                   /db_xref="GOA:D5SPI0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI0"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADG66210.1"
FT                   /translation="MLVKHGIAVSPGVAIGQSMVLGAESFRIPQRFVSVSAVDAEINRF
FT                   RISLQAVCTEIEENERVARERLGKQYAAIFTAHLMMVQDHRIVDEIELLVRQKCFSPEF
FT                   AVSRVFRQYAKKFQNLGVPYLAERATDIFDLEKRVLRQLLGERREELRNIQAPVLILAH
FT                   NLTPSETASLDKAYVLGFATEVGGTTSHTAILAGALELPAVVGVGNFLSDVAGADTVII
FT                   DGSHGAVIIDPDAETLARYRAVEQEHRNFSNRLEAIRTLPSVTLDGVGISLYGNIEFPH
FT                   EAASARQRGGEGIGLYRTEFLYLDASAEPTEEDHYRSYCEVLKAFPDRPVVIRTLDLGA
FT                   DKLPIGFRMEYPEGVNPALSLRSIRLSLQHLDLFRTQLRAIARAACHGDLRIMFPLIST
FT                   LLELRQAKMILGDVLEDLEEQGIAYRRDIPVGMMMEVPSAAIMAEQFAREVDFFSIGTN
FT                   DLIQYTLASDRGDPRIANLYRAGDPAIIRLIQIVVKAGQSRGIPVSVCGQMSSDPLFVP
FT                   LLVGLGLRQLSVTPHLIPEIKELIRKLTISKAENLANRVLRMETANDVESFLRGEHRKL
FT                   SPESPA"
FT   gene            complement(447382..447666)
FT                   /locus_tag="Plim_0360"
FT   CDS_pept        complement(447382..447666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0360"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: dar:Daro_4083
FT                   phosphoryl transfer system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66211"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI1"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADG66211.1"
FT                   /translation="MSQMIHRRNVIVRTEHGLHLSPCSRVAQAALKFRSQVWLTKGSVR
FT                   ADAKSVLDLMTLAAGPGAELTLEVTGDDAPEAVEAILHLFEYDLVSASS"
FT   gene            complement(447823..448293)
FT                   /locus_tag="Plim_0361"
FT   CDS_pept        complement(447823..448293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0361"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: sfu:Sfum_2067
FT                   putative PTS IIA-like nitrogen- regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66212"
FT                   /db_xref="GOA:D5SPI2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI2"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADG66212.1"
FT                   /translation="MKLCDFVVPAAIVPDLQATTKEAAIRAMVSSLCQSGVVPASDEEG
FT                   IVSAILKREELGSTGIGRGVAVPHTKHPSVDRLIATVALSHTGVDFASLDGESVYIMFL
FT                   LISPPDRPGDHLRGLENISRHLRNDNFCKFLRQSKTHEAVLELLKEADNNEI"
FT   gene            complement(448589..448933)
FT                   /locus_tag="Plim_0362"
FT   CDS_pept        complement(448589..448933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0362"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   dar:Daro_4148 SSU ribosomal protein S30P / sigma 54
FT                   modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66213"
FT                   /db_xref="GOA:D5SPI3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI3"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADG66213.1"
FT                   /translation="MQIAITSRHGSISPEAQELIREKSEKLLTYFARVTSINVTVSFEH
FT                   HRATVEILVDAEHKHDFVATDTGDEVIPVFYAALHKMEQQIHKYKEKVQDHKGGPTAAD
FT                   VATLPAEGEK"
FT   gene            complement(449252..450520)
FT                   /locus_tag="Plim_0363"
FT   CDS_pept        complement(449252..450520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0363"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66214"
FT                   /db_xref="GOA:D5SPI4"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI4"
FT                   /inference="protein motif:PFAM:PF07995"
FT                   /protein_id="ADG66214.1"
FT                   /translation="MLIQNRYGLFVMALLTTLCAGEAWISSSPAAEEAISTKALPVKVV
FT                   PVFENVEWSGWEAVSEDGLSQTFRPILLTNFGDGSNRIVVPTQQGVVHVIENTQAKQKS
FT                   HILFDLSSKVVYKDKENEEGFLGMAFHPNFRENGELFVYYTTKDAPHTSVVSRFKAKGT
FT                   QPQTVDLASEEEILRIPQPYWNHNGGTIAFGPDGYLYIALGDGGSGGDPHNNGQNLETW
FT                   LGKILRIDVNQREAGKAYAIPADNPFVKKAGARPEIYALGLRNVWRMAFDRATGVLWAA
FT                   DVGQNLWEEIDIIQKGGNYGWSVREGLHPFGKNGNRSSQGMIDPIFEYNHDVGKSITGG
FT                   FVYRGEKVPELQGKYLYADYVSGKLWALDYDSKAQKVVGNHLIPSQQLPVVSFGEDEKG
FT                   EVYFMTVTGSGKGIYSFQPGGSH"
FT   sig_peptide     complement(450425..450520)
FT                   /locus_tag="Plim_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.634 at
FT                   residue 32"
FT   gene            complement(450865..452346)
FT                   /locus_tag="Plim_0364"
FT   CDS_pept        complement(450865..452346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0364"
FT                   /product="Male sterility domain protein"
FT                   /note="PFAM: Male sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; NAD-dependent
FT                   epimerase/dehydratase; KEGG: afw:Anae109_2676 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66215"
FT                   /db_xref="GOA:D5SPI5"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR026055"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI5"
FT                   /inference="protein motif:PFAM:PF07993"
FT                   /protein_id="ADG66215.1"
FT                   /translation="MSYQLLTGATGLLGTYLLRDLLMAGTRVAVVVRPNRRQNVRQRVE
FT                   TLMTYWDETLGTKLPRPVVLEGDISQADLGLDAVSMRWAAEHVTGVIHNAASLSFVATS
FT                   EDGEPYRSNIGGTRHVLEFCRSLGIRQFFHVSTAYIAGQRQGRVLETELDVGQELSNAY
FT                   EESKLASEKMVREADFLDSPTVFRPGIIIGDSVTGYTTTYHGYYAALQLCNTIVKTFNA
FT                   DETGLVGAQKVRLALNGNETKHLVPVDWVSAVMAHVITHPEHHGQTYHLTPQHPVTIRM
FT                   IRDILEETCHFYDTHLVGVGTTLDKMSEAESIFYEHIRVYNSYWKNDPSFDRTNTLKAA
FT                   PHLPCPAVNRRRLVELSKIVIRDGFPSPSKRPVDPEFDSAAFFQQMLDQAARDPQYDEQ
FT                   DRSISLNLLGNGGGQWHLRIRQGNIVGAEIGLNDDSDALVEMTIDSFAQLVAGQKTMGQ
FT                   LVAESAVRASQERAEEDLLSVLDQLSQQEVAEVQK"
FT   gene            453048..454181
FT                   /locus_tag="Plim_0365"
FT   CDS_pept        453048..454181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: actin cytoskeleton organization protein App1"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66216"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI6"
FT                   /inference="protein motif:COG:COG4850"
FT                   /protein_id="ADG66216.1"
FT                   /translation="MLFRSRAQVRSVDCCEVRHNEEIVFYPSYVAPDSTGEQWTMHIQG
FT                   CIYNLNLPWLRHPIMGAIRRALRIDAEFTETFASRLKPFLVGVEENRQIVVRVGQELVD
FT                   AGKTSAAGLFNGAITLSKETLENITGEAVRPGLWVPCQAVLDPSDNRQFDGASIVVDRQ
FT                   GLSVISDVDDTVKHSNVSNRRDLFQNTFARVFSPVDGMAEIYRDLAARGAVFHYVSGSP
FT                   WQLYRPLREFWETYQFPVGSFHLKRFRLRDSARKLKKSPQMQHKRTSIDPILTAFPDRK
FT                   FVLIGDTGEQDPEIYASVLRDFPQQILGVYLRALHGETADWPRFQQGFADLPADKWHLY
FT                   PHHEELRSRVLECVEKYDGFRSQVVLPEPPPLSMPDT"
FT   gene            454184..456394
FT                   /locus_tag="Plim_0366"
FT   CDS_pept        454184..456394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0366"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mex:Mext_2399 M50 family
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66217"
FT                   /db_xref="GOA:D5SPI7"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI7"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ADG66217.1"
FT                   /translation="MISGGLFLRTDVECIPFAGGQAGDHYLFDPLALKYSLLSEKETFL
FT                   LEKLEQGIEIPRLCHLFEERFSETISPQALEQFMQTLRQQGWAIESPFDAPTMTMMAHR
FT                   LRARRLWAKFANPLAIRFRGIDPTHLPGEIDLLQVANCLMGWIFQWPWIGMGLLLAITS
FT                   LTIVLTHPAELFLAVRLATGQELVFWQLALCLCLVKILHELAHGVASLRHGAHCHELGV
FT                   MLFVGTPVLYCDVTDSWRLPSRWSRMAIAAAGIYIELWIASLATLVWWLAEPGLVSNIA
FT                   LQLMLICGISSLVFNGNPLLKYDGYFILADALKMPNLSDRSRQTVTVFLDWCWLGLSRP
FT                   WPRGVSYHNAAGLIGYAVASSLFRLGLMISILIALHTWLKPYGLDILTWISGSMLLLGT
FT                   GTSFVNRSRRYLTDTQRQNALRTTRARLIALAIVLLVTGGLLWPWPASMTADGYVIPHE
FT                   GVIVRSPVSGRVIFATSKSILTQGEIILELEDRVQKQRLLQQKARVATQRLLLEGLLQR
FT                   QVFEPAVQAMIPTAKQELQDLEEQLAQWEAEEQRHQLKALVSGRLITIPRTESQAKSAI
FT                   QMEDPLRRELALPNWSGSILDPSNRGAFVEAGAELAWIAPQPGYDVLMRVSQSDIVRVS
FT                   PGQEVIIWLQSATQRLLKGTITEISNAPIATTGTVNSASGSKWGFPAFTSDQRVYEVKA
FT                   TLNDASEQVLTGMPVTAKIQLPPESWFRWLMREFRRILRIDW"
FT   gene            456543..457052
FT                   /locus_tag="Plim_0367"
FT   CDS_pept        456543..457052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66218"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66218.1"
FT                   /translation="MSDQAKKDQLRLGFLTAVEDPERGYVGGLLVTNRYGRPLEFQCTT
FT                   PVKPNRTQQILYGPTLRPYLLSELIGKTLIEKVGVKPHLVLTEDESLCELREHVDIPVG
FT                   CFSDESTATLRIGNRHLEFHSSHASEMDHVRDQCKDVPTSADLKEPFDRIREALQETMK
FT                   AALNRS"
FT   gene            457127..459151
FT                   /locus_tag="Plim_0368"
FT   CDS_pept        457127..459151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0368"
FT                   /product="SNF2-related protein"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: mxa:MXAN_7274 SNF2/helicase domain protein;
FT                   PFAM: SNF2-related protein; helicase domain protein; SMART:
FT                   DEAD-like helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66219"
FT                   /db_xref="GOA:D5SPI9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPI9"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADG66219.1"
FT                   /translation="MDESSKTTSVAHTLRTAPERTSSEGLHEGVEQNSSSSAVPAPHWL
FT                   PQVLESIAQYDNQNVAPPDTKDVPLSMGTDLHLAGINSALQRLPKVDAEPVTLMKSIPL
FT                   GPAWKPSRPRIQTFGLKFPEGLEFLPPPKPKEESRQESMAENASASEAAPAQESVSSAA
FT                   DVTAADLIEKSEAALVEKPEAKLTRIKPPAGVLTLEDRLFYLLQPPLQTWLKGQELIMP
FT                   FEPFPYQYEGIAWLFSHDAALLADEMGLGKTMQTITAIRLLVRSGQVRRVVLVCPKPLL
FT                   PNWQREFRTWAEELPFVVVEGDTDRRRITWTMPGVPVLIVNYETLVRDVANFGDEFPKF
FT                   DLVVLDEAQRIKNRTSRTAETARRIPRRRAWALTGTPIENRPEELGALYEFLELVPPGS
FT                   TPDLKQLQSLSKEFILRRTKDLVMKDMPPRLDRDAILELSPAQRYSYDTAEKEGVIQLN
FT                   EMGDSISIQHVFELVLRLKQITNWDPLTGESAKFDRLEADMEEVAASGGKAILFSQWTK
FT                   TLDFLKEKLERFGPLVYHGGIPNKLREPVLKQFKEDPTKHIILMSYATGAVGLNLQFAG
FT                   YVFLYDRWWNPAIEDQAINRAHRIGCKSQVIVTRFISKDTIEEKIDRVLTEKRELFRAI
FT                   LGDGDNLNASLSMTASEIFGLFDLKARHGKGTRSIGPKP"
FT   gene            complement(459364..460155)
FT                   /locus_tag="Plim_0369"
FT   CDS_pept        complement(459364..460155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0369"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: scl:sce8295 phosphoadenylyl-sulfate reductase
FT                   (thioredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66220"
FT                   /db_xref="GOA:D5SPJ0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ0"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADG66220.1"
FT                   /translation="MAKLSQADLTELNRNFEERTPEELLRWATEMFGTRVAAISAMQMA
FT                   GSVLCHIISRQKLALPVLFVDTGVNFQETLDTRDRIAAEYGVEVRTLVPSMSMEEQTRE
FT                   LGVLYLTPDGQERCCHLRKTLPLARTKGQFDCLVSSLRRAEGGKRDNVPILSVDPPMNS
FT                   LRLNPLANLKDDEMDAYIATHNVIINPLHYQGYSTIGCNRCTTPVLPNEPKRAGRWRHL
FT                   GPWAMYCGINATDVDGGISPSIDLSQEVVDRILGRSTDFTI"
FT   gene            complement(460798..461496)
FT                   /locus_tag="Plim_0370"
FT   CDS_pept        complement(460798..461496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0370"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   dps:DP1332 2-heptaprenyl-1,4-naphthoquinone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66221"
FT                   /db_xref="GOA:D5SPJ1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG66221.1"
FT                   /translation="MRPRLEPRALFDEMAKTYGIVHVISSLGFAFFWRRQCAKAIDKES
FT                   RVVLDVMSGAGEMVPILIRHIRCDAKIRLVDFSTGMCDRAQKNSKRWKREHLEVVNEDA
FT                   LSLSCPDNEFDAVTCSFGLKTLTTNEVDQFAAELWRVTKTNGTVSLLEFSVPRSRFLYP
FT                   FFKLYVKHYVPLLGRILLGNPDNYRMLWEYTSEFKSCRGVIQNFERVGFQTRFYSHFFG
FT                   CATQIVAVKV"
FT   gene            complement(461462..461686)
FT                   /locus_tag="Plim_0371"
FT   CDS_pept        complement(461462..461686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66222"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66222.1"
FT                   /translation="MASNMARRLLRASDSRLLSRDLPHLPLNEVGQTRLYRKIEERFNS
FT                   FQQSILRSEIMHRSDETTSETATRTTRTV"
FT   gene            complement(461818..462255)
FT                   /locus_tag="Plim_0372"
FT   CDS_pept        complement(461818..462255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66223"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66223.1"
FT                   /translation="MLNQPSPDFSLIIKDNEKTAAQALSDGQFVQTYLLVHSLIEALLR
FT                   HFLQISDEKNISFDKLIQKYRVYLDQMGYTIPTFLDELTQFNRRRNRIVHQLWRKGHSY
FT                   TNLQAEPAARGAVIMYSLLIEWLETYDPAITQIGFRLDEGI"
FT   gene            complement(462590..463252)
FT                   /locus_tag="Plim_0373"
FT   CDS_pept        complement(462590..463252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0373"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: mxa:MXAN_3711 DNA-binding
FT                   response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66224"
FT                   /db_xref="GOA:D5SPJ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG66224.1"
FT                   /translation="MTKTNERRNIWLIEDNQSFRRALSKTIDAMPAYHCAANFSTAEEA
FT                   LTALEVQSAPELILLDIGLPGMNGISAMKPLRAASPALKIIILTVFDDHNRIFGAICAG
FT                   ADGYLLKTSSAEEIARAIEEVLSGGASMTPQIARKVLELMSNTPPKATVPKSPSDLSLR
FT                   EQDVLKQVVRGLTKDEIARALKLSPHTIDTHLRNIYQKLHVHNRAGAVAIAIRDGLV"
FT   gene            complement(463283..465394)
FT                   /locus_tag="Plim_0374"
FT   CDS_pept        complement(463283..465394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0374"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   KEGG: vco:VC0395_0623 sensor protein UhpB"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66225"
FT                   /db_xref="GOA:D5SPJ5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ5"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ADG66225.1"
FT                   /translation="MARYAPEVFTPLNLRLWRLLALLLIGLLSTSNLQAEAKTPWFDQL
FT                   ARILSPQVAQLSRSEQDLKSRLASLPLYTPQEVLRAGYHSQFQPSRDDQEWIQVDLGAI
FT                   RTFESIVLAPVLLRLNDQQIPGYGFPKRFRVEVADQLDFQNPRILADFTAEDFPAPGYF
FT                   PVQIATPGAIGRYVRITFTRLATLDGNHFVAIGELLVISGMRNIAFWRPVDAKSSIEAD
FT                   LRWSTEYLVDEFSVIPPPVGLQKSPSDGFQQKGPKATQLTITIDLGETYPIDEVRLYPA
FT                   QPTDSPSSPGWGFPTSFQILLSNSPEFEDAEAILDFSRFELRHWTDRPLIIPVASRRLF
FT                   RQQLPQLHDMRGEVDLPIDPLPARYVRLIVNVPDERQSPPVAALAEMQVYAGDQNVALK
FT                   KRVTITHSDTASTGSDKSETASSRWFPAAIVDDFTSRNDIIELANWLKQIDLRRQYEAQ
FT                   LSSVQEKLAQSRSSFWVNAGVGGGGILILSLSFLLTAILWQKGRIHRETTKLRERIASD
FT                   LHDDIGSNLGTIALMSRNLATETGIPQESTHDLIEISKIATETSQAMRDMLWIIKPAPL
FT                   TLEEFISQVRQSATRMLGNLDLKIETPKEIPEVTVDIVWRRNLFLSIKEIFHNLSRHSL
FT                   ATAVSITIILDRKSFLLEIVDNGVGFDSQKVLTGDGLPNIRKRIGELHGSIEFLTGTPH
FT                   TTTLKVPLP"
FT   sig_peptide     complement(465287..465394)
FT                   /locus_tag="Plim_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.719 at
FT                   residue 36"
FT   gene            465578..466564
FT                   /locus_tag="Plim_0375"
FT   CDS_pept        465578..466564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0375"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66226"
FT                   /db_xref="GOA:D5SPJ6"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ6"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66226.1"
FT                   /translation="MHLSSARRGFTLIELLVVIAIIAILIALLLPAVQQAREAARRTQC
FT                   RNNLKQIGLALHNYHDVMQCFPFGSISNALNNSGGGGATPSTTATGASLPPTDISWMPM
FT                   TLPYIDQAPLYNSVSPYFVTTNSRDFPSNLINKVIPAFVCPSDPNGSKLTEFHGATIDR
FT                   NDGFCGNYLACNGSTEVTVANSRAMDGMFFYRSSVRMRDIIDGTSNTVMLAEVNLVPEV
FT                   TPNVSRDWRGRYWRADHLSSIFSTNLPPNTTASDRCRTCEGSPVSPTYAPCTASTDPQV
FT                   IYARSRHTGGVHMALADGSMRFISENIDLGVWRALGTRAGGEVVSEF"
FT   sig_peptide     465578..465688
FT                   /locus_tag="Plim_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.927 at
FT                   residue 37"
FT   gene            466906..467337
FT                   /locus_tag="Plim_0376"
FT   CDS_pept        466906..467337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0376"
FT                   /product="signal peptide-containing protein"
FT                   /note="KEGG: col-186; COLlagen"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66227"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66227.1"
FT                   /translation="MSTYTNWKSYLPVMALSAGWLLTGLAGCGGGSDAPQRYPILGRVT
FT                   LDGNPLEHGEVLILPADGKGRPDAGAIKNGEFAFDCTSGSKRVEITSTKEIPPASPGGM
FT                   PDYVALIPQKYNSASTLTAEVKPSRNVSDNTFEFSLKTK"
FT   sig_peptide     466906..467001
FT                   /locus_tag="Plim_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.427 at
FT                   residue 32"
FT   gene            complement(467492..468541)
FT                   /locus_tag="Plim_0377"
FT   CDS_pept        complement(467492..468541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0377"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66228"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ8"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66228.1"
FT                   /translation="MRKKHGFTLIELLVVIAIIAILIALLLPAVQQAREAARRSACKNN
FT                   LKQFGLAIHNYHDVYNMFPRANFETRSTGDNSYWGWSAHSMLLPYFEQANITGDLDFSL
FT                   AVNESGAGTPNWQMITRRIPVFLCPSDQGPSDPRGGGNSYVMSAGPTLYWGHSGALRGG
FT                   VPLSEQVGVFNFRARVRIGDITDGTSNTIAASEQIASGSGSPDSKLAESWGPSDFSTIN
FT                   LSFPTQTQMQALGTACKALSDAASATGSVHRRSGNLKEQIHWALGIGGQTVFNTVYNPN
FT                   STFPNCVACSGCWSTDNIGVYTARSRHTGGVHVLMADGAVRFVSDNVDNTTWQRLGGRN
FT                   DGQIASLDN"
FT   sig_peptide     complement(468440..468541)
FT                   /locus_tag="Plim_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.960 at
FT                   residue 34"
FT   gene            complement(468753..471956)
FT                   /locus_tag="Plim_0378"
FT   CDS_pept        complement(468753..471956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0378"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="PFAM: protein of unknown function DUF1549;
FT                   Planctomycete cytochrome C; KEGG: pat:Patl_0815
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66229"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPJ9"
FT                   /inference="protein motif:PFAM:PF07583"
FT                   /protein_id="ADG66229.1"
FT                   /translation="MPFLHRFFISTLTALLIATVIASSNLGVQEAQGENESPAKPSANL
FT                   QTSNKLQFNRDIRPILSDRCFHCHGPDSATRAAGLRLDQREEAVRAKAIHLDQLDQSEL
FT                   LVRISSDDPDLVMPPPSLKKPLSATQKATLKQWVLAGAEYQPHWSFIPVPQTISTPAET
FT                   QSQFVEKPPIDQFIEARLAEVGWQPSPPATRLAWLRRVTLDLTGLPPSTVEIEQFLSLA
FT                   DSPETRRAVVDRLFSTPAYAERMTNEWLDLARYADTFGYQADREMHVWPWRDWVIRAYS
FT                   KNLSYRDFLTWQVAGDLLPQATQEQKLATAFNRLHRQTNEGGSVEEEFRIEYVSDRVRT
FT                   IGTAALGLTMECCRCHDHKYDPISQKEFYALSAFFANIDEHGLYSHFTETAPTPALPLF
FT                   ADGQQAQHEKLLQEIQQAATALKEVESQLITQREESQLNAKNEPMPIQPVEPVAQFDFE
FT                   GISPGGTNKLVDSRKTASGQDRGQAIEFSGDDEYKLKEVGNFARTSPFSLSMWLKPAEH
FT                   KPRMVIAHCSQAAEDSAFRGYAFTLDEGRPTFSLIHFWPGNAIRVQAPNVLPLGQWSHV
FT                   AITYDGSSKASGVQIYLDCQPLSLVVERDKLTRDIRHRSEWGDSAAGSLTLSLGARFRD
FT                   IGFSQGQLDDLKIFDVELSQAEIAQLAEAKAEELSLAKNSSRPLHWLRVQPEWKEAFSK
FT                   LASARVAEDDFITRIKQIMVMEELPGMRPTHLLKRGEYLQPAEVVQPDVPQAIGSLKPE
FT                   WPRNRLGLAYWLVDDANPLTARVAVNRLWQLAFGRGLVATPEDYGSQGALPSHPELLDW
FT                   LARDFMDHGWDLQHTLRQIVLSDAYARSATPVDVAYYSADPENRLLARGPRFRLSSEML
FT                   RDQALAVSGLLITKVGGPSVYPYQPAGLWEEAGTGKSYPKVGGEHLYRRSMYTFWRRIL
FT                   PPPSMSTFDAPSRESCIAKRERTSTPLQALVLMNDPQFIEAARVYAENLSLAHAAPADR
FT                   VKVAYTALLTREPSSRELELLLAFYDQQVATYQSQPETTAELLKIGEKPASGKVSPAQH
FT                   AALTQVILLLFSHDDGVSR"
FT   sig_peptide     complement(471870..471956)
FT                   /locus_tag="Plim_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.378 at
FT                   residue 29"
FT   gene            472404..472673
FT                   /locus_tag="Plim_0379"
FT   CDS_pept        472404..472673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0379"
FT                   /product="ribosomal protein S15"
FT                   /note="TIGRFAM: ribosomal protein S15; PFAM: ribosomal
FT                   protein S15; KEGG: gox:GOX1585 SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66230"
FT                   /db_xref="GOA:D5SPK0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK0"
FT                   /inference="protein motif:TFAM:TIGR00952"
FT                   /protein_id="ADG66230.1"
FT                   /translation="MSITKERKTQVIKDFQRSESDTGSPEVQIAVLSSRIAELTEHLRS
FT                   HKKDHASRRGLLMLVSKRRRQLDYVKAKSPAKYFELLERLSLRK"
FT   gene            473382..475493
FT                   /locus_tag="Plim_0380"
FT   CDS_pept        473382..475493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0380"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: smt:Smal_2811 polyribonucleotide
FT                   nucleotidyltransferase; PFAM: 3' exoribonuclease; RNA
FT                   binding S1 domain protein; Polynucleotide phosphorylase,
FT                   phosphorolytic RNA- binding, bacterial/organelle-type;
FT                   Exoribonuclease, phosphorolytic domain 2; KH type 1 domain
FT                   protein; SMART: RNA binding S1 domain protein; KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66231"
FT                   /db_xref="GOA:D5SPK1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK1"
FT                   /inference="protein motif:PRIAM:2.7.7.8"
FT                   /protein_id="ADG66231.1"
FT                   /translation="MKVTVERQFAGRTLSITTGELAKQAAGAVTIQYGETMVFVAAQNG
FT                   PSRPGTDFFPLTCDYRERLAAAGKFPGGFIKREGRPTLREVLTSRLTDRPIRPLFPEGY
FT                   IEEVQVMSNVLASDGVNDPDVLSIIGASAALCLAPVPFQGPLAAVRVGLIDGEFILFPT
FT                   QEQIADSELDLVVAGTEKSVLMIEGFGKQLPEDQMADAIMFGHRTIVELCQLQLELVAK
FT                   SGRERFVLPAPEANPFEAILLEKAYAKLREVKQSSVKKERSSQTSAYKKELLAEFFPND
FT                   AETTAAGLTKAQFFAAFYAVETKAVRDLILDGVRLDGRKHDDLRAVSCAASVLPRVHGS
FT                   SLFTRGETQSLATVTLGTIRDVQRVEGLFGEEAKAFMLDYYFPPYSVGECKPLRGPGRR
FT                   ELGHGALAERSVASVLPSPEKFPYTIRVISDILESNGSSSMASVCSATLALMDAGVPIS
FT                   QPVAGISIGLVKSADRFILLTDIMGDEDHFGDMDFKVAGTQKGVTGIQLDLKIDGISEE
FT                   IVRATLEQAKKARIELLKTMLSAIRRPRSEISTHAPRLLRTKIDPSKIGLLIGPGGKNI
FT                   RAIQEQTGATIDIEDDGTVVIASSSSVGAEDALARVEAIAEEIKVGRVYNGTVSSIKDF
FT                   GAFIEIAPGKDGLCHISELSDGFVKNVNEVVQVGEKIQVKVIAIDEQNRVKLSRKAVLA
FT                   DEAEKPAAE"
FT   gene            complement(475774..477450)
FT                   /locus_tag="Plim_0381"
FT   CDS_pept        complement(475774..477450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0381"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; sigma-70
FT                   region 2 domain protein; KEGG: mfa:Mfla_2322 sigma 70
FT                   (RpoD)"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66232"
FT                   /db_xref="GOA:D5SPK2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG66232.1"
FT                   /translation="MKGPIMSNYRHPALRLLAEQQMRYSPRDVRLQQLERAERLAHRVD
FT                   PQIEYPWQKVCQEVTSYRPESYPDLLITGSDLLHDLRVFIEDLSESIELRPEQMTEDVL
FT                   TVEDVSRQYNVSTKTVDRWRDRGLISRKFLFGGRKRVAFLRSSVDQFVEANHEDIGRVG
FT                   NFRHVTDDERRMILGRARRLARFGAGPTEINRRLARKFHRSPETIRLMLKDFDREQPEI
FT                   ALFPDDSDVLSLTEREAVYEAYHQGVAVEDLATKFKRTKSSLYRTIAEVRARHLLSRSI
FT                   DYMDAPEFHREAAKAIESEEPPAVIDQGVTKPPPGLPPYLASLYATPLLTREQEHHYFR
FT                   KMNYLKFAAENLRKTISLAQPRVKLMDEIESLLARSTEIKNFLIRSNLRLVVSIAKKHS
FT                   HPTANFFEMISDGNMSLIKAIEKFDYTRGFKFSTYASWAIMKNFARSIPAENTRLDRFR
FT                   TGSEEVFVQSMDPRTDQFRDEIVNYRQREALMGILGQLELRERDIIMHRYGLETGQQPQ
FT                   TLEQVGHRLGVTKERIRQIEARALKKLKRIATDERLDIPGI"
FT   gene            complement(478131..478580)
FT                   /locus_tag="Plim_0382"
FT   CDS_pept        complement(478131..478580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0382"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   abu:Abu_0982 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66233"
FT                   /db_xref="GOA:D5SPK3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG66233.1"
FT                   /translation="MSELTVRQALPADVPALAEFLTPFVAVGRLLPRTHDELEILTKHG
FT                   FIAEIGGRIAGFAALEIYSPKLGELRSLAVSPIYQGRGVGRAVVQAVIDRAREQNVFEV
FT                   LAITSTEDFFRKCGFDFTLPGERKALFYQTRPSYLEKPGEVLAED"
FT   gene            complement(478701..479570)
FT                   /locus_tag="Plim_0383"
FT   CDS_pept        complement(478701..479570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0383"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="KEGG: ppd:Ppro_0453 apurinic endonuclease Apn1;
FT                   TIGRFAM: apurinic endonuclease Apn1; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66234"
FT                   /db_xref="GOA:D5SPK4"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK4"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ADG66234.1"
FT                   /translation="MSILGAHMSIAGGCYKALEAGHRLGMGCVQLFTKNNNQWRGKPLT
FT                   EDDIRQFQTTWKSTGIQATCAHASYLINLASPDDVLWNKSCDALVDELERAEALGIPGV
FT                   VLHPGSAVKSTPEAGITRVIEALDDVHAKCKGFRAQVWLETTAGQGSCLGARFEELSQM
FT                   LDGVREPDRIGICIDTCHIFAAGYPLHTADDYADTLEKFSQKIGFDRVRAFHLNDSMKG
FT                   LGSRVDRHAHIGEGQLGRIPFSRLLHDDRLSHIPKYLETEKGERDGVDLDLINLQTLQQ
FT                   LIANPEHD"
FT   gene            479665..480519
FT                   /locus_tag="Plim_0384"
FT   CDS_pept        479665..480519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66235"
FT                   /db_xref="GOA:D5SPK5"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66235.1"
FT                   /translation="MPVESESTVTQWYQVLIIGLAMGCMLLGIAVAIVSTKRTRTEKNR
FT                   GGSTSTPSCSKNEISPIDQDVSHHSPNAGAGSNVFADATLAANSDQHRVPDQQIDAEIL
FT                   ASAEHDILLHWNSLTRTAEEYLHRGGHRGICWQIMGWQPEIVLATAPSTIGVWAVAGIE
FT                   LLPDLSNNEELLDAPGADQIKQASLLFHYAAINLSEPMEPQFHRPDHPLPHQNTDSKTG
FT                   TVDLPSVADIASDQASDLRLNSLRDEPLRWRFACRLLMNLSPERAVERLSYRLQAKIQR
FT                   PDR"
FT   gene            complement(480530..480904)
FT                   /pseudo
FT                   /locus_tag="Plim_0385"
FT   gene            480906..482213
FT                   /locus_tag="Plim_0386"
FT   CDS_pept        480906..482213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0386"
FT                   /product="protein of unknown function DUF1597"
FT                   /note="PFAM: protein of unknown function DUF1597; KEGG:
FT                   mca:MCA2112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66236"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK6"
FT                   /inference="protein motif:PFAM:PF07642"
FT                   /protein_id="ADG66236.1"
FT                   /translation="MQFSLPKSWRTSLARAGVLLGAFGAMAMPVFAEDATTIAEQAKKR
FT                   LNGEVVAAPASPIYQVSAMQEQVPPPVPGANVGQPDQIFVDPGYAAPAEAEEAGPWTLQ
FT                   SVMGSGLADKGIVFGGWADIGYSSNPDLSFTSAAEDDNVNLSQFYMFLKKEADGSKGID
FT                   WGFRFDALYGTDGDDAQSFGNPNRTYDNSAAFDHGIYEWALPQLYGEIAVGDVSVKLGH
FT                   FYTIIGYEVVTSPDNFFYSRQIMFWNSEPFTHTGALATWKASDKLTVWGGWTAGWDTGF
FT                   AQFDGGSNFLGGMSYAATDKLSLVYTTALGDFGLRGTGAINSFILSYMITDKLQYVGQY
FT                   DVLGTNNDVDFQTDGVVRDSNGLVNYLFYTINDQWKTGARWEWYKPDGVSYYEMTYGVN
FT                   YKPTQNFVLRPEVRYQWAPGISYEEFIFGVDAIFKF"
FT   sig_peptide     480906..481004
FT                   /locus_tag="Plim_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 33"
FT   gene            482576..483163
FT                   /locus_tag="Plim_0387"
FT   CDS_pept        482576..483163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66237"
FT                   /db_xref="GOA:D5SPK7"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66237.1"
FT                   /translation="MDFLSKVLLGLGFFFPVVSFVTLILAAIESRRTGRNCSAILIPLI
FT                   GPIALTGWVLVTGRSSWFIPLVWITDLGTVLFLCVLPWIIIEAWRISRWTLLKRFDATH
FT                   RQASATLTLHRHGYYFLRRTWVRTAGSFGPVSAGETGRYLESYDRIVMTSDDGTEGRQL
FT                   LRHEDGHWIMHDPIEAQFQEDYSLDGWKFQQH"
FT   sig_peptide     482576..482656
FT                   /locus_tag="Plim_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.681 at
FT                   residue 27"
FT   gene            complement(483199..484179)
FT                   /locus_tag="Plim_0388"
FT   CDS_pept        complement(483199..484179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66238"
FT                   /db_xref="GOA:D5SPK8"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66238.1"
FT                   /translation="MDNNTQRPLSEEANTFEAAVPHPSIEVTALEQRWAPLMFFASVAS
FT                   LVCFSGVLHLHDRPEFLPIFVGCLAGSLAVYPLYWAELLTRWAAGDPRWTRFFLYCLLP
FT                   PLRLTARNQSRNAVWFPKLGWTPVGPTSFVAMQGRLSGPLFVVALAVLPLIGIEFAYHE
FT                   RIAADARLDAAIRCGTAFVWLAFTLEFFTMISLTERQTKYIRTNWLDLAIILMPLAMFA
FT                   QAAQISGLLRLQQLSKLGRAYRLRGVAMRMFRVLLLMKAIQKLMAPATEGRLSQLKEEA
FT                   IETAQKLESLHQQIAELERVLHEKKMARFNKDHSTVTNRSLRDAA"
FT   gene            complement(484343..485515)
FT                   /locus_tag="Plim_0389"
FT   CDS_pept        complement(484343..485515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66239"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66239.1"
FT                   /translation="MRRRFDHHQRFAFPSGLILVGSLVLLVLHDQSCYGQATAKPKTTG
FT                   GPSAQRNEKVPTTLIGMELLTSDPAAAVHAHAWRTTLEELDVTLSTRKPILDDKPRIEQ
FT                   QMLGTLRKITIMAILTRDGSIKTDRRTFAQKDVAALKEWIDELRVYGAQGAPQGQPLWG
FT                   LSELQFNPLYDTLSQPLGVELKGKTLGEILPLIPGKERYQWRVAEAAALAISKRPEDRR
FT                   VVRQSVGRFTIGTALAMALRDLELGFHPRRTPAGDIELLIEPLPEKLQTPQMETADFWP
FT                   VGWAVKASPQKLAPGLFDIQAMMLDGILLGEVLIKAQMESKVPIHFDFAAIDRGNIDIV
FT                   TPLVKYPARKTSWSVAIRGAVSQVGLSRELLQDEGGHAFVWIYRNPASIN"
FT   gene            485745..486434
FT                   /locus_tag="Plim_0390"
FT   CDS_pept        485745..486434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66240"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66240.1"
FT                   /translation="MNYFAHALPHLADPWFVAGTAVPDWLGAVARRTRPRPEKLLPEII
FT                   TNTFPHAPARQQVQSILSGIEQHHHDDDWFHRTAAFQEVQAQLTLDFRQAFGAQDGFRG
FT                   GFLAHLALELLLDASLMERYPGKIDQYYESLRLVDAEVVELAVNLASRHPTTVFDWFIP
FT                   AFLEERFLPDYLDDTLLSWRLRQVWKRIGLDHMPDQLEQAIPAARKLVRHRTDELLPKH
FT                   LYAWPIR"
FT   gene            486503..487342
FT                   /locus_tag="Plim_0391"
FT   CDS_pept        486503..487342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0391"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: rde:RD1_3873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66241"
FT                   /db_xref="GOA:D5SPL1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL1"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADG66241.1"
FT                   /translation="MKYGMNMLLWTSDVNEEHFPLLEQLKTIGYDGVELPIFDMDVARF
FT                   EKVGKELSRLELGRTAVTICTDTENPISPDAAIRAAALARLKKAIDCCAAAGVSHLCGP
FT                   IHSAIGSFSGQGATPDEWNWAKETLSKAADYAQQNKVTLVCEYLNRFECYFLTCAADDA
FT                   RFCREVNHPNLKMMYDTFHANIEEKDLAAAMKGCWDQVVHVHISENDRSTPGEGHVDFD
FT                   TTFNMLKELKYDGWLMVEAFGLALPAIAAATKIWRRMFPDETYLATNALKFMKQGMA"
FT   gene            complement(487705..488721)
FT                   /locus_tag="Plim_0392"
FT   CDS_pept        complement(487705..488721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0392"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66242"
FT                   /db_xref="GOA:D5SPL2"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL2"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66242.1"
FT                   /translation="MLISILMHLILLGLAVVIVVAPFRSQKNEPARYRDLWWWLAVSVI
FT                   PLFILPFLSFYPLENHFFAYALAFFCLVMGILGAMSTIWRTESQRPRARPVGAVIATSI
FT                   LSLLFAALFLPAMTPAREAAVRQECRNHLKLIGLAIHRHYNALRVFPMASSGQGELAVS
FT                   WRVTLEPYLDAHQIDPKYSDQFAWNAEPNWAFSKRRRPVYECPAAGYRRADPKDGFGLT
FT                   DYVVLVGDETAFPQGKMLLIQNIEDGLSNTAFVVEAIDTGIRWAEPKDLDVNQVELVVK
FT                   SSNTNQQATHPIMSSAHSHGSHILLGDGSVRFISSQISPEILRMLTTASAGDVIRDE"
FT   sig_peptide     complement(488638..488721)
FT                   /locus_tag="Plim_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.757 at
FT                   residue 28"
FT   gene            488915..489979
FT                   /locus_tag="Plim_0393"
FT   CDS_pept        488915..489979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0393"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   afw:Anae109_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66243"
FT                   /db_xref="GOA:D5SPL3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL3"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADG66243.1"
FT                   /translation="MADEQTWLSTLSRLKEPHLGRTLGELKLVRGVSLGSDKIIVSLDV
FT                   PFPGFVKANALKEHVRSATQELAQGTPVEFDLELNIKGKNSGGSIGLSVKNVIAVGSGK
FT                   GGVGKSTVAATLAYGLQELGANVGLMDADVYGPSVPHLVGVNEQPVALERTSPDGKKMM
FT                   RIQPVLASGLPTISMGFFVQADQAVIWRGPMLHQAISQFLQQVDWGPLDYLIIDMPPGT
FT                   GDVSLTLSQLLGLAGAVVVCSPQQVALLDAVKAVSMFRQVKIPVLGMVENMSGEIFGRG
FT                   GAQAKAAELGIPFLGELPMDAGIRVAGDAGEIARLVREENPSRDALLTICENVAEQVAK
FT                   SLLSAPSMPTLEIL"
FT   gene            489986..492220
FT                   /locus_tag="Plim_0394"
FT   CDS_pept        489986..492220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_7207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66244"
FT                   /db_xref="GOA:D5SPL4"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66244.1"
FT                   /translation="MDVSERIFFDSILHLQIYESMPPRSAAKAVAERSTSESGKGAPSF
FT                   LIPEWLWALGAAILASWLAWASFYEGSTLIGGDLYTYLLPQKAFFQQELAVGRWPLWNN
FT                   LTGHGYPVIAESQTAVFYPARLLSLSLFAADHAYTAEQLAHYVAAFFCMWLYLRQIGLS
FT                   IPGTIFGCVVYVYGWFPTRIILEWAIIGGLYLPLGLWLIERFLQRKSWKYAIALAGVLG
FT                   LHLLAGHYNLAFIEVLVWLAYIPVRLWLLPTMEDSPQTSEISARARLPLALALVTAIGF
FT                   GFGLGAVQLLPTWELKGQSQRAEKGQDFQPGYGHIPPQFLGQLFAPTWWNPANHNIDEE
FT                   LSQMWSPTGAGTNRVEAHLYVGLAVWMGLVGVGWLAYRSAGNLIVFRWIGVFLLGSFVA
FT                   MIFATGLPLFVTASLPGFSYFTGPGRFGIVATFCLAVAGGLAWDQLLNHISARYRWILW
FT                   CLVIGFTWFDLQIVSMQATYGVIIEKSPYSMIAKSEVRRILLADPRQPVRVYAPGANLP
FT                   NLLGVSTTPVFLGIGPAAYFSPEARFPTEAPLSQQIEFLSKQGVTHWLTMDPLSLPAAG
FT                   SKDPSTGGSTNEESLRLVWSGFDEFLNRAWGRFDEPLYLYSLPAAPGRCYLEGIGSQPA
FT                   RKVTMVEHGPQRIEVQVEAGSRQTLVLTELADRDWKLTINGQPTSWEAAGLSRKVEVPE
FT                   GETILVWSYQPWSLWWGLGISLFVVLILATIGHIRFWHPQWTHWWLPQAP"
FT   gene            complement(492345..493217)
FT                   /locus_tag="Plim_0395"
FT   CDS_pept        complement(492345..493217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0395"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   afw:Anae109_1782 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66245"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG66245.1"
FT                   /translation="MTNSPRVDVLIFGCGYVGLQVACQFVSAGLSCAAVTRSQEKAAFL
FT                   KSQSIEPVLAEITTAQSLEVLPAAKRILWAVGYDRNSTASKREVYVDGLRNALIATAPA
FT                   AESVVSISSTSVWGFDDGRWVDETTPVSPTTEGGEICATAEEVVRTHCPAGKSTILRLA
FT                   GIYGPGRLLAKVEALKHQQPIAGSGEAWLNLIHQADAAALAYRLLCEGGPEVVVGVDRE
FT                   PVRRIDYYSELARRIGSAPPVFDEASLPKRGSGGLNKRVRSQFPDQFEFRYESYRSGLA
FT                   QAVESPPTV"
FT   gene            complement(493281..494696)
FT                   /locus_tag="Plim_0396"
FT   CDS_pept        complement(493281..494696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66246"
FT                   /db_xref="GOA:D5SPL6"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66246.1"
FT                   /translation="MSEHMTRTCFYLRMNFPFTSWPQLHTIPRPASLKGCLLFGNASEG
FT                   HAQKHLTHLFSELQGMQLWKIRQFGNEMHNQQTRPTPTNTQKQTRASMHRYAALFVAGL
FT                   VVMGGIWTVTPQLRKIAFAAQVDSQENVTSKKDAIEQAAFTKAAEPQILPGSVPGAGQT
FT                   PALLSGATGSVQPLQPAKSADQSASSSKGALETTTPSELAPNALAPSEASVRVLALVQE
FT                   AQVSLARRKSIQANVKTLVQFGEQTIISTGRYEAEGLKLRLTTQLKLKSGITGETLEVC
FT                   DGETLWNRTVIDDIKRYTRRDVRQILNAGAAGGTAETLMLSELGLGGLPGIMASIQRCM
FT                   NFTALKPEETEQGKVFHVQGEWKPEFPAKWFPSKPLSTLPFFPEVVRITYSAETLFPLR
FT                   LLYLKRTAGPEKSLRPIFSMEFSQVVLDEPLDDQTFEFIPTDGVIPEDVTKQYLERIFA
FT                   AKPKPALASDDSR"
FT   gene            494763..496019
FT                   /locus_tag="Plim_0397"
FT   CDS_pept        494763..496019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66247"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66247.1"
FT                   /translation="MKFYFLALGTVVVVCVGCAMDGQQVMNKGEYHAPPAAMMMRPGPM
FT                   VDGPGPGVMPALPTGMGGPMMGGPMMGGPAGGMIPPGIPTTTQVRFVGPDGMHVGWQIP
FT                   DGYAENQLVAPARFNFQQAATYRLKLTNIPGRAGLNLYPTLQVYPSHPNTVGYLSHNSV
FT                   PLQITVEDLDQVESNNFVTKVIYLPDAKYQELAIANVETLVSTRLDPGVDPVQEADKRG
FT                   TIMAILRLGNMDLEMPGAPGAPGATVGGPNGGLNQVAYNVVDGDKGQHVPPMPMSIMPG
FT                   YGPGVPDAMMVAGYGLPGQPAGSPYVSGVGMPMWGQPITGTPIGLAGPPHLPYGGPAGL
FT                   KSHTIRNRTKMDIPEPVDHMLIDVEHAPGLSLPKPVRYVEYKETHPVYSPGELSNPAWN
FT                   APGAGAGGDGAYCPPGMQR"
FT   sig_peptide     494763..494822
FT                   /locus_tag="Plim_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.621 at
FT                   residue 20"
FT   gene            496056..496292
FT                   /locus_tag="Plim_0398"
FT   CDS_pept        496056..496292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66248"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66248.1"
FT                   /translation="MSVLRGSGVPDDGNSALVFSRHAVQFDGFLFSKRVSCHAMPSPPG
FT                   KLESCGSWMENYPLDAPVELSTHGGFRTAVSLD"
FT   gene            496258..497019
FT                   /locus_tag="Plim_0399"
FT   CDS_pept        496258..497019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66249"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66249.1"
FT                   /translation="MVASAQQYPSTDRRHFPLNHMTSPGTAAAWAVANGKAHPAYFQPV
FT                   RITVPTKGRVDFFDGSPARPVSMAAPGQAALLVGQTYRVRLTALPEFPNQEFYPTIELI
FT                   DRLHPPEGLADRFPVEVQFSEDDFEFAAQGRLVTKVVYLEQPDRIPLSVLDADLRVTEV
FT                   PPQQNALAEADLLGRPVAIVRLGGRTPDSHNPLDPTFFGFCPPVQPSPATATPENGQPA
FT                   NPTPIQNETPQARTRPSGVRASASIQQTGGR"
FT   gene            497094..498494
FT                   /locus_tag="Plim_0400"
FT   CDS_pept        497094..498494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0400"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; KEGG:
FT                   vpa:VPA1442 putative hemagglutinin/hemolysin- related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66250"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM0"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ADG66250.1"
FT                   /translation="MTRKLLTSATRPLSCGLPAMLIDHLKSHRLLPRRLILGGLMLAAA
FT                   GSTGCTTQRAVTAMRQISEPPAYLIIVNDEITVRGQSPDDSGNMAGRVKLGSKSANGRQ
FT                   VQTVSHTPAIEALPVGMKIEVCPPDRRVVAGCPDPKICPPPFAPGFTMAECYLMECKKR
FT                   YPDEYICDGGDRGLPVHYDSVGIQGLETEDTVAEFVDHTGKERVKPSSRVCVYAPRFAA
FT                   VRSVSVPAVGEAVSELANVAGSTGDRSMRAQTKIDQSAQQTPTGGLRMRSRSSGLESTS
FT                   GQGDFASITRLAAHEKLVNLFQDIGFLRTGLMEVDDVAAIQQGMQASMAWSREQSPIIA
FT                   AKLDVPIEGRSDVHAAVITLIDDAKNNEPGELRVVKLADKQDAVSGDVIEFVIRFDNLG
FT                   PNAVSGVRLIDNLTPRLSYIPDSATCTLPGQLVVTPNGVGSEILIWELENSLEARKGGV
FT                   ITFKARVR"
FT   sig_peptide     497094..497261
FT                   /locus_tag="Plim_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.466 at
FT                   residue 56"
FT   gene            complement(498927..503726)
FT                   /locus_tag="Plim_0401"
FT   CDS_pept        complement(498927..503726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66251"
FT                   /db_xref="GOA:D5SPM1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66251.1"
FT                   /translation="MKNMIHAKSAQQVVQLGKDRKPATIAHPRRGSTLLIVLVLLGLLS
FT                   ILGVIFFTFARQEQSNAEYFSEAAKAPQELGLTGEVLFDFALEQIVVGTRPEYRSSALW
FT                   SSTHSMVTNAMGNVQRVDSAGTGRVVYQYPDRHPFDGGSMRMSWNAGTLAIDNYLIADV
FT                   AAPVRVSNFNLLAGTGDRINVSTGATVSTITAGQTEYNPLSLNVSPAANNWRSADPLLL
FT                   PRRGGDYTAPDINTAFLAYRGYIPHPTNPALSVPVIVPSYHRPQYMRRPGTNDPLLATD
FT                   PAGQRWYDYNGWGSRSLRPHPDHRVQVQGSSAVSRFLTNAEAASPSLNPPMTQGFPMQP
FT                   MDESYTTSVPVFKTGRQGIWERIATSSGTFLTDAATYEYDIDNDLDGIPEGIWLDLDYP
FT                   VQEDANGNPFVPLFSATIYDLDSLINLNAHGNLALNQALGVPALGTNPNGATGAVPAGV
FT                   LGAAASLEFFSRSNQGLGPAEVNPSWVFNSRPGTADVAGGVDWSPYSQMFGAQPASYPG
FT                   PTTNPPITSIVNTWKEASNMELAMILLGRVKFSAPSVIETLYPGRHGEQSLLQSVATGT
FT                   GTVLPRAGLTNSDDNNDSANGGTGYPTSWPYPVAANVLNSTFAWPLDFMGVGSYVLSTN
FT                   VKNLDFFNNQFRFSRMVGQDTNSFVKWNTTNAPRLAGVFTLGDDPYETAYYRDTPDLND
FT                   SLFDAFDSAVLQMRQAKATEYNVATRLTDLAPFNLNTGNSTRADDIRTKLTTVSSDRKQ
FT                   FSWPRSISRAWEYTASGGRFVFPPQFGAVAPYSAADPLRGPVRKWLEIIENDNNTARIH
FT                   RRIPLNSVIDGTAASPTVRPLVQHEVNAGANIATSTQERQARLDRQRLARDVYVLLYLF
FT                   GGAADNLNAATQPASALYSPDQLREMAQFAVNYVDAMDRDEVITRFVYDIDLSDGWNVD
FT                   DANLPTSATVSGSSTYAQVYGIERQRLAINEVLAIKANQVEDASMVPVDHQATQWDDTT
FT                   DQYLMYVELANTGPDNIDFTNGDYQIVVQPRIAMTLPDLSKARALTMQLGTIAPNGRYT
FT                   IGGTSFDVGASAQPTDMQSVMKVDFEWTSGTPDFTINRTWIAPRNGVLDLDVVRRESTN
FT                   GTTHRLMAGDANEYGAVTAGIRLLEDSMITNANDPLDVILYRRQYLGRTRPADATAATD
FT                   NEWVEVDRLRVTGLREFDLQPSTAYPNIDTELNKLRSFERNQPLDATAASLTQHPDGTP
FT                   PTPPDGTETAPLDPYVNSIGAANPGALVTWTALQRHFDRDLANMGELFLIPLFGPKHLT
FT                   LRLVDTRKSYAAGQQNLEEQYDSNNDGAIDFIEYSRTAGAKFLAPLYQSPVSTTPPAGN
FT                   NHNRWHRVLELLEVPSRVNKNLSNETAMNSINRVPGKLNPNTIRHPEVLAAWLDDERVV
FT                   NVDLTTNVSAPPLSTIDGLNWWNEFLFNRDYSEADPWYGDSGQQYGLPGLPGSRPFRSF
FT                   SATPTVGAGNPALPSWIRSVDPLDQNTRLLFEVGSDTDHSNGALDPMTRERLIAKMSQN
FT                   GTTRSNTFVVFLTCKFFRATYDTANGNAVRIGAPLNDLYEPEFRGAFVVDRSKLEAAYD
FT                   AGQGTFDFRKFIEAGQVLEK"
FT   gene            complement(503951..505651)
FT                   /locus_tag="Plim_0402"
FT   CDS_pept        complement(503951..505651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66252"
FT                   /db_xref="GOA:D5SPM2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66252.1"
FT                   /translation="MNSLTQQPRLQGHRKGHSAGFTLVEMLVSVALVLLMMTLFAQVFQ
FT                   IAAGTVSTQRGIMENDQRARSIQTIITKDLNNRTYRYVWPWAARPTGYTDTVNTEESDM
FT                   LGYFYISENNPFDDTDDVLEFTGKITATINSLADTDSYSGRALQVGNSLNQPDYDDGDL
FT                   GNLSSLSSTAEISLFMRRGTTGRPGALYRRVMLVRQPADSTAEIEPHEDGNTTNTLFDS
FT                   TSGATTRYTPSATSTFWKDFDFSARPISSRTFNQTMPPPFINGVRFNTLADLQLPTSRF
FT                   GFEFADGTADAGKPREFLSGVFFGRYTMEETSNVAFQYPFTATPSPMNQATAGLTVDAA
FT                   TGVVDPLQHNSANGSRRGEDLLLANVVSFDVKVWDDFANGGLGAFVDIGGPGSVLYSTN
FT                   PAVTGNPDRRLNIDFGPDGPSGNNVFDTWAKDVRLATITSDPAENPPLLPRRYIAAATA
FT                   SAFELPRFTPGTTAGAVLPALSGGVSSIPGDPVFFVRSGASAGTNNAAGAAIPLTLPIV
FT                   YGTPINDGLVEWTPVDNRRPIRLIQITVRFLDPTSQQLRTVTMQCDLTP"
FT   sig_peptide     complement(505526..505651)
FT                   /locus_tag="Plim_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.725 at
FT                   residue 42"
FT   gene            complement(505652..507058)
FT                   /locus_tag="Plim_0403"
FT   CDS_pept        complement(505652..507058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66253"
FT                   /db_xref="GOA:D5SPM3"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66253.1"
FT                   /translation="MKTLLPLPRSTRTNYRPNKTHGSNARAGVTLSEVLISLMIMGIGI
FT                   VGLASLFPISVLKSVAATNMTNSAILSYNVRGMRNALSQVNTGAALWQPGLTATSITDN
FT                   PARPTFILPSNPITRSQFPRLVFGCSTSGVLGNTEPVWASTGPITAADGTIWQPVSITN
FT                   GYVVDPLGSFRMADVLAPNAGRFFGNDGTNALTVVPRFTGGATTLLQASQIATLPDSWL
FT                   LQVESVDFAAPVDNGDGTFTITFADQTGLSQIVNPAVTSSRMVMFDADMRRVEVRPISG
FT                   TPAPTSTSLSFVGALGFSPVKIRIETQELRYTWLTTTRVKADGTRNSDAVVFFRRQFGI
FT                   NDERIQGAFFASYVDTSGAASSVIVVKYDENDPPKWKKGGYILDAGRMRWYRISQLEES
FT                   FTSLAAAKPAEFPAASFYPTGLSTGSGTSYARIRIEGRVFENANDGSAVIMPNVVDVFP
FT                   LNPVSIRDVQ"
FT   gene            complement(507055..508137)
FT                   /locus_tag="Plim_0404"
FT   CDS_pept        complement(507055..508137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_2522 methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66254"
FT                   /db_xref="GOA:D5SPM4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66254.1"
FT                   /translation="MFAKYVILPIGRQPVQRISERRGFTLIELLVVISILVTLLVITAT
FT                   MVRLSLDGDKVRAGARQIQSFLNGARDRAIYAKAPVGVRFIKSPNNDRTITSMVYIQPG
FT                   ELWSDGTIELRRDESNLTSTDVRVVAEAAGTNWSNLISRQRFPNDIRIRIPKGSQGTWY
FT                   RATLDTSAGQIRLRLTTPFRLPAETPSGTLEAFAAGRDGVTTYDLQLDPVPFVGQKPVF
FT                   LPAGVVVHLDRCSRNIDNLATASARGNILPTAWRDGSVNPPRYSNQIDIMFSPSGTVIG
FT                   QAATAGLLHLYVGTQKDADLDRLAWESGSAAELEDSENRGDKYFVSVATRTGAVSVHEL
FT                   GYGAGSDRLLYAETGEGAGK"
FT   gene            complement(508162..509274)
FT                   /locus_tag="Plim_0405"
FT   CDS_pept        complement(508162..509274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66255"
FT                   /db_xref="GOA:D5SPM5"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66255.1"
FT                   /translation="MIHPFHQFDFRSSPTGAIARCANRISSNSSFPPRTRGSQHRRAGF
FT                   TVIELLVVIGLILLMISIFAAVFGNTILTARERATQATILKIDGLLQQRLESFNRAVDK
FT                   ALEQGTNNQRYFRQVRADLGISNANTNNYIPAMKVLARKMLLKQTFPQSFSELPSSHPL
FT                   LTSTAYISANHKVETESSALLYYALTQAQVFGLPPVSPDNFSSNEVRDTDGDGHLEFID
FT                   AWGEPLRFYRWPTALVRNTTSGTTATLATASNSNPPLTYPSGTIDRQYGLVLIPELPAS
FT                   TGTNLDPLGVDPDDGYGRIQSMLLGLGQSDAAFRNNYHQLDTFFTPLIVSAGPGKVLGL
FT                   QEPHTTTGRLGLPASRDDLLDDISNFNNRR"
FT   gene            complement(509364..510422)
FT                   /locus_tag="Plim_0406"
FT   CDS_pept        complement(509364..510422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3367 general secretion pathway
FT                   protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66256"
FT                   /db_xref="GOA:D5SPM6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66256.1"
FT                   /translation="MFLKTNPYSLRFAGRGCDSSTQSDGGSSGPRAGFTLIELLAVIVV
FT                   ISILIALLLPAINGARRRATIAQVRTEISAIESACVAFEKEYGIHPPSRIVIPQTATLW
FT                   ATPADGGVAPNLYTAQEIRESKAIIRQFWPQFDFAYTAGAPDIDGDGTAGGSAIVLSNA
FT                   ECLAFFLGGLHEKTVEGSTTLWRAIGFSKDPAAPFRRGTGPRTTPYYEHPASRYTDLDG
FT                   DNLPEIVDPISGQGTPYFYAATTNGKYGILTYGPQGNSANYPILPYAQDKANKSAWNAK
FT                   SFQIISPGYDQTFGPGGPFQPEVATPLPGYAATDIPSAVWAPGITGAVSVADREAEFDN
FT                   ITNFYSGTLGGR"
FT   gene            complement(510626..511885)
FT                   /locus_tag="Plim_0407"
FT   CDS_pept        complement(510626..511885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0407"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sfu:Sfum_0118 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66257"
FT                   /db_xref="GOA:D5SPM7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM7"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADG66257.1"
FT                   /translation="MPTFMYEAMDNKGMEVKDTIEAATEQEAQSKIRERGFYVTKISEK
FT                   GRTKKKKDTSPAKDGKKKPNARKKGTFTIGGVGAKQLCTFTRQLSTLQDAGLPILRSLR
FT                   ILEVQAKPGALKNSLMGVIEDIESGSTLSEAMGKQPKAFDNLYVNMVRAGEAGGALEVI
FT                   LQRLAEFKERQQSLKRKVQGAMIYPAAVITVATLIVGFIMYWIIPKFKKIFDDFGTKLP
FT                   MMTEVLIGTSSAVVNYWYLGPVIPISIWLLIKIIKKNKTGAFVVDWISLRIPMLGLILK
FT                   KSIIARTCRTLGTLVASGVPILEALSITRDTAGNAVFVKAFEHVNAAIREGESMAVPLR
FT                   ETKIYDEIVVNMVDVGEETGALDNMLYKVADVYDEEVGVLVEGLINMLEPLMVVVLGLI
FT                   VGFIVIALFMPLIQLLNDLS"
FT   gene            complement(512038..513750)
FT                   /locus_tag="Plim_0408"
FT   CDS_pept        complement(512038..513750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0408"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: mxa:MXAN_5788 type IV-A pilus assembly ATPase
FT                   PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66258"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADG66258.1"
FT                   /translation="MAQRKLGQILVDLGYISEDQLWDVLEEQKRSPGEIIGQVAIRMGL
FT                   VTEAQVTEALAEQWGMPVVNLGETTIPPRAIEMVPQTMAELYKIMPISLKDNVLTVAMA
FT                   DPQNVAALDDLRNFLGAEVRGAISNLKDVEAAIARYYADKQDSIEDLITSMEESYGGTG
FT                   GQNSREYNLDEAELADAAPIRKLLNMILLLAIKDQASDIHFEPFEDEFKVRVKADGMLY
FT                   EMVPPPRHLANAIVSRIKIMSDLDIAERRLPQDGRIELNVGGNSVDLRVSILPTLFGEA
FT                   VVMRVLDRTVVQLDLNKIGMDANTLTRFRSMIKRPNGIVLVTGPTGSGKTTTLYSALNE
FT                   LNDVETKIITTEDPIEYEIEGLLQVPVNHDIGVTFATVLRAILRHDPDTILVGEIRDYE
FT                   TAEVSVQSALTGHLVFSTLHTNDAPSAITRLRDMGVPPFLITACVEAVLAQRLVRRICT
FT                   ECRTKFDPSDELLMELQLPIQQARKYNFYYGKGCQRCNNSGYKGRCGIYELLDVTDDIR
FT                   DLIAASASVDDIRNFARSQGMTTLREAGLKLIFDGVTTIDEIVRETITEDGEG"
FT   gene            complement(513912..515024)
FT                   /locus_tag="Plim_0409"
FT   CDS_pept        complement(513912..515024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0409"
FT                   /product="twitching motility protein"
FT                   /note="KEGG: twitching motility protein; K02669 twitching
FT                   motility protein PilT; TIGRFAM: twitching motility protein;
FT                   PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66259"
FT                   /db_xref="GOA:D5SPM9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPM9"
FT                   /inference="protein motif:TFAM:TIGR01420"
FT                   /protein_id="ADG66259.1"
FT                   /translation="MAFLQIDKLLETVVRERVSDLHITTGQPPVVRVSGHMVRLDTKSL
FT                   EPEDTVALMKSITPERNQQELQEVGGTDFGFAFGDKARFRVAVFKQRGHIGMVLRRIPN
FT                   EFLSFEQLGLPPIIRDLIRRPRGLFLVTGPTGSGKTTSLASMINYLNDNDDAHIITLED
FT                   PIEYYHQHKKATINQREVGVDVPDFPEALRRALRMDPDIILVGEMRDLATISSAITAAE
FT                   TGHVVFGTLHTTGAQGTVDRIIDVFPTNQQEQIRTQLSTSIIGILSQALLPRKPKGVVA
FT                   AYELLVVTPAIANLIREAKTYRINSAIQTGRKFGMQLLDDALFNLWKNQICEEDDVVVR
FT                   SNQPGELKARIARAKKGLLDDEPEDEEDEE"
FT   gene            complement(515847..517544)
FT                   /locus_tag="Plim_0410"
FT   CDS_pept        complement(515847..517544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0410"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: scl:sce4467 type IV pilus biogenesis protein
FT                   PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66260"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN0"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADG66260.1"
FT                   /translation="MADDYLRKLIKDGLISKDQLGEAEDLGRSMGISISDALIKLGYVG
FT                   ASELGQRQAAAFGYQYVSLDGMEISSGVIGLLPESVARENIVIPLAMDDDRLKIAISDP
FT                   MNYEVLDKLRFLLNRDIDLAVASKESIQNAINRHYGQSETESVDSILLEFTETAIDFTA
FT                   TDIPSSAATTAEENAPIVRLANLIVSEAVNMRASDIHIEPFEDKVRVRYRIDGVLVERD
FT                   SPPKRLHSALISRFKIMGNMDIAEKRRPQDGRIKTRINGQDFDLRVSILPTGFGQAIVM
FT                   RILDRNNIKVGIRSLGLSDENYRRFNNTIRRPNGIFLVTGPTGSGKTTTLYSALGEMNR
FT                   PDKKIITAEDPVEYYLPGINQVEVKADIGLNFARIIRAMLRQAPNIILVGEIRDAETAQ
FT                   MAIQASLTGHLVFSTLHTNDAPSSITRLIDMGVEPFLVASSIVAIMAQRLVRTVCPKCK
FT                   EPYAPDPSEIAHFALTPEQVAGANFMRGKGCNHCQQSGYRGRAAVFELMMMNSTLREMT
FT                   FKGEPSQSLRRQARLFGMKTLVEDAVDKALIGKSTLLEAYKLDKGSGH"
FT   gene            complement(518054..518272)
FT                   /locus_tag="Plim_0411"
FT   CDS_pept        complement(518054..518272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66261"
FT                   /db_xref="GOA:D5SPN1"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66261.1"
FT                   /translation="MTWAAWAMLIPAWTIVILTMTWSMNRVLRSSSGSSEMKSADSEST
FT                   QGAPSEASVPNQGSYRALTSDMQGAPE"
FT   gene            518760..519290
FT                   /locus_tag="Plim_0412"
FT   CDS_pept        518760..519290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66262"
FT                   /db_xref="GOA:D5SPN2"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66262.1"
FT                   /translation="MPYNSVLSQPGLLKDFHIRAGHAVNPAKPPLHTPVILPKGQKLSS
FT                   LPEADADVDATQTLNSVDLDRLLTIQKWARLLDARFTIPGTSIRYGWDSIIGLVPWAGD
FT                   LLTGLVGAWLVYLAYRVGLPRWLLLQMSANIVLDFAAGSIPVVGDLFDLAFKAHIRNAI
FT                   LVENYVKTQQAEL"
FT   gene            519606..521519
FT                   /locus_tag="Plim_0413"
FT   CDS_pept        519606..521519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0413"
FT                   /product="glycoside hydrolase family 13 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 13 domain protein;
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: mes:Meso_2421 glycoside
FT                   hydrolase, family 13- like"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66263"
FT                   /db_xref="GOA:D5SPN3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN3"
FT                   /inference="protein motif:PFAM:PF02922"
FT                   /protein_id="ADG66263.1"
FT                   /translation="MVPANVSVENRVSVENQASKPSETAPHHAGMGAILTQQGVAFRVW
FT                   APHAEAVSVVGDFNDWQETRHPLSQEYREQLEDHEQAGTAPESVASGFWYGEVTGLSVG
FT                   AEYLYALKLGEKWMTRIDPYAKEVTNSVGHAVVTDPHFDWQNDAFELPPRNELIIYEMH
FT                   IGTFAKDAGDGQPGTLSSAIRQLDHLRRTGVNCVEIMPLAEFAGDFSWGYNPAHIFAVE
FT                   SSYGGPKAFKEFVREAHQRGIGVILDVVYNHFGPSDLSLWQFDGWNENQLGGIYFYNDW
FT                   RAETPWGSTRPDYGRPEVRQYLCDNALHWLEDFHCDGLRFDMTLYIRSVRGDGDPGGDL
FT                   PDGWSLTQWINREIHARHPQALTIAEDLHNKDDLTAPVERGGAAFSAQWDARFVHPVRE
FT                   VLIEPDDDDRSLDSIKGAIFATFNGDPFERVIYTESHDEVANGKARIPSEVMPLETRNW
FT                   FAQKRATLGLALVMTTPGIPMVFQGQEFLEDGWFRDDVPLDWDKAIELKGILRLFRDLC
FT                   HLRLNNKGVSRGLTGSGLALLYEDHTAKTLVFHRWHTPAPHDDIVVILNFYREPRQVEF
FT                   NFPNAATWQLELNSDARIYSPEFANTPCIDQLNLQDEATNPAHHVSLEVGPYSALIFSR
FT                   QT"
FT   gene            complement(521636..521866)
FT                   /locus_tag="Plim_0414"
FT   CDS_pept        complement(521636..521866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66264"
FT                   /db_xref="GOA:D5SPN4"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66264.1"
FT                   /translation="MITSEGYQATIPVGQERDNSLPESEMLSHALQPSCELQPFHDLGE
FT                   YLKVYAREKPGTAAMVCLGIGFVLGWRLRHW"
FT   gene            complement(521966..522442)
FT                   /locus_tag="Plim_0415"
FT   CDS_pept        complement(521966..522442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66265"
FT                   /db_xref="GOA:D5SPN5"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66265.1"
FT                   /translation="MDSEKIAMNEREPVPASRGNFRNNEQPPTLITIVHECLKLADLQL
FT                   QLFQMDIVEFWKRSQLALGLFSLGSALLLGSLPIALMAIAAWLKTTVGLSQEASLACTA
FT                   AMGVIIAVTTLAWAVMRLQRAIEPLASNQEEFRANLQWMRHLLHQDESNDSTGP"
FT   gene            complement(522418..522714)
FT                   /locus_tag="Plim_0416"
FT   CDS_pept        complement(522418..522714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66266"
FT                   /db_xref="GOA:D5SPN6"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66266.1"
FT                   /translation="MIADRFDRGPVCSHSNSSQHHGVLSEMRVRENPTQALRVTEGFTE
FT                   NKLLVRTIDNGRLQRPVDAWDVANRWIAQNAAMSLLIAATMGATWGWIQKRSR"
FT   gene            complement(522714..523220)
FT                   /locus_tag="Plim_0417"
FT   CDS_pept        complement(522714..523220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66267"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66267.1"
FT                   /translation="MMDDRERIRFKMRRLRRQLDQHSSEWSAQAHRWLDWKYQVSQHPL
FT                   LSVGIAAAAGYLLIPRKTPAVQVEIDEATRREIVKQLQRQQFNEPISQSPAVPTLWQTG
FT                   VTIASQFLLRSAINYGVSQIDRLINSVQTATEHPSSDTFNAPGTHDIHSRNTPIPENNL
FT                   HLYHG"
FT   gene            complement(523298..523723)
FT                   /locus_tag="Plim_0418"
FT   CDS_pept        complement(523298..523723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0418"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66268"
FT                   /db_xref="GOA:D5SPN8"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN8"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="ADG66268.1"
FT                   /translation="MITREEIQGQWTHLKGQIRERWGQISDDELQQAQGNTEQLIGLLE
FT                   SKTGESRRQLEQFVQGAVKNGQNFLGNAGQTVREYAQTAAHAAGKGLGSIESGIESGMQ
FT                   EAHKMVASRPLESITTAFGVGLLAGVVVTLLLRSDRA"
FT   gene            complement(523827..523997)
FT                   /locus_tag="Plim_0419"
FT   CDS_pept        complement(523827..523997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0419"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   pmy:Pmen_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66269"
FT                   /db_xref="GOA:D5SPN9"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPN9"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ADG66269.1"
FT                   /translation="MLSWALTFLIVAIIAGVLGFGGIAGTAAWIAKLLFVVFIILFLLS
FT                   LIMGGVRRPSI"
FT   sig_peptide     complement(523914..523997)
FT                   /locus_tag="Plim_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.297 at
FT                   residue 28"
FT   gene            complement(524322..524468)
FT                   /locus_tag="Plim_0420"
FT   CDS_pept        complement(524322..524468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66270"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66270.1"
FT                   /translation="MHAVWPQLSKATHFPGAFLRDVFSALSHVRLRNGDNPLSQLAAWD
FT                   SSS"
FT   gene            524807..525103
FT                   /locus_tag="Plim_0421"
FT   CDS_pept        524807..525103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66271"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66271.1"
FT                   /translation="MMTFSCAITSCDLHTFDLQFSIRSHILILQTTASHLFKTPVKRSQ
FT                   PRKESLDRQWNDPSVEEIFLACQQIQSEWPPAEKRRRRCAAFLWSDELPIEFH"
FT   gene            525288..526313
FT                   /locus_tag="Plim_0422"
FT   CDS_pept        525288..526313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0422"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: lip:LI0536
FT                   exopolyphosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66272"
FT                   /db_xref="GOA:D5SPP2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP2"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADG66272.1"
FT                   /translation="MNTIDWKPIVPLIESHQRILVSSHVRPDADAIGSALGLACLLKHL
FT                   GKTVRIVNPSAPPANLFWIDPEQMVETFGGSVNGASLAETDLHIIVDTSAWQQLGELGK
FT                   WMRTTTIPRIVIDHHVSSDDLGAMEFKDTRSEATGSLIFRLCEFMNVPLTQVAATALYA
FT                   AIATDTGWFRFPATNAQTMQIAGALMERGADPTDIYRHLYEQSTLARLHLCGRVLGRAQ
FT                   LDADGLLASTVVKWSDFVELGAVPADTEDLVNECLRIAGTRAAYIGVEQMNSQIKFSFR
FT                   SRGGLNVASIAEKFGGGGHKQAAGATLPGPLDVAHARVHAAMLEGLKALPDPASSSIPA
FT                   S"
FT   gene            526434..527153
FT                   /locus_tag="Plim_0423"
FT   CDS_pept        526434..527153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0423"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   scl:sce0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66273"
FT                   /db_xref="GOA:D5SPP3"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP3"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADG66273.1"
FT                   /translation="MSAFDIHSLPPEFPPSGVSFMTTKPSVASESEGSHLSPPAPAEAI
FT                   VSQTSTDLAPSRRDAVAAMLACGSFLAAVAIPVSAAVGLTLDPLLRKSGSTADSSPGGN
FT                   PAAELASGFLPIIRFDELPEDGTPVKSVVRIDVRDAWQVFPDQPVGTIYLRRFPDRTVV
FT                   VFSDICPHLGCKVDYEADQSRFFCPCHSSAFALDGQAMNKVSPRPLDQLEARIDPSGMV
FT                   WVKYQEFRTGIPEKVVV"
FT   gene            527253..529085
FT                   /locus_tag="Plim_0424"
FT   CDS_pept        527253..529085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0424"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: scl:sce0365
FT                   cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66274"
FT                   /db_xref="GOA:D5SPP4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP4"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ADG66274.1"
FT                   /translation="MHRVSHWLEARTGLITWFRELANAPVAGGPRWRYAWGSVLVVLFI
FT                   TQLVTGLAMAGTYSPGRLSSWESTYYIQHQLHWGWLVRGIHHYAAQAMVVALALQVLQI
FT                   VWDRWYLAPRELSFWATIAGGLCILGLSHTGYQLPGDQRAHAATSIFLNIMSSAPVAGP
FT                   YLQELVQGSSRYGNLTLSRLYVLHVGLLPLAYLGVLCLQTLLWRAEARRNRQDDVPLNA
FT                   TRFWPGQALRNGIFSLLAVVAVVGLTLIQPAELGAPMNPAEAFSAARPEWYFLFLFRFL
FT                   KFEFVQQLGGLVFGAIYLPTLIGLVILIMPWTGRSRWGHKANVAFLLLLLAGVGYLTVT
FT                   TLREDALNVDHQLALHHSEQLAQRTVDLASQTGIPASGAVALLANDPLTQGPRLFQKNC
FT                   AACHHHEAVAASHAAHPPQFSAADLSHFGSREWMKAILIDYATVLAPLKNHSDATVAAR
FT                   FLEGDMASWSSDNRDLLLAPENATSLAALLEFMAQQSGRKDRGTIDEKLALQGREVFAT
FT                   GKLASGSLSSACIDCHAMHVRGEDKPLAENSGTGAPTLTGYGGSQWLTQFLKAPGSDDY
FT                   FGAKNAMPAFDKLPPRELEMLVQWMTGDYWLPAR"
FT   gene            complement(529103..530323)
FT                   /locus_tag="Plim_0425"
FT   CDS_pept        complement(529103..530323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0425"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   gur:Gura_2680 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66275"
FT                   /db_xref="GOA:D5SPP5"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP5"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADG66275.1"
FT                   /translation="MDLVPVMSTFTYTARDIQGTTHSGSVEAETLAMAVRQLKTDGLYP
FT                   VQLVESAVSLQLKPWLTRKPRQADIVSMTSQLAVVVDAGVALSVALEGLASQAVSPALK
FT                   QMLTTIEERVKSGDDFSTALSEFPRSFDARYVNLVKAGEATGHLGPILSRLAEQLQQES
FT                   ETRQRVQGAMMYPAAMLLMCVGACIFLLTYVFPKIAPMFAGRGIELPAATRILLTVSNS
FT                   LTGYWWAWILGVVALVAANAYLLSKEWGQRLRDRLMLQLPILGPLVRKTILARIARTLS
FT                   ATVSAGVPVLPALELAAKVAGNRIFQDAMEDVALHVTSGQSIAQIMATNPVFPKSVVQM
FT                   IAAGEQTGQLGTVLGKLSDHYDREVAVSIKSATSLIEPIMVAVMGLVIGTIALGMLLPI
FT                   FKLSTHH"
FT   gene            complement(530461..532194)
FT                   /locus_tag="Plim_0426"
FT   CDS_pept        complement(530461..532194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0426"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; KEGG:
FT                   gsu:GSU1491 type IV pilus biogenesis protein PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66276"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP6"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADG66276.1"
FT                   /translation="MAGLLQLNKPRLGDLLVQKGYLSAEHLDEALAQQHSSGGMQLLGE
FT                   IVVAQGYCSEDQVLECVADDCGIPYIRLDSRLFDPRAVELLPREFLEKNCILPLFKVRQ
FT                   TLTVATAEPSNIFIIDQLRQISGCDIQLAVASSRDIRRTFQMYLPNSKVFVIDDIIDDV
FT                   NTEAVELIEESIDDISFDVDLAGQSPIIKLVNYVIFSAVRDGASDVHIEPTERQIRVRY
FT                   RVDGALHQALELPLHIAPAIASRIKIMATLDISERRLPQDGRIHVLMEGRPIDLRVSTL
FT                   PLPHGEKVVIRILDSQKINLTLSQLGFSAEILEKFIAQIHHPNGIALVTGPTGSGKSTT
FT                   LYSAINAVTSMEKNVCTVEDPVEFQLPMVNQFQVNEKIGLSFAAVLRSLLRQDPDIIMV
FT                   GEIRDNETARIGIQAALTGHLVFSTLHTNDACSAVTRLINMGIESYLLAASLNMVLSQR
FT                   LCRRICPKCKQSYEPPKAMQLAMGKMGMEAKEFFRGVGCKKCRNTGFSGRVAIHELLVV
FT                   DDGMRDLIAQSPALGELKSYAQKQGMMPLRFDGFRKVREGLTTIEEVFQASDEGWLPLR
FT                   S"
FT   gene            complement(532246..532584)
FT                   /locus_tag="Plim_0427"
FT   CDS_pept        complement(532246..532584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0427"
FT                   /product="anti-anti-sigma factor"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   dal:Dalk_0884 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66277"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP7"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADG66277.1"
FT                   /translation="MQVSTETFGNVLVAHTPEELTEETTRLFHEAIETHLQAGLKSVVL
FT                   QMDRSETLDSAGLTALVDLHERLREQGGNVKICALTETGRKIFHVTRLDEEFDLYESMI
FT                   DAVGSFQS"
FT   gene            complement(532644..533066)
FT                   /locus_tag="Plim_0428"
FT   CDS_pept        complement(532644..533066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0428"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rce:RC1_0993 transcriptional
FT                   regulatory protein YycF"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66278"
FT                   /db_xref="GOA:D5SPP8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG66278.1"
FT                   /translation="MNYRVLLCDDEPHVLLPLSLKFRKSGFDVQMAEHGGIAWSKILEE
FT                   QPDVVITDCNMPHMSGLQLIEKIRSCEATRHLPAILLTAKGYEMDEAELQERLGVSALV
FT                   VKPFSPKEVVQTAIRLLNPGGHDSVEITDLTNHFRP"
FT   gene            complement(533134..534840)
FT                   /locus_tag="Plim_0429"
FT   CDS_pept        complement(533134..534840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0429"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: glo:Glov_0589 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66279"
FT                   /db_xref="GOA:D5SPP9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPP9"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADG66279.1"
FT                   /translation="MRGDLPALDARLNALSAEFDIPSEEGTDRNAKLCQQLSGIDPHST
FT                   REGSKSDKAARTSTSQGSTTRAHDLEPQSSSSPSPGKPPQRRIFQAHYSVLLPLIIPVA
FT                   VFGQTAVLLCILLFGTPISSLIVFLFCLGGVLISAMIAARYEADAARRLGQPENRTQLT
FT                   ADLVLFRNIISEANHLLQQAEKRTAEAVHARATVEARFKVQKRHVRRLEMALDDMEQPV
FT                   VVTDVNGHALYQNESARSLYKQISQKLAREIQEQTGLIDILEGMKPLLQETLTRRVASD
FT                   RRTADIPCLTTTYRIHAHTLKENENTLLGAALVLQDIGREVQDRSRHAEFVSSVCHEFK
FT                   TPMSSIKAYAELLRDGEIDEAEEQQKILVFIDEQVDRLSRLVDNMLNLARIESGVIRVQ
FT                   RKDVEINRLLKSALDVVTPQAAAKSQTVESLLSDLYIPAHVDEDLFSQAVVNLLSNAVK
FT                   YTPAGGKISLKSRLEEDRVLIEVRDTGMGIPAASLPRLFERFYRVPENMKAAAGTGLGL
FT                   ALVKYIISSIHDGSISVSSKQGEGSCFTISIPAGHRIRKTHRVNDHVLLDN"
FT   gene            complement(535262..536506)
FT                   /locus_tag="Plim_0430"
FT   CDS_pept        complement(535262..536506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0430"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: tgr:Tgr7_1034 exodeoxyribonuclease VII;
FT                   TIGRFAM: exodeoxyribonuclease VII, large subunit; PFAM:
FT                   Exonuclease VII large subunit; nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66280"
FT                   /db_xref="GOA:D5SPQ0"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ0"
FT                   /inference="protein motif:TFAM:TIGR00237"
FT                   /protein_id="ADG66280.1"
FT                   /translation="MPGNDLPKLTVSQLSDCLREIVEMAFPRVIVTGEISGLTRASSGH
FT                   VYFTLKDEASQIKAVMWRSSAIKLKFDLRDGLAVEAIGGVEVYAPRGQYQLMVERLTPQ
FT                   GIGPLELAFRQLHAKLAAEGLFDVARKRPLPRFPKRIAVITSPAGAAVHDILQILLRRW
FT                   PGVNVVVVPVPVQGPEAAPKIAAALGMVHRLPDVDVVICGRGGGSLEDLWAFNEELVAR
FT                   AIAQCRIPVISAVGHETDVTIADLVADQRALTPSEAAERVIPVKAEWVQHLDQLRDRLC
FT                   SSLVALTNSRRKELEQLKKRRALAKPLEQIHRFSRELDDLETRLKQSWKRKLASLNAEL
FT                   ESAGRALQALSPLAVLERGFSISKRVPGGDLIQSVKQVQVGDRLATLVADGQILSQVLQ
FT                   VDADDDQQDPASSES"
FT   gene            complement(536619..538466)
FT                   /locus_tag="Plim_0431"
FT   CDS_pept        complement(536619..538466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0431"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; TPR repeat-
FT                   containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66281"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ1"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ADG66281.1"
FT                   /translation="MPVRLVNIRRFACAASLAWAIGSTVGCAPMSGWVMNSSGAAYYQR
FT                   GEFEMARNEFARAVYDDPLNPDYRFNLAVAQSRLGQVAEAEQILQHNLTIDPSHEPTYA
FT                   ALSRLMIDTGRSSEAVGVMQTWVGSQPYNPDAYVGLASAQQKTGDLSAAQQTLQQALRV
FT                   QPNEPKVLAQLGEIHQAQGNVAMASQMYQQSLAANVHQPDVQAKLMATANQAHPGSMPA
FT                   TQLAQSMPKVPSVLHPIASGQKTPVSPTAAPTSIARRAPQNAHQAVQQQAQNQPAINQV
FT                   AQHRPALQPIPARQPTPIAASPAMNAPAQFAMASQVSAMPQGNMVQWQAPAQAPSPVPG
FT                   YRYVILPQPVAFLVPQGQVAQQQVPQQYQVSYQPVMSQPAGVQPAMLPQGVVTQAQPVQ
FT                   TQPMQVVYQWPQNYGVPANGMTAMVIPQASQPQTTYGAQAMMAPATQNFATQNHATTFT
FT                   PPLYQQQPAAVRSPMVSSVPNPGTSETIFPVSYHPLPMTNATSRKEVSPVETSAPAQVP
FT                   AFTPPPQEPTVVSASHTTTAPATTSNRSGTPIQVLSTPTETLVLPGVIQQPSSPATNLE
FT                   TSATNMHVPPAPTRTGQPVVVAPSTSLVSQTTTELPPGF"
FT   sig_peptide     complement(538386..538466)
FT                   /locus_tag="Plim_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.365 at
FT                   residue 27"
FT   gene            539039..540874
FT                   /locus_tag="Plim_0432"
FT   CDS_pept        539039..540874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0432"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   afr:AFE_0276 dolichyl-phosphate-mannose- protein
FT                   mannosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66282"
FT                   /db_xref="GOA:D5SPQ2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ2"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ADG66282.1"
FT                   /translation="MMLTTRQRWGLLLAVGLVFFTGLGSPWLFDEDEPKNAECGREMYV
FT                   RGDWLVPTFNEDLRTDKPILIYWLMLTSFHLFGVSELTARLHSSILSVGSVLLVWQLGK
FT                   SLFRSETGLLAGLILGTSLMFAAVGRSVTPDATLIFCILLTMTAYVTAVARRHGGRFGQ
FT                   ADSDGNVVAQRLWGEYVPQSTWEFASIYASMGLAILAKGPIGFLLPMAIWGQFLLLQRY
FT                   RDRTECGNSVIDARQHWLSRTFLMTWELYHPRAFWEALREMRVVQGTMITALVALPWYI
FT                   AVGFATQGAWLAGFLGGHNVDRFMRPMENHSGPIIYYIPVIALGFFPWSIFLPAGIWQM
FT                   TRQVRKPSNDRAAVTFVATWAMVWIGFFSLASTKLPNYVLPSYPALALLVANYLSEWMQ
FT                   EASHIRSLGFRNACRLLSVVGIVAIPALIYATSIYLPNEVWLASLGVIPLVGGVLAFSA
FT                   AQKALRHRAVAICCASALLLSLGMMGVAAPRISRYQDSPQLAKLIRHEANGRPVRIATH
FT                   NYSAPNVVFYAAQRIERLDSPKDITKFFHEAPEGYLITRADRMEDIVDALPQEITILHR
FT                   MPRFLRRHDLIVLGNQSKAASMTAAAQDLDRLRWQ"
FT   sig_peptide     539039..539113
FT                   /locus_tag="Plim_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.631 at
FT                   residue 25"
FT   gene            complement(540880..541908)
FT                   /locus_tag="Plim_0433"
FT   CDS_pept        complement(540880..541908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_3317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66283"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66283.1"
FT                   /translation="MISEMWQKAMHRFLLASCAVILMSQRWVIAEDNISSVPPARPWPR
FT                   ALTEFTPLSLEPIFTGRGLPTSQELSSQEKPAWDARIRERGDILRLSPDDWRLYYTGYD
FT                   GSKTGIRQLGLAHSKDGLRFERSQPEPLIPGRWVEDVCVRTHNSQKNTSSAPFLMFAEG
FT                   EGDQMQWFQSQNGIEWSHLGQVDIRKRSGEPIEPGPYGTPTLWIEGNQWHLFYERRDLG
FT                   IWHATSADGKVWQLVQDDPVMVCGPQDFDRLQIAANQVFRHGGMYYMVFHGSGDATTPR
FT                   RWATGLARSTDLHHWEKYPGGPLRPIDENKSSGIIVHDGLRYRLYTMHDQVIVHVGPMT
FT                   SD"
FT   gene            542089..543816
FT                   /locus_tag="Plim_0434"
FT   CDS_pept        542089..543816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0434"
FT                   /product="peptidase S24 and S26 domain protein"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   aph:APH_0802 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66284"
FT                   /db_xref="GOA:D5SPQ4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ4"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ADG66284.1"
FT                   /translation="MVTTFGHGPLRTTVECVVALLLAVLLFRTFAAEGFMISTGSMAPT
FT                   LLGFHKRVACPKCGELFAYGTAWDESANHLAASSSEFEVEQSICPNCSQQGIDLSHVPR
FT                   NHGDQLLVNKQAYLWSSPQRWEIAVFRNPNLPTEAYVKRIVGLPGEAVSIRNGDLWING
FT                   EIARKPLAVQRTMWIPVYHQEHRPTHDTSFQDRWVSTDGWLEPTSNLRGWRSSPTSFLF
FT                   REQTAGGATEALPAISSDSEQNITSQPAGQTAVAAESSISWIEYQHWVRSGGTHITTVT
FT                   LEEWPSDLQLATLPPSGLKYDSKTKKLSCFGVLPDDVVSFLRTNSQNLVFLQAIDKLKA
FT                   ASHLAPITDRYGYNPAANSMEPNSVRDIAFVGDLSLPQEQGRFFIQLTDGFERYTLDFD
FT                   SERESVRLFLEGTDRPLRVGPWSPPERGQSVQIEASMIDRQVALAIDGHEVFPAWPISA
FT                   VPLGAESPRSPVRFGALSGTVRISNPTLYRDVFYTFHRSRHAVNRPYQLGPDEFFVLGD
FT                   NSPVSHDSRQWEVPGVHRKLLVGKPFLVHLPSQPGRLKIGDQEWLLRLPDFDRVRFLR"
FT   sig_peptide     542089..542184
FT                   /locus_tag="Plim_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.789 at
FT                   residue 32"
FT   gene            544299..544370
FT                   /locus_tag="Plim_R0007"
FT                   /note="tRNA-Thr1"
FT   tRNA            544299..544370
FT                   /locus_tag="Plim_R0007"
FT                   /product="tRNA-Thr"
FT   gene            544387..544468
FT                   /locus_tag="Plim_R0008"
FT                   /note="tRNA-Tyr1"
FT   tRNA            544387..544468
FT                   /locus_tag="Plim_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            544502..544572
FT                   /locus_tag="Plim_R0009"
FT                   /note="tRNA-Gly1"
FT   tRNA            544502..544572
FT                   /locus_tag="Plim_R0009"
FT                   /product="tRNA-Gly"
FT   gene            544734..544806
FT                   /locus_tag="Plim_R0010"
FT                   /note="tRNA-Thr2"
FT   tRNA            544734..544806
FT                   /locus_tag="Plim_R0010"
FT                   /product="tRNA-Thr"
FT   gene            545039..546235
FT                   /locus_tag="Plim_0435"
FT   CDS_pept        545039..546235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0435"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: scl:sce0841
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66285"
FT                   /db_xref="GOA:D5SPQ5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ5"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADG66285.1"
FT                   /translation="MAKEVFQRTKPHVNVGTIGHIDHGKTTTTAAILAVQTAKGLAKFK
FT                   SYSDIAKGGTVRDETKTVTIAVSHVEYETATRHYAHIDCPGHADYIKNMITGAAQMDGA
FT                   ILVVSAADGPMPQTREHILLARQVDVPALVVFLNKCDLVDDEELLELVEMEVRELLTKY
FT                   DFPGDDITIVRGNAKGALDNPADPKFNKCIGDLMDALDANVPEPERAVDKPMLMSIEDV
FT                   FSIEGRGTVVTGRIEQGILKVGDKVQIIGLKDTIESVCTGVEMFQKTLDEGRAGDNVGV
FT                   LIRGIKKEDVQRGQVLAKPGSIQPHTKFECQVYVLSKEEGGRHTPFFNGYKPQFYFRTT
FT                   DVTGGAKLLGGAEMCMPGDNVKMEVELLKPIAMTENVRFAIREGGKTVGSGVVTKILA"
FT   gene            546408..546563
FT                   /locus_tag="Plim_0436"
FT   CDS_pept        546408..546563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0436"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: cju:C8J_0444 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66286"
FT                   /db_xref="GOA:D5SPQ6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ6"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADG66286.1"
FT                   /translation="MAREFVWLECTESGQRNYRVSKETRGTERLELMKYCPRLRKHTLH
FT                   KESRKK"
FT   gene            546621..546693
FT                   /locus_tag="Plim_R0011"
FT                   /note="tRNA-Trp1"
FT   tRNA            546621..546693
FT                   /locus_tag="Plim_R0011"
FT                   /product="tRNA-Trp"
FT   gene            546889..547371
FT                   /locus_tag="Plim_0437"
FT   CDS_pept        546889..547371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0437"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: cps:CPS_4778
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66287"
FT                   /db_xref="GOA:D5SPQ7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ7"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADG66287.1"
FT                   /translation="MNMASTAQATIWQSIISPGLYKRNQGRLVRYLTAAAMILAVLLGS
FT                   WTFSVRVFDDLMAQLSAAFPAISNFSNAIRIAVPTVMAVLGSWCAWRLVHYPVFADFLI
FT                   EVESEMSRVTWPERPELMKATGVVLFVTISLSLVLFGFDLFWQWVLGLIGVLQIYG"
FT   gene            547576..548190
FT                   /locus_tag="Plim_0438"
FT   CDS_pept        547576..548190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0438"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="KEGG: lch:Lcho_3872 NusG antitermination factor;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: NGN domain protein; KOW domain protein; SMART:
FT                   NGN domain protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66288"
FT                   /db_xref="GOA:D5SPQ8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ8"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADG66288.1"
FT                   /translation="MAVDGKATEGVAGGASSSNSEVASTENAMLWYVLKITSNREKSIR
FT                   DNLLRRIRQEGLEQFFGEILIPTEKVVENKNGKKKVVEHKLYPGYLMVQMILNDDTWYI
FT                   VRTTGGVGDFTGSAGKPTPMQDHEIARMLQKQEQKQESAAPAMKIEFAVGDIVKIKEGT
FT                   FEGFEGPIDSIDEANGKINVLVEIFGRSTPVELEYWQAERP"
FT   gene            548258..548692
FT                   /locus_tag="Plim_0439"
FT   CDS_pept        548258..548692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0439"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: tcx:Tcr_0284 ribosomal protein L11; TIGRFAM:
FT                   ribosomal protein L11; PFAM: ribosomal protein L11; SMART:
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66289"
FT                   /db_xref="GOA:D5SPQ9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPQ9"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADG66289.1"
FT                   /translation="MAKKEAKIKAQVKVQIPGGKATPAPPVGTALGPHGVNLGQFVTQF
FT                   NDRTKDLNGMIVPVVITIFEDRTFKFELKSPPASVLLKQAAAIAKGASKHRSEKVGSVT
FT                   KAQLAEIAKTKMADLNASSLDAAVRIIAGTARSVGLEVLD"
FT   gene            548759..549466
FT                   /locus_tag="Plim_0440"
FT   CDS_pept        548759..549466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0440"
FT                   /product="ribosomal protein L1"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: sfu:Sfum_1546 ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66290"
FT                   /db_xref="GOA:D5SPR0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR0"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADG66290.1"
FT                   /translation="MATVSKRMKHLGEIAGKIGVVDLPAAVTSLKGMESKLPKGVKPCK
FT                   FDQTVTISVRLGVDPRQADQIVRGSIVFPHGIGKSKRVLVFAQGDNVKIAQDAGAEFVG
FT                   GKELADKIKEGWVDFDVAIATPDMMGVVGPLGRVLGPRGLMPSPRAGTVTADVAAAVKE
FT                   YRAGKVEFRVDDGGNVHCVVGKMSFGEQQLIENVEAFLKYIRSLKPATSKGQYIRNIVI
FT                   VGSMTPAVYVTAV"
FT   gene            549570..550082
FT                   /locus_tag="Plim_0441"
FT   CDS_pept        549570..550082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0441"
FT                   /product="Ribosomal protein L10-like protein"
FT                   /note="KEGG: acp:A2cp1_2361 ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66291"
FT                   /db_xref="GOA:D5SPR1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR1"
FT                   /inference="protein motif:COG:COG0244"
FT                   /protein_id="ADG66291.1"
FT                   /translation="MSKVVKKMMIDDIRTAVGEHRDLLVLDASKVDAVSANKWRLLMQS
FT                   KKISVLGVRNSVANAALREVGIDLADSLKGPSTIVWGAEDVVALAREIVDSLKDCKNLA
FT                   VKGGTLSGTALSASDVEKLSKSPGRKEVLGQLVGLILSPGANLAGALLGAGGTLAGQVQ
FT                   SIAEKTE"
FT   gene            550232..550624
FT                   /locus_tag="Plim_0442"
FT   CDS_pept        550232..550624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0442"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bra:BRADO3053 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66292"
FT                   /db_xref="GOA:D5SPR2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR2"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADG66292.1"
FT                   /translation="MADFDSATTELGDKIVALTLLQAKALADYLEQVHGIKPAGGAVVM
FT                   APGGGGAAPAAPVEEKTEFDVILTGFGDNKLSVIKVVRTATGLGLKEAKDLVEGAPKPV
FT                   KTGISKEDADKLKKELEASGATAEIK"
FT   gene            551257..554973
FT                   /locus_tag="Plim_0443"
FT   CDS_pept        551257..554973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0443"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase Rpb2
FT                   domain 2; RNA polymerase beta subunit; KEGG: mes:Meso_1819
FT                   DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66293"
FT                   /db_xref="GOA:D5SPR3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR3"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADG66293.1"
FT                   /translation="MPNPAQRVIETHETRHFGSIRGEFAISELTQIQTASYHRFLQLES
FT                   EPRERADDGLEAILREVFPIESYDQKYRLEYIKYELGKPRYTPLECRQLRLTYGRPFRV
FT                   WLRLMKEQPQEEEVYLGDLPIMIGGGEFIINGSERVVVSQLHRSPGVDFVMSAEPGEKK
FT                   TFSCRVIPERGSWIELNIGKRDTLNVRIDQSGKFSAMTFLRAMDPAYGRTKDLVKLFHN
FT                   VVTFKVSDSHFVEHVAGKHAADDIVYPAGHERMGEIICEACHVITKPLAEEIKESGIKT
FT                   VDVAEKSDDPIIMDSLIEDSTASHEDALLRIYQRLRPGNPPQLEKAIELFKEKFFDVNR
FT                   YRIGRVGRFRVNRKFDQDVPDTEMTLRPEDIINSIRYVMKLRTGDATAHVDDIDNLGNR
FT                   RLRTIDELAQEELRKGFLKLRRTVQERMSLKDVEEMSPRSLINPKSVSAAIDFFFGRGE
FT                   LSQVVDQTNPLATLTHERRLSALGPGGLNRKRAGFEVRDVHISHYGRICPIETPEGTNI
FT                   GLISSLSIFAKVDDYGFLITPYRKVVDKKVTEEIVWLRADEESHVYIAPADTPVQDDKM
FT                   RDERVMCRHHNDFLWLPASQVNYIDVAPCQMVGVSAGLIPFLEHDDANRALMGSNMQRQ
FT                   GVPLLIAEPPLVGTGLEGPVAQNSGMVLRAEKSGKVTYVDGDCIEIDGKRTPLRKYTGL
FT                   NERTCLNQTPVVKVGDKVKKGDILVDSAAVGDGELALGRNVLVAFMSWEGFNFEDAIIL
FT                   SERLVKEDVYTSIHIDEFDVEVRETKLGREEFTRDIPNVSDKALRHLDDDGVIHVGTRV
FT                   EPGDILVGKVSPKAKTELTPEEKLLHAIFGRAGEDVKNESLEVPSGVEGIVIHTEKFSR
FT                   RMSLSETERKKFETDLKRVEESGNDLIAAAFKTFLTHFETALEKKLQDDDGRDLGKLDD
FT                   AKFLATYAESFLHRFETMDLRSPQKKADCKKAIKEFWGPVEEAIDDRDRKLNTMKRGDE
FT                   LPSGVLQMVKVYVAQKRQISVGDKMAGRHGNKGVISKVLPVEDMPFLADGTPVDIILNP
FT                   LGVPSRMNVGQILETHLGWAAAKLGFRAKCPVFDGPAEETIRELLKQAGLPEDGKAQLL
FT                   DGRTGEPFEQKTTVGYIYMLKLHHLVEDKVHARATGPYSLITQQPLGGKARFGGQRFGE
FT                   MEVWALEAYGAAYILQELLTVKSDDVEGRTKIYESMVKGENTLEAGTPASFEVLNNEIR
FT                   GLCLNMQLEKSLT"
FT   gene            complement(555433..556161)
FT                   /locus_tag="Plim_0444"
FT   CDS_pept        complement(555433..556161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_0803 dual specificity protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66294"
FT                   /db_xref="GOA:D5SPR4"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66294.1"
FT                   /translation="MTHENTTNSTETTPAASRLRFRWILILATIVAMGAGGWAYRQNHR
FT                   YKHVAIHDPGKVIRCAWVEADVMAELVQKHQVKTVLNLCRPGEMGPDRARQERMAVEAA
FT                   GAKLIELSLPDIDDPSSPLIAPHIAVLKDPANYPLIVHCQHGFNRTGRVLTMYDVMFRG
FT                   KTGEEALSKMPLFGRHDYAPLEHAFARNFDVFYAAEKAKEAAGEKPDQSTPSLTTEHVE
FT                   TAVPAIEQTSFQEGTGKPSR"
FT   gene            complement(556296..557300)
FT                   /locus_tag="Plim_0445"
FT   CDS_pept        complement(556296..557300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0445"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gme:Gmet_2892 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66295"
FT                   /db_xref="GOA:D5SPR5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG66295.1"
FT                   /translation="MHVSIVVPIYNELENLPLLHAAIMRVMEPLVHSCELILINDGSTD
FT                   GSTEVMDQIAAADSRVKLIEFRKNFGQTAAMQAGIQAATGDVIVTIDGDLQNEPEDIPM
FT                   MLAKIEEGYDLVHGWRKNRQDAVLHRKLPSVCANWLIGKVTGFPVHDLGCTLKAIRSEI
FT                   AKELQLYGEMHRFIPILARQRGARCIEVVTRHHARRFGVSKYGLGRVTRVLLDLATVKY
FT                   LIQYAVSPMKLFGMMGLMAMFTSGLAAFASIGLKLTYNYDMTGNPLLLLSAVSGLAAIQ
FT                   FVFLGLLSELCSRIYFQVQNVQTYAVRKTTNFETVSLAISPAPLLDPRSRRAA"
FT   gene            complement(557540..558973)
FT                   /locus_tag="Plim_0446"
FT   CDS_pept        complement(557540..558973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0446"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: bca:BCE_0694
FT                   cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66296"
FT                   /db_xref="GOA:D5SPR6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR6"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADG66296.1"
FT                   /translation="MFNWLPGTLAVISFVLQFSLVSVVLLTKRRQETATVAWIITIITL
FT                   PYIGAILYLIFGINRVESTVKHRLRAWRRLSHRLPELSERHLLDSDRLTPLQSNMAKVA
FT                   TRLAESRPTMHNRVDLLHDAGIAFDEIETAIRNARSTIHLEYYIWQPDKIGTRLRDLLI
FT                   EKARAGVKVRFLYDSIGSLRLSRRFIAPMREAGIEISAFVPGRGWLESWSLNLRNHRKI
FT                   IIVDGEIGFTGGMNVGDEYLSRVPHFGHWSDTHLRLMGPSVLQLQMIFAEDWHCATGRE
FT                   ISWQDDFPRPETHGHVEAQVVSGGPHMEDSVFQSLFFAAINEARHHITITTGYFVPTNA
FT                   LVVALECAAVRGVKVRLLLSGAKGYWYTRMAGRSSYSPLLRAGAEIWEYNRGYLHSKTL
FT                   TLDGEYSLVGSPNFDSRSVFLNFEVAVAMYDKGIAEQLNSQFEIDVRQAEPIEKSLWFK
FT                   RSRWQKLQENWARMFAPIL"
FT   gene            complement(559141..559974)
FT                   /locus_tag="Plim_0447"
FT   CDS_pept        complement(559141..559974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0447"
FT                   /product="Type II secretory pathway component ExeA
FT                   (predicted ATPase)-like protein"
FT                   /note="KEGG: dsh:Dshi_3387 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66297"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR7"
FT                   /inference="protein motif:COG:COG3267"
FT                   /protein_id="ADG66297.1"
FT                   /translation="MMPEDSLTRPSPFRLTLAPDDFFASVEHEEALSRLWYLAEQRAPV
FT                   GVLSGISGTGKTFLLHVLARELSQVGVEAILLDATSLDRHELLWRIVEAFGLGPDVEDS
FT                   PLWLWSRLTDFLEGQKSTGQRLAFMIDHCQTLDPASAHVLRRLLALSMGCESNVTWIFA
FT                   IGRSEEHAFLSWLEESSGLKIDLPIWSSARCDEFLRWRLARSNYSLPIFTKAAVDRLYT
FT                   RSRGIPLEICRLADLALLAGSAEGRELIGAETIDCVAQELIRDRESSRPGTVVFD"
FT   gene            complement(560210..560542)
FT                   /locus_tag="Plim_0448"
FT   CDS_pept        complement(560210..560542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66298"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66298.1"
FT                   /translation="MEHSMLSRSIVRIVELVARGGPIFACGQEEIMNGMQSTGWRMSVA
FT                   LMVLSASASMSGCFQTTVGGQTLPSAYYLEDDVQYFPAGPETRLYNQIQAMERYNLERE
FT                   QLESSY"
FT   gene            complement(560797..560901)
FT                   /locus_tag="Plim_0449"
FT   CDS_pept        complement(560797..560901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66299"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66299.1"
FT                   /translation="MVKRLQKTTLTFVTYLFKIVYDMKQVLENQDLSA"
FT   gene            561032..563506
FT                   /locus_tag="Plim_0450"
FT   CDS_pept        561032..563506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0450"
FT                   /product="DNA topoisomerase type IIA subunit B region 2
FT                   domain protein"
FT                   /note="PFAM: DNA topoisomerase type IIA subunit B region 2
FT                   domain protein; DNA gyrase subunit B domain protein; TOPRIM
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: DNA topoisomerase II; ATP-binding region ATPase
FT                   domain protein; KEGG: ank:AnaeK_0004 DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66300"
FT                   /db_xref="GOA:D5SPS0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS0"
FT                   /inference="protein motif:PFAM:PF00204"
FT                   /protein_id="ADG66300.1"
FT                   /translation="MSDAAATPAPSTSEYSEKNIRALEGIEGIRLRPDMYIGDRGSRGL
FT                   HHLVFEVVDNSIDEAVAGYATWVSVKINVDGSVSIIDDGRGIPVGAMADQGGKSALEIV
FT                   LTKIHAGGKFDRQGGYKTGTGGLHGVGITAVNALSEWLSAEIRREGHVWTMDFARGTRT
FT                   TELTKLGLADVTGTKITFKPDSTIFTESKFVFDVLAKRLQELAFLNAGIHIRLADERTE
FT                   QSEEFHYPDGLREFVKHLNRTETTLYADILSIEGEIEGVKVMVCLQHNDGFSETVRAFA
FT                   NNIYNMEGGTHLSGFRSALTRAINNYGKRENLFKDIDTTGDDFREGLVCVIAVRVPHPQ
FT                   FEGQTKTKLSNGEVEGIVNSIVFEGLTKFFEENPGIAKKICQKGAMAAEAREAARKSRE
FT                   MVRRKGALTSGGLPEKLRDCRSRELDITELYLVEGDSAGGSADTGRDSNTQAILPLRGK
FT                   ILNVEKAQLVKILDNAEIANLFKAVGIPPMAELEDVTKRRYGKIILMTDADVDGSHIRT
FT                   LLLTFLFRHMRALVEHGCIYIAQPPLYRVIQKNKTRYVQTHDMMMTELIELGMNGTRLV
FT                   DPNDGFTFEGESLRHVVNLMRRLAEPVELLERRGISLKSLEPLLNASFKLPQYRVTITR
FT                   TDHWFHTREDVEAFLQSEAARRGSELNMANSDAQPVAADTAKPVEGAAQLTDLHEIRTL
FT                   NDVLSDLRGIGIQFRHLIPAGMRDGELVFPFRIEQEKSVLKLQSLRELLEKLRALGEDG
FT                   LTVTRFKGLGEMDPEELWETSMQPTARTLLQVRMDDAAAADEMFRVLMGDQVEPRREFI
FT                   EKHALDVKDLDI"
FT   gene            563754..564770
FT                   /locus_tag="Plim_0451"
FT   CDS_pept        563754..564770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0451"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: aba:Acid345_4540 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66301"
FT                   /db_xref="GOA:D5SPS1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS1"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADG66301.1"
FT                   /translation="METPRTTFEGPRPIPFQAPQGDLAILSGTANPLLAQHVATALGVS
FT                   LTPCRAHIFSEGNVFVRIKENVRGKDAYIIQGCHFPVNDNFMELLFWIDALRRASAQNI
FT                   TAVIPFFSYAQGDKKDEPRVSIRARVCADAIEAAGADRVLTMDLHSPQIQGFFRVPVDH
FT                   LYGRQVLAEHVRRLQIPDLVVCSPDVGFAKGAAAYANLLGTPVVIGNKQRTDHSETVEV
FT                   LEVIGDVKDRNVLLVDDLTITGRSLIAMAETLKKRGARDVYAAVTHAVLSKGASERIAQ
FT                   SQIKLMFVTDTIENSFDPLPPNVQVVTVAPLFAEAIRSIHERTSISMLFPDGRPICP"
FT   gene            complement(565017..565089)
FT                   /locus_tag="Plim_R0012"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(565017..565089)
FT                   /locus_tag="Plim_R0012"
FT                   /product="tRNA-Thr"
FT   gene            565472..566248
FT                   /locus_tag="Plim_0452"
FT   CDS_pept        565472..566248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0452"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bbr:BB2871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66302"
FT                   /db_xref="GOA:D5SPS2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS2"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADG66302.1"
FT                   /translation="MNLKSVEQEIIRSCEKSGRLPNEVTLIAVTKYVHAPVIAALYDLG
FT                   VRDVGESRPQNLALRRCEVEALFPSTTSGSTRDEGTLADLKWHLIGHLQRNKAELAVSK
FT                   ADAIHSCDSERLLTRLDQLLSATPRPLPLFLEINISGEVSKHGFTPDEARAWWRAQAVE
FT                   RPAGCMAQSHLPVGLMTMAPIDASPAELVQIFSGLKDLKIELEAMSSEHRLPWLSMGMS
FT                   GDFPIAIECGATHVRVGSRLYQGLSNRCFLNDTPPA"
FT   gene            complement(566324..566875)
FT                   /locus_tag="Plim_0453"
FT   CDS_pept        complement(566324..566875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66303"
FT                   /db_xref="GOA:D5SPS3"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66303.1"
FT                   /translation="MIDEAHLSREGERRKEAILMLAKQTGQRRRDRRVATRWGIMLMFC
FT                   GAGLFAAWQVVITETARFVQHAPAPHSPTKEPVLPIDNKRLSPVVGQQPALARAPDRRI
FT                   SPARDLQPARHLQPTNRPVVISKIKTDPGLRQKLTIARKTPLWEKIDDQLLIEELRQGQ
FT                   IPAGLAIVAGKSQLIYHDLP"
FT   gene            complement(566865..567509)
FT                   /locus_tag="Plim_0454"
FT   CDS_pept        complement(566865..567509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0454"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bha:BH0263 RNA polymerase sigma
FT                   factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66304"
FT                   /db_xref="GOA:D5SPS4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG66304.1"
FT                   /translation="MHQPISELTRAMSAGSVKAIEEFYREYFPQIYRTARRITGRDESF
FT                   GLDVVQEAMLRILRCIKPIENQQHLTAWLDLVVKSTAYDLLKAEARRQKREQTAVQGRQ
FT                   LTVGIVPAALAGDEEAHDRLVWLRQQLSQFDPELAQMIDLRYQQSWTLDRMAEFLGLSI
FT                   ATVDGRLRRAINRLKKAAMSQGAFEEITTSIPGYPCETIRPAINGGGSYDR"
FT   gene            complement(567574..568422)
FT                   /locus_tag="Plim_0455"
FT   CDS_pept        complement(567574..568422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gdj:Gdia_0064 SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66305"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66305.1"
FT                   /translation="MLLKRSVTALFAICLTWLAAFPSLLMAQETDAPAESQVAVEDRVI
FT                   AEVQLEGVRLSEAIEHLKEVYPGFQAIVITKSNVPATDPVLPNIALKNVKLRNILRLLE
FT                   ISVPGLAYETIDDGEGNSDRITMFRVDYTEDAPENVLKIFSLRTILSRSDDRRAALDET
FT                   LSLLQATLEAIGESNSVSMKVHEGTETVLIRGTLEQVAAIEEAIIALTPTAEELEMANA
FT                   AESSQAELEKMAAQIHQLSEALPRIVSVMEKLKQTSEATSSELAAMQKRLDALEKSAAA
FT                   K"
FT   sig_peptide     complement(568339..568422)
FT                   /locus_tag="Plim_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(568788..576635)
FT                   /locus_tag="Plim_0456"
FT   CDS_pept        complement(568788..576635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0456"
FT                   /product="Parallel beta-helix repeat protein"
FT                   /note="SMART: Parallel beta-helix repeat; KEGG:
FT                   bmj:BMULJ_04389 outer membrane autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66306"
FT                   /db_xref="GOA:D5SPS6"
FT                   /db_xref="InterPro:IPR001577"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D5SPS6"
FT                   /inference="protein motif:SMART:SM00710"
FT                   /protein_id="ADG66306.1"
FT                   /translation="MPLTKPSLASALLLAMAAPAVAQSVEDELGVATMQDFSGGGMLNG
FT                   TYFDVRNQSNSGVGYQHGFTQIGALTPLLNDGQFLIAPQARLLITDTSKIGVNVGLIGR
FT                   VYDAGRDRIWGANVYYDNDETTYSNRYSQIGFGFESLGQNLDLRANAYLPTGSSDKVIG
FT                   PNGLSNTLFYTGNQLNFTGSYLSEEALRGADFELGIPVTQNMSWLRAYGGGYFYDATQN
FT                   NVSGVRGRLDAQLSTDLTAGVIATHDSTFKTRVNAYVEWRFAGFVPTVWFPRLNTQERM
FT                   LTSVQRNWRVSTTTYNTTVAVPVINPRDDQAYFITWVDSANPNGGAGTGTYEDPLTQLP
FT                   PNSPPADLILVRQGNSNVTPYNNSITLTDFQRLLGEGKVHQIEGYANYGPFSIPQQTFT
FT                   LPEFDFNDPSRNPTLTSTAGNVVTLASNNEVSAFNIQDALGSGITNTPGGSTNFLLQNL
FT                   NITNNNTAGSATAGGIYLSNVDGTGTIRTVTTSNNQGFGTRVAADTDLDLLLDGLASTG
FT                   NELDNLNISGASGADIDVALTSTGGANAFTGSTAGSGIVMSIDNATGTFTSTTPLTASG
FT                   NALDGIRLESTSGILGTALTPFSLNGANLANNGRDALSLIGTGAGANISVAGANINGTS
FT                   AGRHGINIDATAGANVTANLSNSQFGGAGANGLNAVLDAATGTVLLTNVDVSNNGQAAG
FT                   GTGLQDAINLDLANASSLGLGLTDVIGDGGATQERGLVYNVASGSSLTVNGLRGSFDNN
FT                   LVNAINGVATGAGSIANVSLDGFTGNNAGADAVVVSSLLGATQNFELLNGTFNLATGNG
FT                   LNFTASGASTLNTVLEDVTVNGSGAEGMLVSSTGGSTFTGVIQDSFLTGSTLSGLNVSV
FT                   SDANSVATFGAIDSQFNGNGEEGLVASATSGGELNFRSAGSQFNGNGTSGVFDGVNVTA
FT                   DGANTIARTLFADSESNNNTGDGYDFAASNGAFMTARIDTSTATNNQGFGVQMAGTGAG
FT                   TTAVLLMEGDNDISGNTLGQYNATFTNVDTAVVSLSGSFNNGPGDGVNVNMTGTGTGTG
FT                   LVLLNGAAGQTIDGNAGNGVNISMTNLLNAGVTVAGYDSISNNTLDGININLDTILGAA
FT                   AVNLTGPTVLSTNGDNAIDIALTNVALGALPPGVGTDTYSVLTRTDNDVTEPRLPVPVD
FT                   LALNTLATLPTADGIVIDSMLADTSGTSSGNAAGIAIVGDTVTNGSGTAGIVVTNSQSN
FT                   TTTNGAGLLVSLLNSTTPGTELNLDINTNNFSNNDLDGVLVTLDASNLDTLNISDNVDI
FT                   SGNGGSGVVVDLSNGSTVATTTINNNLLIDANALNGIQLVVNGSDFTNGVELRGNTITG
FT                   SVAGDGISVVDPTTTAGPLVLTIAENTITGNGGNGVNLTATTGGDFSGSVIDDNTIDSN
FT                   LANGINLTLVNSTADNFQIINNSSISGNTLDGINIDLDNSSFANFLIDSNGLGGNNPTP
FT                   ISQFNIEVVLLGGLTPSQQAIFSQAAARWSQLITGDLADVDLGGGDIIDDLRISAEGAN
FT                   IDGVGGILGQAGPNGIRAGSNLPYSGGMRFDSADLANLEASGQLFDVILHEMGHVLGIG
FT                   TVWNLQGLLQGGGTADPRFTGAQATAEYNARFANVETGVPVENTGGPGTRDSHWRESIY
FT                   DNELMTGFLNPGVDNPISRTTTASLADQGYVVNINASDPYLQAITSGSTPSSPSSTAEV
FT                   VRTTNFTVTQAMAPHAALASIANNGLNGIEFNVVNSTIGGTISNNTIDGHIGGDGIRMI
FT                   NPTSGSSIDIVYDANTITNNTGGAGINLAANSTTILNQTFTNNTIDNNGDQGVNLVLAD
FT                   TAQATMTFTDNASISANGAEGVNFLVQNGSQLTTTFANNRVNNNTGIGINIVANGTNAN
FT                   AVNLTMEAGANPSLVNIVDNNRGAGVAVALSNTAGATVDISGTTISNTQLGTVAGYAGQ
FT                   GLSLRGVGSATYGGITIGDATDTTGTLFNGNNAEGIEITLTDNTLAPNVTVPSIVVQNI
FT                   DSSANGSHGFSLNTRSFADVTDVSITGSTFNANEGAGDGLHFDREADSFIRNVLIDNNI
FT                   ITGNSDGIDITARARNLDADVYTITNNTIDNNRARGITAQLVADADLQVDIDTNSIQNN
FT                   GGDGIQFSVNSALTDTPFISSVITNNTIVGNGNDGIDVSVAHSLSITDNTISENTANGI
FT                   NISGSSFNPNTNAQTVDTIVNNTIDANGSNGILVTSGGINNLQIADNDVTNSGNDGIQL
FT                   NSSGAILTATIDNNLIALNTGDGLQYVATGSGNLPLGPNNVVLTNNDIAQNTRRGINLL
FT                   NRGDANTVFTIGDGTIGNQNQVRRNQLEGIYVVNTASTTQDADANANTALLANGSIFAS
FT                   PNLQLNVDTNEVTANGRISNPAAVFDTTGLVLRVGTSDGGDGFDDEGGFAAGGRGGVIA
FT                   SVTDNIFGGHFGADVTFESFVSTSNPGATGGTWNYDNTAVFNPANNLFTPTNYQSDPLA
FT                   RLDLTFTGNTGQGIIATRTGASYTNSEAVFKSRTTDPGGSTAPGAPGSVNGPFGSDTRA
FT                   RNAQRLAARFTLPPTINIPANGGSDNFLFPGLGESTFRVNANANAANVGFGGTLFIFDA
FT                   PAYIGTGSAGGVGATGGGPFGIDNMPFGWGRLP"
FT   sig_peptide     complement(576567..576635)
FT                   /locus_tag="Plim_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            complement(577341..577874)
FT                   /locus_tag="Plim_0457"
FT   CDS_pept        complement(577341..577874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GF10480 gene product from transcript GF10480-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66307"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66307.1"
FT                   /translation="MRRVTGLMRLTGGVLLSGAVLSGAFWNHQGQSTSSFASEIQALSS
FT                   EQQADQAETRALGIQAASGAYLLAQADGAKKAMAPKTEAGAKPADDKEDSPRLPNNFGK
FT                   LELSGEQKEQVYTIQKKYAAEIESLEKQLAALKAKRDAELQGVLTAAQKETLKSIQSTP
FT                   KTKKAKTAETKPAA"
FT   sig_peptide     complement(577761..577874)
FT                   /locus_tag="Plim_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.554 at
FT                   residue 38"
FT   gene            complement(578087..578542)
FT                   /locus_tag="Plim_0458"
FT   CDS_pept        complement(578087..578542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0458"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: gbm:Gbem_1954 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66308"
FT                   /db_xref="GOA:D5SQ56"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ56"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG66308.1"
FT                   /translation="MINTETVGRPMEILLVEDSLMFSRIAIGALKNSHLRHRLTWVTDG
FT                   EQALEFLHQRGIYQQAPRPDLIFLDLGLPGIDGRDVLAELRAEEQIKSIPVVIMTASTD
FT                   EATFVETEKLQVQGYLTKPLDIEKFNRLMIDLNQFWHQDMILPRTAN"
FT   gene            578832..579053
FT                   /locus_tag="Plim_0459"
FT   CDS_pept        578832..579053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66309"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66309.1"
FT                   /translation="MSIIMYTIQKAKRVSESDSSAKMELLRKNSGTHESSFLRGFTVWE
FT                   GKPFQQTNLSGEFVLQNPSDTKRRWLFS"
FT   gene            579278..579739
FT                   /locus_tag="Plim_0460"
FT   CDS_pept        579278..579739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0460"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; NERD
FT                   domain protein; KEGG: gsu:GSU0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66310"
FT                   /db_xref="GOA:D5SQ58"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ58"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADG66310.1"
FT                   /translation="MKLWISRWGLRLSACRWCVAFWQRSPHSPSSHRTLNIGEQGEARA
FT                   EKYLKELGYQILARNLRTRLGEIDLLALEGETIVFIEVKTRKSDARGRPEEAIHPRKQK
FT                   QLSRVAMALLKSKGWLHRQSRIDVITITGEPESPDCELRHYRHAFPSVL"
FT   gene            complement(579779..580183)
FT                   /locus_tag="Plim_0461"
FT   CDS_pept        complement(579779..580183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66311"
FT                   /db_xref="GOA:D5SQ59"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66311.1"
FT                   /translation="MLEFSRAVNECLIVGDDTIIRVIEIQPAFVRLEILQTRQPETRRI
FT                   ETLWLNPEDDSTNESSTEDVPFGDSSTGETFFTQPHLSAGSNHYSSTTDEDELDDGFLD
FT                   FSDLVNWKPQEGREEDDSRFDLETDLLPLR"
FT   gene            complement(580597..587841)
FT                   /locus_tag="Plim_0462"
FT   CDS_pept        complement(580597..587841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0462"
FT                   /product="polyketide-type polyunsaturated fatty acid
FT                   synthase PfaA"
FT                   /note="TIGRFAM: polyketide-type polyunsaturated fatty acid
FT                   synthase PfaA; PFAM: Beta-ketoacyl synthase; KR domain
FT                   protein; Acyl transferase; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: gur:Gura_2012
FT                   erythronolide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66312"
FT                   /db_xref="GOA:D5SQ60"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004432"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ60"
FT                   /inference="protein motif:TFAM:TIGR02813"
FT                   /protein_id="ADG66312.1"
FT                   /translation="MTGMAPSTMSQLATTPQQHGSAPEPIAVIGLSCLFPEAASAEEFW
FT                   SNIRRGVDCIREIPETHWNVDDYFHADPKSPDRTYARRGGFLKAVDFDPLEFGISPNNL
FT                   EAIDTSQLLGLVAAKRALENAGYGQERVFNRSRVSCILGVTGTLEMVIPLGARLGHPHW
FT                   KRALEEAGVAPSVAQDVIERISAAYVPWQENSFPGLLGNVVAGRIANKLDLWGTNCVVD
FT                   AACASSLSALHLALLELQAGRSDMVLTGGVDTFNDIFMYMCFSKTPALSPTGDARPFSQ
FT                   NSDGTMLGEGVGLMVLKRLADAKRDGDRVLGVIRSVGTSSDGKGTAVYAPKAEGQIRCL
FT                   EDAYQQAGISPHEIDLVEAHGTGTKVGDATEIKGLTTIFEAAARTVAGEAKSAWCAVGS
FT                   VKSQVGHTKAAAGIASLIKVLLALHHEVLPPTIKVDQPADALRSNSGDRQSPFYVNIQS
FT                   RPWLPGLNRKRRAGVSAFGFGGSNFHCVMEEAPAECRPPRQPGWDGQIQLLTFSGPDDD
FT                   QLIRTIHEFLAQARRSPKTVRQLASQLRSQFRAQDLCRLAMVADLSSTDWPTPATRAIE
FT                   QIGRTRQSPLEAPVQWTLPEGVAYSRGFASGSIGLLFPGQGSQYPGMLRDLACLFPEMR
FT                   DVLAAANHAFADAPRTGNRAFSWTLSDAIYPVNVWNDEARALATTQLKATDVAQPALGA
FT                   VSLGGWRVLQRFGIRPTAVAGHSYGELTALCAAGRFSPEELYRLSMLRGQLMAEGELQP
FT                   GGMLAIHASSEVVEQALRELNLELVIANHNSPSQVVISGRLDQIARAGELLGQRNLRGK
FT                   QLAVAAAFHSPLVAQAAHKFRPALEQIPFHGGSIPVYANSSAKVYPQEADAARELLASQ
FT                   LARPVHFLDEIRAMYQSGVRTFIEVGPGHVLTGLVSSILSGQPHQALALDSSQGRRRGE
FT                   WDLAWLLGQLAVSGHDLQLAHWDAPTLWSNHHLPEPREGTIPICGANYTKPKPPLPVKT
FT                   KLAEPVQIPATSSELPRANLTNAIGSMPQSSSDVAQQHASLTPPKSSMSPELSSHTTAS
FT                   SSTGASAKSSEFSLNSMEDRFVTNSITNTAQINQTQPLTHPVQIKDSSPVASYLETLQA
FT                   IQQQTALAHQTFLAQQQQALQLLTQLIQHVPAASPNGSMTSPATQALAAPLPPAMPPIV
FT                   TPAVPATTILAIPPVAVLPPAPPMITPAQPVVSAVVPAAVPVTVPAPVPVMAPPAGKTN
FT                   SELAASLLEVVSEKTGYPKEMLQLRMSLDHDLGIDSIKRVEILSAMQERFPNLPAVSPE
FT                   QLGSLQTLADVVAAYPQSTTGTAPAVAKIPQELTAPVPTSSRSQTSSVSESSGLAASLL
FT                   EVVAEKTGYPKEMLQLRMSLDHDLGIDSIKRVEILSAMQERFPNLPVVSPEQLGSLQTL
FT                   ADVVAAYPGEPVPSAGIAASSGVIQSSASPSVSMPAASHGTNGSNGHSGGSDLANALLQ
FT                   VVAEKTGYPKEMLQLRMSLDHDLGIDSIKRVEILSAMQERFPNLPVVSPEQLGSLQTLA
FT                   DVVAAYPETTAAGIPVSTYELKKNTSSDALGSFGLIVESTHKENELPPTAIAGSTQAMP
FT                   REVRFPEPHTLQRGLLKTVALAPASERRTKDVFRHEVWITDDGLGESGLSRALASALIN
FT                   EGITSRIVPQTATIQGASVVSVPDVLSGLILLPSTAAQDPLTNLWQNLEWLQQVSSALR
FT                   KDVVAGERRLLGGVVRLNGHFGVLDSNAPRHIVAPESGGLTGLIKTARHEWPEVTARVF
FT                   DIGQLSHTEAVPQLVEELLATGPLETGIAQFPGGSPVEVQVEWNTLDVQGATAQANPVL
FT                   STGDLVVVSGGARGVTMEAALEFGKALGTTMVLLGRTPPPELSATTSENDRPLTEIEFR
FT                   QQIMSENPVGWTPRMVADEARQRLAQQELRTNLDRFAKAGVRAVYQRVDVSNPSSVRHA
FT                   LAEIVATMGPIRGLIHGAGVIADARIERKTREQFDDVMRVKVQGLKHLLAAIDPSQLRM
FT                   LGLFSSFTGRYGRTGQADYAIANEILNKQARGWAAQHPECHVTSWNWGPWDGGMVNDQL
FT                   RAIFSKEQVGLIPLREGASIFASEYCQSSERPVEIVVLAPVQPTAAATLVESQTPIEKT
FT                   KPVVASRQGFDRLLSVNDHPFLDDHVIGGKAVLPLAMMLEWMAHGAAHLSPGMALSGFE
FT                   NVKVMKGVRLSSHELAHLKVQLEPLAEADSPRHTSGWVQPWQARLTSEAAGRTLLHATA
FT                   DVIMTGQTIDQTPVTTTNELRGDSFDRSILPADLYQEWLFHGPLMQGIEQVLTCNERQL
FT                   SVISRVAEAPRLWMHKPHRHSWLIDPLVLDVIFQMAIVWAWQQRGMPSLPTGIRRIEIL
FT                   QRKWPAEGVIITCRIQKTTAHVVSMDVEILNRQGQTLARLEGVDSLMDASLKPAFAARR
FT                   LSPGQLLNR"
FT   gene            complement(587912..589540)
FT                   /locus_tag="Plim_0463"
FT   CDS_pept        complement(587912..589540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0463"
FT                   /product="PfaD family protein"
FT                   /note="TIGRFAM: PfaD family protein; PFAM: 2-nitropropane
FT                   dioxygenase NPD; KEGG: glo:Glov_2266 PfaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66313"
FT                   /db_xref="GOA:D5SQ61"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014179"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ61"
FT                   /inference="protein motif:TFAM:TIGR02814"
FT                   /protein_id="ADG66313.1"
FT                   /translation="MTTTSAGPRPSAGNHSATWASPREPQAVAQLLGRLNWPLSVTALE
FT                   PESAPHDYCIEPWHGSAKGHLLGIIPALHPHQLGSAAFRQYHGVKYAYMSGAMAAGIGS
FT                   ESIVEEMAQSGMLGIFGAAGLSPERVEQALTRLEQNCAGKPWGANLIHSPSEPRLEAAV
FT                   TDLYLRRNVRLVEASAFLDLTPNIIRYRLSGVHQRGHEIVVPNRVVAKVSRVEVATKFM
FT                   SPAPPKLVAHMVSTGVLTEEQGRLAAYIPVAQDVTAEADSGGHTDNRPLVSLLPSLIAL
FT                   RDRLQDEFKFAEPVRVGAAGGIATPQSTAAAYLMGAAYVMVGSVHQACVESGTSDVVRK
FT                   LLAEAQQADCIMAPAADMFEMGVKLQVLRRGTMFAMRAAKLHELYRTYASVDDIPVAER
FT                   QQIEKTMFQTTLDHVWQQTVEFFTKRDPRQLERAEKEPKHKMALIFRWYLGQSSRWANQ
FT                   GLPERRLDYQIWCGPSMGAFNEWTKGTFLAEPAARKVSTVALNLLYGAAYVQRANALQW
FT                   TGFPVHPDWQRVVPQERQTLLDLIN"
FT   gene            590076..590531
FT                   /locus_tag="Plim_0464"
FT   CDS_pept        590076..590531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66314"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66314.1"
FT                   /translation="MTWRTFWANAFAIPRKPPLSAEDRALSAWVAQELKRRNLDVPAIL
FT                   VVESCQPLAGIAAQLMIFLEPSLSLFMRPVDIGRFREFIEKEGALDDLVGRLQGQPAVE
FT                   VGDSKSKDQTEANSEPSRLPETSSISDSINSSGDSPSAVSDATTERP"
FT   gene            complement(590540..590782)
FT                   /pseudo
FT                   /locus_tag="Plim_0465"
FT   gene            complement(590987..592108)
FT                   /locus_tag="Plim_0466"
FT   CDS_pept        complement(590987..592108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0466"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /EC_number="2.3.1.74"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: pin:Ping_0256 naringenin-chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66315"
FT                   /db_xref="GOA:D5SQ63"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ63"
FT                   /inference="protein motif:PRIAM:2.3.1.74"
FT                   /protein_id="ADG66315.1"
FT                   /translation="MAMLISGIGTAAPASRIPQMDAYSAMSNTCCDSDEHRRVMEMIYQ
FT                   GSGVKHRGSVLVGAEPEDFIRADDRDEFFFYERENEEDYGPSTQERMRQYEQHALPLAI
FT                   KSSVAALRDAGQDAREITHIVTVSCSGFNSPGVDMGLIEELGLNRNTSRTHVGFMGCHG
FT                   SFNGLRVAHGYTASDPDAVVLMCSVELCSLHHHYGWTTDKVIANALFADGSGAVICRSS
FT                   KIEDRKPAYQLIRSGSFLVPNTKFAMSWRIGNHGFEMTLSQKVPALIEENLVSWLTPFL
FT                   AREGLTIKDIAGWAIHPGGPRILDSCLAALSLSNSHVAPAREVLEKHGNMSSSTILFVL
FT                   DRMREERINGPVVALGFGPGLAIEAMLLKAENI"
FT   gene            complement(592403..592534)
FT                   /locus_tag="Plim_0467"
FT   CDS_pept        complement(592403..592534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66316"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66316.1"
FT                   /translation="MFQTFKLKNMHLRPLSTFCDCVDLCSTGIYLFAGASHYAGCAM"
FT   gene            592658..593317
FT                   /locus_tag="Plim_0468"
FT   CDS_pept        592658..593317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0468"
FT                   /product="Transcriptional regulator TetR"
FT                   /note="PFAM: Transcriptional regulator TetR; regulatory
FT                   protein TetR; KEGG: sfu:Sfum_3173 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66317"
FT                   /db_xref="GOA:D5SQ65"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ65"
FT                   /inference="protein motif:PFAM:PF09209"
FT                   /protein_id="ADG66317.1"
FT                   /translation="MPPSSDDTRTRLVEAAGLMFADKGFDAAGVREICHEAKANVAAIK
FT                   YYFGDKRSLYKAVLEHVHVCKENLGQVMASEEWQAQTPLQQLKSFILEMVKEHLASQKP
FT                   AWHLEIMLWEMTRPTPEGKEVIELQLRPMATHLKKILMQIVGDDIPEETIWKCGFSIVG
FT                   QVLFYYVHQAIARQLAGDTIYNQLTVEQIASHIYRFSVAGLATVANRPELVTQIDS"
FT   gene            593386..594546
FT                   /locus_tag="Plim_0469"
FT   CDS_pept        593386..594546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0469"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bid:Bind_2114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66318"
FT                   /db_xref="GOA:D5SQ66"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ66"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG66318.1"
FT                   /translation="MNWVAWKMLNGDPVKYLGTVFGVGFGVLLIAQQCSIFVGIILRTA
FT                   NPIADVREAQIWVMDPYLQNADEIKPLSDSDLYRIRGVEGVDWAVKIYKGLARAKIETG
FT                   NFRQVILMGVDDQSLIGAPVKMIEGDIRDLKRPDAIVMDQYGYKYLWPNEPFQVGREVE
FT                   MNDRRAVIVGICDVSAPFQSFPVVFTRYSQAVQFVASERQQLSFVVAAPRQGYQVDEVC
FT                   RLINEQTRSIGEKSGLIAMPYREFVWINIKYYLENTGIPVNFGITITLGFIVGTAIAGQ
FT                   TFYLFTIENLKQFGALKAMGVTNWGIVGMICLQASVVGVIGLSIGLGLTALFFVATTRL
FT                   LPDLRGLHLMWEIAGGTCLAVTLIICLASALSLRKVLTLEPAVVFR"
FT   gene            594709..595503
FT                   /locus_tag="Plim_0470"
FT   CDS_pept        594709..595503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0470"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0166 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66319"
FT                   /db_xref="GOA:D5SQ67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG66319.1"
FT                   /translation="MNTLLMPESSINTQSPLKVGVACVKLVKEFGDGANRNRVLHELDI
FT                   DFYSNQLTLLVGPSGCGKTTLISIIAGLLFPTSGDVELFGTPQSRLKGGKLVRFRAQNV
FT                   GFVFQQYNLLPALTATENVCVPLLIQGVPRPRALIKAKEMLDRVGLSPRAGAYPRELSG
FT                   GQQQRVAIARALVHEPRLLVCDEPTAALDGNSGRTVMQLIREVSVQPGRVVIVVTHDSR
FT                   VYSYGDRMIEMSDGRVTNISNSPSSSMTDSQVISQFKTKETH"
FT   gene            595503..596747
FT                   /locus_tag="Plim_0471"
FT   CDS_pept        595503..596747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0471"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein;
FT                   biotin/lipoyl attachment domain-containing protein; KEGG:
FT                   dvm:DvMF_1628 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66320"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ68"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADG66320.1"
FT                   /translation="MRRWILPVLAAVALAFSLVHMSLENVRPPAQFPPVEPARSPYRQV
FT                   VAGSGLIEAKSENISVAAETAGVVTEIAVRVGQSVEKGQVLFRLDDRKQRSELGVQTAA
FT                   LLSAKAELERLKALPRPEDLPPSAAKLAEAREDLELQRDQLNRAEELVAKRVIQQEELV
FT                   QRKQAYSMARARLENAEAQDQKLRAGAWSYEIDVQKAAVLRAEQQVAQAQTEIDRLVVK
FT                   SPINGVVLKVDLRPGEFVGAPPGQPLIIMGDLSTLHVRVDIDEQDIPRFRPGLPAKGFL
FT                   RGDAKFPIDLSFVRVEPYTQPKKSLTGDSKERVDTRVLQVIYAIDPNWRSKGKSPSKTE
FT                   NTTPVPSAGQPATHPLENEILAADEPVEIYVGQQIDVFIDIEEKPSAAQPEKTSQARRK
FT                   PVSSERMVALSEVAP"
FT   sig_peptide     595503..595577
FT                   /locus_tag="Plim_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.587 at
FT                   residue 25"
FT   gene            597053..601336
FT                   /locus_tag="Plim_0472"
FT   CDS_pept        597053..601336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0472"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: glo:Glov_1340 DNA-directed RNA polymerase,
FT                   beta' subunit; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 5; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66321"
FT                   /db_xref="GOA:D5SQ69"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ69"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADG66321.1"
FT                   /translation="MSTGETSYDRVNEFSSIKINLASPHDIRSWSFGEVKKPETINYRT
FT                   YRPERDGLFCERIFGPEKDWECACGKYRGMKYKGMICDRCGVKVTHSRVRRKRMGHIEL
FT                   AAPVVHIWFFKSMPSRLGALLSVKTTSLEKVIYFQDYLVIDPGDTTLKRGQLLTEEEYR
FT                   QAKTKFGEGSFDADMGADAIKKMLLDLNLVEISQQLRVELKKTNSQQKKKELIKRLKIV
FT                   ESLRDSDNRPEWMVLDCVPVIPPDLRPLVLLDSGNFATSDLNDLYRRIINRNNRLKKLV
FT                   DLNAPEVIVRNEKRMLQQSVDALFDNNRCKRPVLGSSNRPLKSLTDMIKGKQGRFRENL
FT                   LGKRVDYSARSVIVVGPTLKLHQCGLPKKIALELYQPFIIRRLKELGHADTIKSAKRML
FT                   ERRDEEVWDILEEVITNHPVLLNRAPTLHRIGIQAFEPQLVEGNAIRIHPLVCRGFNAD
FT                   FDGDQMAVHLPLSIEAQVEAHTLMMSTHNIFSPSNGAPIISPSQDIVMGCYYVTMKKPG
FT                   LIGDGMTFSSTQEVYTAFQHGKVRLHTSIRVRLPKDKRVKGEGADTYKKGGLVETSVGR
FT                   VVFNDMISPKMAFYNYTMKGRDLAGVISDCYLEMGRRETIALLDRMKETGFRESTRSGL
FT                   SFAASDLKTPPNKDKVISEAEAHVLKFQKNYEKGVITAKERYEQTLDRWTQAREAITVS
FT                   MMDEFKNDVRDEGRYVNPIFLMADSGARGGVEQIRQLAGMRGLMAKPSGEIIETPIKAN
FT                   FREGLTVLEYFSSTHGARKGLADTALKTADSGYLTRKLADICQNLVITMRDCGTTKGIT
FT                   RGVIYRGEKVEVGLADAIRGRVSRTNIVNPVTDEVVVREDELITIEIARKIEAMGLEKI
FT                   QVRSPMTCEAGLGICQLCYGMDLSTGALVEEGLAVGTIAAQSIGEPGTQLTMRTFHVGG
FT                   TASRDVEDSEIKCRKGGRVRFARVRSVVNADGKAVVLGRNGEVTVVDSKDRELEKYTIP
FT                   NGATLQVAENEVIEAGQILCSWDPHSVPILCEVGGKVRFEDLIEGQTVRSETDRMGNIR
FT                   KTIIEHKGDRHPQIVLEDSAGKILDFYYLPERATVEVLEGQQVAAGSILAKNPRESMGT
FT                   QDITGGLPRVTELFEARKPKEPAIISEIDGEVELVAEKKRGKRIIKVKGVDGTEREHII
FT                   PHGKQLLVHSGEQVKAGDALVRGPLVPHDILAVSGEEAVHAYLLHEIQNVYRSQRVVID
FT                   DKHIELVVAQMLRKVRVDDVGDTTLLPGVLIDRFEFRKINQKLQQCGRVTDPGDSEFHK
FT                   DDIVPLETIAQVNEEIEASGGQPIATAKPRPASASTQLLGITKAAVQSESFLSAASFQE
FT                   TTKVLTEAAIAGKSDYLVGLKENVILGHLIPAGTGFKLHQKSEVRIRPEALAELTAERD
FT                   RILAARANLLNEPEISPNSGLGRLE"
FT   gene            601658..602029
FT                   /locus_tag="Plim_0473"
FT   CDS_pept        601658..602029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0473"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: mmr:Mmar10_1800 30S ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66322"
FT                   /db_xref="GOA:D5SQ70"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ70"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADG66322.1"
FT                   /translation="MPTINQLVRKPRVKQPNRTKSPVLEACPQKRGVCLMVKTMTPKKP
FT                   NSALRKIARVRLSNGKEITAYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYKIIRGVLDT
FT                   LGVNNRKQARSRYGTKRPK"
FT   gene            602159..602632
FT                   /locus_tag="Plim_0474"
FT   CDS_pept        602159..602632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0474"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: mgm:Mmc1_0843 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66323"
FT                   /db_xref="GOA:D5SQ71"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ71"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADG66323.1"
FT                   /translation="MASKFTASADQLKPDTRYGSRLASKFINCLMHDGKKSVAEGVFYD
FT                   ALDIIAEKIPDRSPIEIFTTAVDNCRPNVEVRSRRVGGANYQVPTQVKPKRQQTLAIRW
FT                   ILAACRGKKGRPMHRKLAEEFMAAFRREGAAVTYRENVHRMADANKAFAHFAN"
FT   gene            602864..604939
FT                   /locus_tag="Plim_0475"
FT   CDS_pept        602864..604939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0475"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: wbm:Wbm0344 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66324"
FT                   /db_xref="GOA:D5SQ72"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ72"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADG66324.1"
FT                   /translation="MIRDISSIRNIGIIAHIDAGKTTTTERILFYAGEIHNPGNVDDGN
FT                   TVTDFDPEEAQRGITIYSAAISCSWRGCSINIIDTPGHVDFTAEVQRSLRVLDGGVVVF
FT                   SAVEGVEAQSETVWRQADGFKVPRICFINKLDRIGANFERVIGQITERLQGVPLVLSIP
FT                   IGSGPATNSDGFTGIVDLLRMEAVYFDKESKGREIRREPIPAACQDLADDYRVRLIESV
FT                   AMLDDDVFAVYDETGDIPLADLNRLIRQGTITGQFQPLLCGASLDYIGVQPILDAVVDY
FT                   LPSPLDVPPVEGRHPKKENIEVRKPNENEPFAGLVFKVQVDEHSELYFVRVYSGVLKSR
FT                   SRMLNPRTGEKELISQLWKMQADSRVKLDEAGAGDIVGVVGPKSSVTGDTLCEANQPIL
FT                   LESITFPETVISMAIEPETSADRKKLEETLKLLAKQDPTFRAKVSEETGQTIVSGMGEL
FT                   HLEIISKRMERDFHLKMRIHKPRVTYRETICKAVEFEEVFERQAGATSLYALIKLRAEP
FT                   LEGAQSVVVENKMKPGAFPAELTQVLIQAMNDESKSGGTVGYPLMNMKLQVLGAGFREG
FT                   ETNEIAVRAAASSAVRRVLDEAGVMLLEPVMKLEVVTPNDFVGNVTADLNSRRASILNT
FT                   GLRGNLVVIEAEVPLSGMFGYSTQVRSLSQGRASYSMEPLRFAPAPDSVLKTMLGE"
FT   gene            605113..605439
FT                   /locus_tag="Plim_0476"
FT   CDS_pept        605113..605439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0476"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: mmr:Mmar10_1796 SSU ribosomal protein
FT                   S10P"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66325"
FT                   /db_xref="GOA:D5SQ73"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ73"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADG66325.1"
FT                   /translation="MVGQKQEKIRIRMEAYDHSVLDLSASEIVDTAKRTGAIVHGPIPL
FT                   PTRIERYTVLRSPHIDRKSREQFEIRTHKRLIDIIQPTGKTIDALNKLSLPAGVDVKIK
FT                   ATAS"
FT   gene            605519..606256
FT                   /locus_tag="Plim_0477"
FT   CDS_pept        605519..606256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0477"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: dsh:Dshi_0276
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66326"
FT                   /db_xref="GOA:D5SQ74"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ74"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ADG66326.1"
FT                   /translation="MAMNSPLGFKVFGMSCGLLGRKVGMTQVFTPQGEAIPVTVIECGP
FT                   CVVLQIRTVERDGYSAVQLGFSDKPRRLASRSERGHVAAIDSKRRKSLAAAGVALAEKA
FT                   DCEPKRFVREFRVTPEEASAFTVGQVLTVSQIFGEVKHVDVVGTSKGRGFAGVMKRHNF
FT                   HGTCASHGVKKVHRSGGSTGQSTDPGKVFKGTKMPGHYGDAQVTVRRLQVVRADDENNV
FT                   LLVRGAVPGYSGGFVRVRKTNCK"
FT   gene            606327..606956
FT                   /locus_tag="Plim_0478"
FT   CDS_pept        606327..606956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0478"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: bha:BH0135 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66327"
FT                   /db_xref="GOA:D5SQ75"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ75"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADG66327.1"
FT                   /translation="MISLPIHTSTGEATGRNYEFDPAELADSINKQLLHDAVVMYQANL
FT                   RQGTFKSKSRAEIAGSKQKLFKQKGTGRARQGNKRQPVRRGGGHAFAKRPTDFSYRLPR
FT                   KALQLATRMALLGKFQDNEVTIIESLALEAPKTKVVASLLNKLGLESKGCLISIPSHDS
FT                   NVWKSARNIPKVGVSPAAGLNAYQLLLRKQLVVTTDALDLLRKPAQ"
FT   gene            607022..607330
FT                   /locus_tag="Plim_0479"
FT   CDS_pept        607022..607330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0479"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pmy:Pmen_3907
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66328"
FT                   /db_xref="GOA:D5SQ76"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ76"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADG66328.1"
FT                   /translation="MAIVPKSGVVLESYQVILKPLITEKGTYLSSKRNAYTFQVNPLAT
FT                   KFDIKKAVEELFSVKVEKVRTQNRVGKPRRHRMKLGYRSAWKKAIVTLNNDDRIAFF"
FT   gene            607419..608279
FT                   /locus_tag="Plim_0480"
FT   CDS_pept        607419..608279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0480"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: dvl:Dvul_1762 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66329"
FT                   /db_xref="GOA:D5SQ77"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ77"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADG66329.1"
FT                   /translation="MGVRFYKPTSAGRRGGMVSDFSEITDRKKKPEKSLVVPYKKTGGR
FT                   NFQGKITSRHIGGGHKKMYRLIDFKRNKDNVTGVVTHIEYDPNRTCRIALVQYEDGEKR
FT                   YILAPEGLAAGSKIMSANDGLEPIVGNCMPLEKIPTGTSVHNVELQPGRGGQLCRSAGV
FT                   SAVVNARESGWAQITLPSGEVRRVPSSCRATIGVLGNGEHMNIVIGKAGRVRWMGKRPY
FT                   VRGSAMNPIAHPMGGGEGRRSGGRHPVSPTGKLAKGGRTRNPRKTSRNAIVRRRKSVRY
FT                   GQLKL"
FT   gene            608343..608612
FT                   /locus_tag="Plim_0481"
FT   CDS_pept        608343..608612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0481"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: lch:Lcho_3995 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66330"
FT                   /db_xref="GOA:D5SQ78"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ78"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADG66330.1"
FT                   /translation="MSRSSKKGPYVDEKLLKKIEKLVVAGKKEPIKTWARRSTISPEFV
FT                   GHTFLVHNGKQHLSVYVTEEMVGHKLGEFSLTRIFRGHGGKGNK"
FT   gene            608659..609012
FT                   /locus_tag="Plim_0482"
FT   CDS_pept        608659..609012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0482"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: dps:DP1129 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66331"
FT                   /db_xref="GOA:D5SQ79"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ79"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADG66331.1"
FT                   /translation="MRYQAVHKFARIAPTKVRHLADLIRGQFAGQGLTTLRYMPHRGAR
FT                   MLEKVLSSAIANAEDRGERVPESLRIIECKVDGGPMFKRIQPHARGMGFVIRKRFSHIT
FT                   IAIGSIESPVAGQ"
FT   gene            609141..609842
FT                   /locus_tag="Plim_0483"
FT   CDS_pept        609141..609842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0483"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: aeh:Mlg_0464 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein S3-
FT                   domain protein; KH type 2 domain protein; Ribosomal protein
FT                   S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66332"
FT                   /db_xref="GOA:D5SQ80"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ80"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADG66332.1"
FT                   /translation="MGQKVRPTGFRVGIVEDWRSRWYATKKEFGDLLIEDQKIRRFIKT
FT                   KYEFAGIPRIEIERTRDQVIVHLHTARPGIIIGKKGQEVDRLKAELEDLTGRRMELKIV
FT                   EIHQPHRSAVLVAEDIAQQLVKRGSFRRVMKRSLDQVMESGVEGIKIEMNGRLGGAEMS
FT                   RTEKAIRGSIPLSTLQKHIDYGLAIAKTTMGVIGVKVWIDLGEYRNEEESYGADAQAGQ
FT                   APQRAKRSRKR"
FT   gene            609781..610200
FT                   /locus_tag="Plim_0484"
FT   CDS_pept        609781..610200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0484"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: aba:Acid345_1233 50S ribosomal protein
FT                   L16"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66333"
FT                   /db_xref="GOA:D5SQ81"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ81"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADG66333.1"
FT                   /translation="MALMPKRVKHRKEQRGRVKGNATRGIEVSFGDWGLQVLEPGHIRG
FT                   TTIEACRIAATQYVRGEGKLYIRIFPNKPVTARPLETRMGTGKGEPDHWVAVVRPGKIL
FT                   FELAGVSEEAARECFARVAYKLPLKVRLVGRTIKV"
FT   gene            610250..610459
FT                   /locus_tag="Plim_0485"
FT   CDS_pept        610250..610459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0485"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: rce:RC1_0719 ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66334"
FT                   /db_xref="GOA:D5SQ82"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ82"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADG66334.1"
FT                   /translation="MQIMTSARNLREMSAEQLQFQLDEAQKALFDLRCKAASEKLETPS
FT                   LVRRARREIARIKTVLRLQELAKV"
FT   gene            610495..610758
FT                   /locus_tag="Plim_0486"
FT   CDS_pept        610495..610758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0486"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: lpc:LPC_3004 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66335"
FT                   /db_xref="GOA:D5SQ83"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ83"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ADG66335.1"
FT                   /translation="MRKTVIGVVTGDKASKTRRVEVERIFKHPKYGKTVRRRTVCHAHD
FT                   ENNVSRLGDTVEIIESRPMSALKRWALVSVVKTALPTSSDAS"
FT   gene            610821..611189
FT                   /locus_tag="Plim_0487"
FT   CDS_pept        610821..611189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0487"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bja:bll5390 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66336"
FT                   /db_xref="GOA:D5SQ84"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ84"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADG66336.1"
FT                   /translation="MIQMQTMLDVADNTGAKTARCIKVLGSSRKRTATLGDVIVLAVQK
FT                   ALPGSSVKSGSVVKGVVVRVRQPSRRVDGSYVRFDSNAVVIVDNDGNPKGSRIFGAVAR
FT                   ELREKRYMKIISLASEVV"
FT   gene            611191..611547
FT                   /locus_tag="Plim_0488"
FT   CDS_pept        611191..611547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0488"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; KEGG: dvm:DvMF_0090
FT                   ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66337"
FT                   /db_xref="GOA:D5SQ85"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ85"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADG66337.1"
FT                   /translation="MRIRKGDMVVVLTGDDASATPRKVLSVVQSGDKVVVEGVNRVFKH
FT                   VRRGHPKSQQGGRLSREMPVSSSNVAYYCSACGKPTRIGMRLLADGRKERFCKKCDASI
FT                   GVISPAPKSASVPG"
FT   gene            611611..612153
FT                   /locus_tag="Plim_0489"
FT   CDS_pept        611611..612153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0489"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: afw:Anae109_1923
FT                   50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66338"
FT                   /db_xref="GOA:D5SQ86"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ86"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ADG66338.1"
FT                   /translation="MARLMERYRSEILPSLKSELGRENELSLPKLTKVVVSMGLGKAIG
FT                   ERKRLEEAAQHLASITGQKPLITKSRKAVSGFRLREGMEIGCMVTLRGRRMYEFLDRLI
FT                   SLALPRVRDFRGVNPNGFDGHGNYSMGLTEQLVFPEVNPDKVNFVQGMNITMVTTARNN
FT                   DEGRLLLKKLGIPFRKD"
FT   gene            612203..612388
FT                   /locus_tag="Plim_0490"
FT   CDS_pept        612203..612388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0490"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: aba:Acid345_1239
FT                   SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66339"
FT                   /db_xref="GOA:D5SQ87"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ87"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADG66339.1"
FT                   /translation="MATSAHVAKAKRTPKFSTRSENRCQLCGRPRAVYRKFKICRICFR
FT                   NLALDGLIPGCKKASW"
FT   gene            612425..612820
FT                   /locus_tag="Plim_0491"
FT   CDS_pept        612425..612820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0491"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bha:BH0148 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66340"
FT                   /db_xref="GOA:D5SQ88"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ88"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADG66340.1"
FT                   /translation="MMTDPVADMLTRIRNAVACERPFVDIPYSREKAAIAAVLQREGYV
FT                   WESEVIEGQPRSTLRISLKYGPSGERVVQQIKRISKPGCRVYAGVDDLPNVLQGLGIAI
FT                   VSTSKGVLSNREARKQRLGGEVICTVW"
FT   gene            612908..613444
FT                   /locus_tag="Plim_0492"
FT   CDS_pept        612908..613444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0492"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: msl:Msil_0565
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66341"
FT                   /db_xref="GOA:D5SQ89"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ89"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ADG66341.1"
FT                   /translation="MSRIGKKPVAIPAGVTVQVAGDKLSVKGKVGELSLTVHPKITVRV
FT                   DAGQVLVERPDDTRESRALHGLTRALVNNMVVGVDKPWEKKLEIQGVGYQAALAGKTLT
FT                   LQVGFANAIKLDVPTGVSCVLADPTHITVSGADRQAVGQFAANIRRVRPPEPYKGKGVR
FT                   YSDERVRRKSGKAMS"
FT   gene            613519..613881
FT                   /locus_tag="Plim_0493"
FT   CDS_pept        613519..613881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0493"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: rru:Rru_A2672 50S ribosomal protein
FT                   L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66342"
FT                   /db_xref="GOA:D5SQ90"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ90"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADG66342.1"
FT                   /translation="MKLIKRAAKQKERRGFRVQNRVRSSGRLRLTVFRSNKHIYAQIVD
FT                   DVAGQTLVSASTVEKSVLPEGHGSDCAAAAAVGKALASRAKEKGIVEIAFDRGSYRYHG
FT                   RLAALADAAREAGLSF"
FT   gene            613969..614448
FT                   /locus_tag="Plim_0494"
FT   CDS_pept        613969..614448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0494"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5; ribosomal protein S5 domain protein; KEGG:
FT                   gbm:Gbem_0950 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66343"
FT                   /db_xref="GOA:D5SQ91"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ91"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADG66343.1"
FT                   /translation="MSSENQNSSPERVVQIRRCSCVVKGGRRFSFTALVVVGDGNGRIG
FT                   YGYGKAVEVPLAVEKAVKQANKRMVRVPLVDGTIPHQVIGNYGTSQVMFMPANPGTGII
FT                   AGSSLRAIAESLGMRDILTKVRGSSNPLNAVKAAFAALEKLRTREDVARLRGVKI"
FT   gene            614451..614900
FT                   /locus_tag="Plim_0495"
FT   CDS_pept        614451..614900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0495"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: pca:Pcar_0720 ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66344"
FT                   /db_xref="GOA:D5SQ92"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ92"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADG66344.1"
FT                   /translation="MMLHDVNIGINGHKTRKRVGRGPGSGHGKTSGRGHKGAGSRSGTK
FT                   RRLGFEGGQKPLMRRIAKRGFSNNFFALKIAEVNLSAIEKAFEVGEVVTPEQLSVRGLA
FT                   KGRFDQVKILGDGDLTKSLSVTAHRFSASAEEKILAAGGSTVKLV"
FT   gene            615058..616428
FT                   /locus_tag="Plim_0496"
FT   CDS_pept        615058..616428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0496"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: afw:Anae109_1931 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66345"
FT                   /db_xref="GOA:D5SQ93"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ93"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADG66345.1"
FT                   /translation="MFSQLAMIFRIPELRQKILLTLVLLAVYRMGGLIPLPFIDQMKLA
FT                   ETLQSQGSDGMGRVMSMISLFSGTSIGMSTIFGLGIMPYISASIIFQLLGTVYPPLEKL
FT                   QKEGEAGRKKINEYTRIATVFIAFGQSFFWIRQLAVSGGIMGNEGSLLIAAYSGVFFQL
FT                   ICTLTMTAGTLLLMWIGEQIDEYGIGNGISLIIMAGILARMPQAGQALLEPAFQNGVKL
FT                   GSQTGIEKFLLLGILFVGVIVGVVAITQAQRKIPVQSAKHVRGRSVAGGQRSYLPLRLN
FT                   QSGVMPIIFASSLLLFPMFLFQILSQFFPTVGFFRLAEATMQNHGGFIYNILYIGLIYF
FT                   FCYFWTAITFNPKDMANNLKDYGSFIPGYRPGGRTAAYLEAVMVRVTFVGAAFLSLISI
FT                   IPTVISNALGIDPLVASFYGGTGLLICVSVALDLVQKIDSHLVMRNYRGLLESDNAA"
FT   gene            616868..617254
FT                   /locus_tag="Plim_0497"
FT   CDS_pept        616868..617254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0497"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: gdi:GDI3382 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66346"
FT                   /db_xref="GOA:D5SQ94"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ94"
FT                   /inference="protein motif:PFAM:PF00416"
FT                   /protein_id="ADG66346.1"
FT                   /translation="MPRIQGVDIPNDKPTYISLQYLYGVGDFRAFEICFKLEIDPQRKA
FT                   RELSDDELARISAMLDKDYLVEGSLRRSIQQNISRLRDIQSYRGLRHRRGLPCRGQRTR
FT                   TNARTRKGIKKTVAGKKGVKDMKH"
FT   gene            617356..617736
FT                   /locus_tag="Plim_0498"
FT   CDS_pept        617356..617736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0498"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bsu:BSU01420 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66347"
FT                   /db_xref="GOA:D5SQ95"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ95"
FT                   /inference="protein motif:PFAM:PF00411"
FT                   /protein_id="ADG66347.1"
FT                   /translation="MAKTKRRKIRRNVNRGIAHIRATFNNTTVTITDANGDVLCWATAG
FT                   TVGFKGSRKSTPFAAQRAAETCAERAAKFGVREMEIRVKGPGSGRESAITGLQGAGISI
FT                   RSIEDVTPLPHNGCRPPKKRRV"
FT   gene            617866..618876
FT                   /locus_tag="Plim_0499"
FT   CDS_pept        617866..618876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0499"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: gsu:GSU2831 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase insert; RNA polymerase alpha
FT                   subunit domain protein; RNA polymerase dimerisation; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66348"
FT                   /db_xref="GOA:D5SQ96"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ96"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADG66348.1"
FT                   /translation="MRIRWRGLELPSRVVPERETLSSTYGKFTVEPFERGFGSTIGNSL
FT                   RRILLSSLEGSSVTSVKIQGVQHEFTTIPGIVEDVTEIVLNLKAIIVKNHSPSTKTLRI
FT                   EKTSRGVVTAGDIITDDQVEILNRDLVIATMTDDVPLYLEMTVENGRGYIPAADHHGPE
FT                   QELGVIPLDAIFSPVVRVRYLIEETRVGQRTNYDRLILEIWTNGTVTPESALVESAKIL
FT                   RKHLNPFITYREPGPEMFPEGGLRNMLEATGYAPVDLELEEKLGQSLAELNLSVRATNC
FT                   LESEGINFVRDLVTRTEDQLLQVRNFGETTLTEVRERLGLIGLRLGMKLPNSARV"
FT   gene            618966..619583
FT                   /locus_tag="Plim_0500"
FT   CDS_pept        618966..619583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0500"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: pla:Plav_2761 ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66349"
FT                   /db_xref="GOA:D5SQ97"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ97"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADG66349.1"
FT                   /translation="MRHKVAGRQLGRNASHRHAMFRNMSVSLILTVRSEKKDGEAKVPG
FT                   RIVTTLEKAKELRPHLEKLITLAKRAQEAEKAAAPFATAAERNSEEWRAWRKSDQWQKW
FT                   SNAIAPAVALRRRAFAALRDKVALEILFDDLGPRFADRPGGYLRIVRLAEFRLGDAGRR
FT                   ALIEFVGENDRLKRQRRAAPVVRQEAPPAEVTSPEAPAADPV"
FT   gene            620017..621729
FT                   /locus_tag="Plim_0501"
FT   CDS_pept        620017..621729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0676 heat repeat-containing PBS lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66350"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66350.1"
FT                   /translation="MTLELASGNQRLDLLAIGLSSGVDRIEDACAQMLLADGSLPAQAM
FT                   LIAAAARPSVCLGEKIRANADTLSVAFRQLLIHGTPTQAIAALDAIELTETLEPVPVVI
FT                   ELLRANVPQPVLDRAENLLRSMAWKLHELTEHGSEKRLHPTLAALAARYRLPIIEALSR
FT                   ALELEVDHLELQKANVRELFIECLMIIGPDDAPEVRRVLWSSNPSVREIVRHLMMSGTH
FT                   PGILRSIIGSLGHNYPHPRALDAVQERDDPEFVVSLLMTISKPISQKLMQNLRQISSVN
FT                   WLSRESLDLSWIPGEYQAGIIHLINLTRLSRDCRRNVEEWLLRYGCSEAREVAVQSASQ
FT                   HDGDKVKEIVRSSLNSADSAVAAWACSQLKTQQFPDAARLLLEKLRCADREVREVARAE
FT                   LLEWFHAERMLEMQEAMTPEIGRHAGRLLLEIDDSALTTIELELNHAIRHRRIRALMAI
FT                   DRMELIHETQAFLFKMLTDIDPLVRRTLVDILAKLPSLDSLLALQYLTRDESLRVREAA
FT                   VVAFQRLKGSMGELNLASQLSNHVETAERPVSSTDDSGILAWANPADETRSIN"
FT   gene            621763..622017
FT                   /pseudo
FT                   /locus_tag="Plim_0502"
FT   gene            complement(622022..622729)
FT                   /locus_tag="Plim_0503"
FT   CDS_pept        complement(622022..622729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_03100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66351"
FT                   /db_xref="GOA:D5SQ99"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQ99"
FT                   /inference="similar to AA sequence:KEGG:SYN_03100"
FT                   /protein_id="ADG66351.1"
FT                   /translation="MPPLSEALTGLMGGLGLSAASGLNTYVSLITLGLAHRSGWITLAA
FT                   PYDWLGNEYLLIAITILGLIDLIGDKIPAVDHALHTVGMFLAPIASAILFASQTSSVIQ
FT                   IHPVILLAAGCLVGSTVHLSRSAIRPAVNVATAGTGTTVVSVIEDLIALLLSILAVVLP
FT                   ILAGMIAIVLLVMMSWLFFRVLGYAKVRLRQRWLRQTGDAAIHGDEPRRDQVSDIPQPA
FT                   DQDGQKLPPELHD"
FT   sig_peptide     complement(622664..622729)
FT                   /locus_tag="Plim_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.224 at
FT                   residue 22"
FT   gene            complement(622820..624886)
FT                   /locus_tag="Plim_0504"
FT   CDS_pept        complement(622820..624886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GA28568 gene product from transcript GA28568-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66352"
FT                   /db_xref="GOA:D5SQA0"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66352.1"
FT                   /translation="MPFEIICGSCQNPMMVEAEGNVVVECPECGAHLEVQSEIPVESEP
FT                   VAPVSSEAESIDSTFDFSQLGAPAKNFPGSASIPDFLSSIPQPDFSTNTTSSPMASKDF
FT                   LPPFIPAIDSPTGATSPATVNFDFLQTVPSSTEPSGPGEHHDDLQSFVFPSPHLPGMDE
FT                   LPIPSLGSIIAETVPAESLPGMPSFEPAHAVTSEPEEEVVFDFIPDSQPVIAPHSSLQE
FT                   ISESFPAVTEETLNPTLADDSYSSPAGLPGHTIATTIDPSLSNDLHTSDPETDHFSQSS
FT                   PQLAELIRQTAGVGLMTAEPAMNLTEPSMTVDVTTQGHGDSATPDFPAVATSNAPSISA
FT                   GTEINSAEDQSLAFLSNLDQPLVAAQTPETNLDVQQLSSFSQLAQPFPTGEDLTLVSTG
FT                   TTSEKRSGDKVQEGNFQFSRQPVPVGSLSAGTADAFPENPASLRKEEVVSRQLFLLLAG
FT                   YASASTLALLFFIVQYMRQPYHQLESLPDIKPPATGISVTLINPDNRVAPLHTLKLNQT
FT                   RRFGNIELTPLKVTRGPISIVQNASNSSSETTEPVLKLLVRFKNVSRDQTIIPLDRELV
FT                   FFRDRRFGSRANQFIKWADQLASDTGVINLFELPLQDEVSIANMPLGIALAPGESIETF
FT                   LPSEAGGIDELNGNLIWRLQFRKGQNPRSGYPVTTLVDVQFNSDDIEREATAS"
FT   gene            complement(624876..625013)
FT                   /locus_tag="Plim_0505"
FT   CDS_pept        complement(624876..625013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66353"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66353.1"
FT                   /translation="MEKAEAPFHSEMTLSGSRSRISLPTCLFCTEKSVFPLMESPLHAI
FT                   "
FT   gene            complement(625116..626744)
FT                   /locus_tag="Plim_0506"
FT   CDS_pept        complement(625116..626744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0506"
FT                   /product="TROVE domain protein"
FT                   /note="PFAM: TROVE domain protein; KEGG: pfl:PFL_2303
FT                   60-kDa SS-A/Ro ribonucleoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66354"
FT                   /db_xref="GOA:D5SQA2"
FT                   /db_xref="InterPro:IPR008858"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA2"
FT                   /inference="protein motif:PFAM:PF05731"
FT                   /protein_id="ADG66354.1"
FT                   /translation="MSLFASILGRLPKANAVNEAGGLAYQLEPKHALAQVAATGTFNNA
FT                   FYSTAESQLDEVLKLIDTVDDNQYLAKLALYAREKAFMKDMPAALLVALSVRDTELMHR
FT                   VFDRVVDNGRVLRTVFQMIRSGQFKNKAGKSRVGLSSSVQRAFQRWLNTASVGKLLSAS
FT                   IGNDPSLRDILRMARPTPKDNARRAMFGWLTDKSIDKWAPATEADLPVEVQSLIAYRKS
FT                   ESEEAQALIAGGLDIVRWDLLSDAARGPKVWAVLARKMGPQALRMNLNTLLRHDVLATS
FT                   AMVDYVADRIADKTEIQRSKQFPYQYFAAYLNADDNVPQKIKTALHKAAEIACGNVPEL
FT                   PGPVVIGLDTSGSMSSPVTGNRGRGATSKMRCIDVAALFAAAILRRNPASVVIPFDTSA
FT                   YDVKIDPNDSILSIAQRLAKYGGGGTDCSLPLVVANQKYARRKFAGMVLVSDNESWVGT
FT                   GRHGSTGVMTAWEAFSSNQRKLSRKAAPPKLINIDLQPYQTVQACERTDIMNIGGFSDA
FT                   VFNVISAFLADNNQRFVAEVEAIEL"
FT   gene            626838..627185
FT                   /locus_tag="Plim_0507"
FT   CDS_pept        626838..627185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66355"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA3"
FT                   /inference="similar to AA sequence:KEGG:Gura_1699"
FT                   /protein_id="ADG66355.1"
FT                   /translation="MKSDLPDRTFAFAERIVRFCMFLEQNGRVSTTLATQLLRSGTSVG
FT                   ANVEEAGASESRKDFIHKYAIACKEARESHYWLRLLAVSEVVPKDRLELLTSEANELIA
FT                   ILTTIIKKSRE"
FT   gene            complement(627713..628813)
FT                   /locus_tag="Plim_0508"
FT   CDS_pept        complement(627713..628813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0508"
FT                   /product="RNA ligase, DRB0094 family"
FT                   /note="TIGRFAM: RNA ligase, DRB0094 family; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66356"
FT                   /db_xref="GOA:D5SQA4"
FT                   /db_xref="InterPro:IPR012646"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA4"
FT                   /inference="protein motif:TFAM:TIGR02306"
FT                   /protein_id="ADG66356.1"
FT                   /translation="MTAHLPLLQISKNMRKLATIQTISAIEPITNADSIELARILGWAV
FT                   VVKRGEYRVGDKIIYCEIDSLLPERSEFEFLRSNCFKPAQIDATGRIAVPAGFRIRTIK
FT                   LRGQYSQGICFPVSLVPNGDHLPLGTEVTAELGIVKWEPPIPAGMVGKIKGPFPSFVPK
FT                   TDETRVQLLADALERHKGKELIVTEKLDGSSFTAFHYQSQFGICSRNQWIDEMDGTSKY
FT                   VAIAESFHLREKLAEMSKQLGFDLAVQGEMIGPGIQGNKYRLEFVTLRIFNVVNLTTGM
FT                   LLDFDQMQEVIKSLGLVAVPFLEKVTLNHSIDELIKLAEGKSVLNSSTLREGIVLRPIS
FT                   ETFEPDTGGRLSFKAINPAFLVKYDE"
FT   gene            complement(629223..629753)
FT                   /locus_tag="Plim_0509"
FT   CDS_pept        complement(629223..629753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_7049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66357"
FT                   /db_xref="GOA:D5SQA5"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA5"
FT                   /inference="similar to AA sequence:KEGG:MXAN_7049"
FT                   /protein_id="ADG66357.1"
FT                   /translation="MIACVDVGYQVQSALAACVTISDWKAELPQGSHTVEIPSIEDYIP
FT                   GEFYKRELPCIKAVLNQLVAKPSLIVVDGYVWLDANGKRGLGAHLFELLEGQVPVIGVA
FT                   KTSFATAKNAIEVYRGKSSRPLWITAVGTNESEAARCVSEMHGSYRTPTILALVDRLSR
FT                   SGPEPVSKSQDDA"
FT   gene            complement(630154..630228)
FT                   /locus_tag="Plim_R0013"
FT                   /note="tRNA-Arg6"
FT   tRNA            complement(630154..630228)
FT                   /locus_tag="Plim_R0013"
FT                   /product="tRNA-Arg"
FT   gene            complement(630479..630552)
FT                   /locus_tag="Plim_R0014"
FT                   /note="tRNA-Leu9"
FT   tRNA            complement(630479..630552)
FT                   /locus_tag="Plim_R0014"
FT                   /product="tRNA-Leu"
FT   gene            complement(630849..630924)
FT                   /locus_tag="Plim_R0015"
FT                   /note="tRNA-Leu8"
FT   tRNA            complement(630849..630924)
FT                   /locus_tag="Plim_R0015"
FT                   /product="tRNA-Leu"
FT   gene            complement(631004..631078)
FT                   /locus_tag="Plim_R0016"
FT                   /note="tRNA-Asp2"
FT   tRNA            complement(631004..631078)
FT                   /locus_tag="Plim_R0016"
FT                   /product="tRNA-Asp"
FT   gene            complement(631171..631243)
FT                   /locus_tag="Plim_R0017"
FT                   /note="tRNA-Val4"
FT   tRNA            complement(631171..631243)
FT                   /locus_tag="Plim_R0017"
FT                   /product="tRNA-Val"
FT   gene            complement(631583..631654)
FT                   /locus_tag="Plim_R0018"
FT                   /note="tRNA-Gln3"
FT   tRNA            complement(631583..631654)
FT                   /locus_tag="Plim_R0018"
FT                   /product="tRNA-Gln"
FT   gene            complement(631877..631954)
FT                   /locus_tag="Plim_R0019"
FT                   /note="tRNA-Asn1"
FT   tRNA            complement(631877..631954)
FT                   /locus_tag="Plim_R0019"
FT                   /product="tRNA-Asn"
FT   gene            632002..632361
FT                   /locus_tag="Plim_0510"
FT   CDS_pept        632002..632361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0510"
FT                   /product="S23 ribosomal protein"
FT                   /note="PFAM: S23 ribosomal protein; KEGG: tbd:Tbd_0653
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66358"
FT                   /db_xref="GOA:D5SQA6"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA6"
FT                   /inference="protein motif:PFAM:PF05635"
FT                   /protein_id="ADG66358.1"
FT                   /translation="MRDYHKLRAFELVDQLALEIYKCTKSFPKEEMFGLTSQIRRAAVS
FT                   VPSNIVEGCAKSSQADYSRFLEIAYGSVCEVEYQISLADRLGYLDSQSAKETASLASET
FT                   GRVLNGLLRSLRTEA"
FT   gene            complement(632387..632457)
FT                   /locus_tag="Plim_R0020"
FT                   /note="tRNA-Gly4"
FT   tRNA            complement(632387..632457)
FT                   /locus_tag="Plim_R0020"
FT                   /product="tRNA-Gly"
FT   gene            complement(632556..632628)
FT                   /locus_tag="Plim_R0021"
FT                   /note="tRNA-Lys5"
FT   tRNA            complement(632556..632628)
FT                   /locus_tag="Plim_R0021"
FT                   /product="tRNA-Lys"
FT   gene            complement(632650..632722)
FT                   /locus_tag="Plim_R0022"
FT                   /note="tRNA-Ile2"
FT   tRNA            complement(632650..632722)
FT                   /locus_tag="Plim_R0022"
FT                   /product="tRNA-Ile"
FT   gene            complement(632730..632801)
FT                   /locus_tag="Plim_R0023"
FT                   /note="tRNA-Lys4"
FT   tRNA            complement(632730..632801)
FT                   /locus_tag="Plim_R0023"
FT                   /product="tRNA-Lys"
FT   gene            complement(633874..634992)
FT                   /locus_tag="Plim_0511"
FT   CDS_pept        complement(633874..634992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66359"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66359.1"
FT                   /translation="MKPRPKEQGDELDLDALMDAMTNVVAVLILVLLLTQLNVQETIRD
FT                   VVSRSTVTEADLNSAKKELDALLEKKQSVDSRLNEFNLASEKERLARMQETLAARKKLL
FT                   ETQNKQANEFAMRIENDRKMAVESENEIEQNQQERDKLQTQIAETLAKKADLQARLDKT
FT                   PVKPAPPPKVVSIPSPRPAPEGAKRLSILCANNKIYPISIDDIRKDAEEKAKGIILRYK
FT                   LNTNPEAGIDPEKFENFYTKLPSPNDEFFKVEYFVADKRWPRIRLIPRENKGITVEQLA
FT                   STKSAGRRLLASIDPQKFYVVFDVLTNSFDAYLSARHVLMQANVPAGWEPRPDQWVYES
FT                   WIPGNIELGPPRPPAPPPITPQTPAKPPNVID"
FT   gene            complement(635010..635846)
FT                   /locus_tag="Plim_0512"
FT   CDS_pept        complement(635010..635846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66360"
FT                   /db_xref="GOA:D5SQA8"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66360.1"
FT                   /translation="MAQKRAAEPDDFSLFPFMDIVTSVVGILMLMIAAASLEQMTAGDA
FT                   AVITSYEATVAKIQEEQARQAELQKLLDEKIGPSAALTRQQIDATEEEILSLTKKIEAV
FT                   QAELDKLKQAQIVVPKLDPSQRETLAAMQAESKALAEQIAQLEKDLKSRKDAPPANVSI
FT                   LPGGSGLNFIPHFIECQDGAVVLHDLSPPKTVRTANLAADKDFLEILSKAANNVSHSVV
FT                   FLIRSDGLNTYNTARKFCTDREISNGRLPVIGAGKIDLSYFTKKLESQKSSPDNDK"
FT   gene            complement(635934..637457)
FT                   /locus_tag="Plim_0513"
FT   CDS_pept        complement(635934..637457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amc:MADE_03505 possible biopolymer transport
FT                   protein, ExbB family"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66361"
FT                   /db_xref="GOA:D5SQA9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66361.1"
FT                   /translation="MPTFSKFLCPHCSKTLKVPEELAGKTRTCPYCRESIRIPGNSLST
FT                   LGLTNFPSDTGDVPNISPTEKSTSATLLGDEADSASSDVSLILSGLIALGLSVAIFLAM
FT                   LPFRSNMLGQIFWDRGVIPYWLTIVFAWALAILFLKWLHIKRQKEAMLLDVLPTEISEE
FT                   INPKSLDKFVHHIRELPGSSSKSYLINRVLRGIEHFRVRKSAAETVTMMESQSSIDINN
FT                   VTGSYSYVKVFLWTLPILGFIGTVLGLSVAVASLAASLAAASDMNALKGAMNAVFAGLA
FT                   TAFDTTLLALIMSVVIKIPMSALQKSEEDLITSVDEYCNENFLRRLNDGKEGGSERGAG
FT                   GSTSAFREAVEAAMGTHHAELEKWLAKLDSIGGKLTTQMSESWEKVASRFQKHQLDFAA
FT                   QLREQQTAHQQQLHDQLQQMAQAAQAIQSTLTTVATQTEQMQNSVNQSFSTTQTHLQTQ
FT                   FQGLESGLSSLNNVLVKLGEQSIVIQQMPAATETSKRRRGGWLGSLGWK"
FT   gene            complement(637892..638176)
FT                   /locus_tag="Plim_0514"
FT   CDS_pept        complement(637892..638176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66362"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66362.1"
FT                   /translation="MPRELFFHSPHKTSTLPTEFLRALRKSHPSLFTPRIQLDFSEGSL
FT                   TITGTTSTFFQKQQIQETLRKKVPTLRINNRLLISPERHPYSTDALVRG"
FT   gene            638957..640480
FT                   /locus_tag="Plim_R0024"
FT   rRNA            638957..640480
FT                   /locus_tag="Plim_R0024"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            640871..641842
FT                   /locus_tag="Plim_0515"
FT   CDS_pept        640871..641842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0515"
FT                   /product="Cyanophycinase-like exopeptidase"
FT                   /note="KEGG: sus:Acid_4248 cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66363"
FT                   /db_xref="GOA:D5SQB1"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB1"
FT                   /inference="protein motif:COG:COG4242"
FT                   /protein_id="ADG66363.1"
FT                   /translation="MRFRALILATLMCSCDSWLAADDALLGFPKPNDDAKPGAIVLHGG
FT                   GRVTDETFERFIELAGGQEARIVFVPSAGFRLADYRGKQEFLNAVNLRYGSWAKLAREG
FT                   KISSFQFLATDNPADADSDLFIKPLLNATGVWFSGGSQLRVNYRFVGEFPQTTKFQDAL
FT                   LEIVKRGGVIGGTSAGTAAIPEIMTLWSERENPDSPETAVAAHGFGLLRNAIVEQHFQA
FT                   RGGRLERFCKLLRDSPRLDELTGRPGSGRLMVGLAIEESAALVIRRNHLEVIGDARAHI
FT                   FLKSSGSKSLTWHELDPRETVQLRKLPGAPTALLREETALVR"
FT   sig_peptide     640871..640930
FT                   /locus_tag="Plim_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.635 at
FT                   residue 20"
FT   gene            complement(642041..642808)
FT                   /locus_tag="Plim_0516"
FT   CDS_pept        complement(642041..642808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0516"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: swp:swp_4561 transcriptional regulator, AraC
FT                   family; TIGRFAM: PAS sensor protein; PFAM: PAS fold-4
FT                   domain protein; helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66364"
FT                   /db_xref="GOA:D5SQB2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADG66364.1"
FT                   /translation="MDHDAGQFQKAFFSCQPLAESLMSLFDSMPQTYFYAKDRNSRFVK
FT                   VNHLFLEKHGLSRESEAIGRSDFDFHPPVMAEAYIAEDQRVMESRKPLGGQLWQVIHRR
FT                   VSIRWYVSTKTPLFDLSGEVIGLAGAMYEVAEPEQKTHHFQELLPVINYVEEHYAETIV
FT                   MADMAKLAGLSSTHFNRRFQELLRMTPTQYLRQVRIQTARQLLTFTSRSLADIAADTGF
FT                   TDQSHFTKRFRESTGLTPEAYRKKFLSRQGTGR"
FT   gene            642920..646111
FT                   /locus_tag="Plim_0517"
FT   CDS_pept        642920..646111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0517"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="PFAM: protein of unknown function DUF1549;
FT                   Planctomycete cytochrome C; KEGG: sus:Acid_6290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66365"
FT                   /db_xref="GOA:D5SQB3"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB3"
FT                   /inference="protein motif:PFAM:PF07587"
FT                   /protein_id="ADG66365.1"
FT                   /translation="MKTISVWLLVVAMSPSLLAEELSFNRDIRPILSENCFQCHGQDPQ
FT                   HREADLRLDVREEAIKDLGGYRAIVPGKPESSELVARLISHDPDKKMPPPASNRLVTKE
FT                   QIETIRRWIEEGASYQIHWAYLPPQKLKLPEVQNPSWPRQPFDRLILSGLEKQGIVPSA
FT                   ESSPEVWLRRVSFDLIGLPPTPDEIRTFVNDVAQRQEAAYEHAVDRLLQSPHFGERMAM
FT                   EWMDIARYADSHGFNNDGLRSMWRWRDWVIDAFNDNMPYDRFVLEQLAGDLLPAPTLEQ
FT                   QIATGFSRNHVINSEGGIIDEEYRVEYVADRVRTMSTAWLGLTTECARCHDHKFDPISQ
FT                   RDYYRLFAFFNNVAEHGEDGRTANAVPMIPAPTREQQRVLADQRDRLRLLDAEIADLQK
FT                   SPELLIDSSDLFESKATSKETNDDWQWLLESGEARDRQVGNGISFNASQPLIQIAAKNL
FT                   PFSKHKQTILSLWIKPNSDNSDEVAILSSIDYGGSPADTQYGKGRELRLVDGELEWRES
FT                   SRLPVYSRIVITEGASVSPEQWSQIVVIVGGDNNAAAVRFFVNGQEVATHSLYDGLINE
FT                   APDKDVLIGRDNAKDSVRFLGQIDELRWSQRLPTSEEIRDEFLNEAIPYARSHPKCETS
FT                   QSWLMTARSLIHAKLRTLIDQRCRLWEEHLALRRELPTTMVMKELGEAQDMHAPLDQYS
FT                   DRYSNRYRKRYLSQGPRKTYVLTRGNYDAPGEEVDPGALETLLAPWPIDAPRNRLGLAR
FT                   WLTQPQHPLTSRVVVNRFWAQLFGVGLVKTVEDFGSQSEWPSHPELLDWLARDFVDSGW
FT                   NVKSLMKSLVLSASYRQSSETTPTAVARDPENRRIGRGPRVRLPAELIRDQALAISGLL
FT                   KPQIGGPSVYPYQPDKLYDGIVVGTEYPGSRWQLSQGDNLYRRSLYTFWKRTVTHPAML
FT                   TFDAPDREVCTARRSRTNTPLQALLLWNETGYLEASRKLGARMIKEGGDEDSSRVSFAF
FT                   QLATGRLPVAAESEILVKTLKRLRNDFECRPADAAAFIQMGASPVDQSIAPTDLAAAMA
FT                   VANMILNLDETITKN"
FT   sig_peptide     642920..642979
FT                   /locus_tag="Plim_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            646118..647575
FT                   /locus_tag="Plim_0518"
FT   CDS_pept        646118..647575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0518"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   sus:Acid_0975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66366"
FT                   /db_xref="GOA:D5SQB4"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB4"
FT                   /inference="protein motif:PFAM:PF07394"
FT                   /protein_id="ADG66366.1"
FT                   /translation="MHRIPGYEHISRGDFLSKLGLGIGAAGLMHLLGEPEVQGSPADRS
FT                   TKPGLPGLPHFAPTAKRVICLFQSGGPSHLDLFDDKPVLRERFNEDLPDSIRKGQRITG
FT                   MVASQARLACQPSKWNFSPCGQSGTKLSELLTHTGTIADDICLIRSVHTEAINHDPAIT
FT                   FFQTGSQLPGRPSMGAWTDYGLGCANENLPSFVVLISVNKERPGQGLLARLWGSGFLPS
FT                   EHQGVQFRGSGDPVLYLSDPKGISRENRRWMLDGIQELNQQSFARIGDPEIETRIAQAE
FT                   LAYRMQSSVPDLMDLNNEPEHVLNSYGEDVHVPGSFARNCLLARRLAVRGVRFIQLYHR
FT                   DWDHHGGIHDRLPPMVKDTDQASAALVKDLKQAGLLDETLVIWGGEFGRTPYAQGSARL
FT                   DAYGRDHHGKAFSIWMAGGGIKPGMCYGETDDFGFNVVNQPVHIHDLQATILHCLGIDH
FT                   TRLTYRFQGRQFRLTDVHGQVVKAILK"
FT   gene            647903..648262
FT                   /locus_tag="Plim_0519"
FT   CDS_pept        647903..648262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66367"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB5"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6740"
FT                   /protein_id="ADG66367.1"
FT                   /translation="MIDLWLDDERDPEDPRVQELFNADAGMVWVKTVDAAMARLRQGNV
FT                   GFISLDHDLGTTATGYDLACWIEQRAFHNELPRLAWRVHSANTVGASAIRRAMENADRY
FT                   WIDHERNASEPESSL"
FT   gene            648585..648866
FT                   /locus_tag="Plim_0520"
FT   CDS_pept        648585..648866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66368"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66368.1"
FT                   /translation="MILKNIVVFAILSIPSFSGVSCMAEQSQDKSEWFVRPTSPEFPRT
FT                   FGAHYTTDLHRYPGYGLVVWNYDTNRYQDQAGVSAQILAAARKCRQDF"
FT   sig_peptide     648585..648659
FT                   /locus_tag="Plim_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            complement(649497..650645)
FT                   /locus_tag="Plim_0521"
FT   CDS_pept        complement(649497..650645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0521"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   aba:Acid345_3257 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66369"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB7"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ADG66369.1"
FT                   /translation="MDFRYSRYDENNAFSPQSADELFDQLSEYMLQYGDEVLDNLSDWE
FT                   EQQPDVVDMLIRQGLVEKDREGRYSVTPKGLKRVENRALDELFQVQRKDSFGKHQVDFR
FT                   GPGEVLQDESKKYEFGDAISNLNLHETMRSAMSRHAREGKLANRQIHIQEDDLVLYDQQ
FT                   YQTNCATVLLVDMSGSMTRMGKYGSAKRVAMALQALINGRYQGDFLQIVGFYTYASPLS
FT                   SKELFASAPKPVSMYDPRIRLRISLDNSPAFVPQHFTNIHAGLQFARRILNKQPTQNRQ
FT                   ILIVTDGEPTAHVEGRDLMLIYPPSEQTALATLAEAKRCAAEGISISSFALIEDYFYLE
FT                   LVNFVQRMAEVTGGISAYCNAGDLGNLVIESFIKGRKKRMAR"
FT   gene            651219..653099
FT                   /locus_tag="Plim_0522"
FT   CDS_pept        651219..653099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0522"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="PFAM: protein of unknown function DUF1549; KEGG:
FT                   sus:Acid_5709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66370"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB8"
FT                   /inference="protein motif:PFAM:PF07583"
FT                   /protein_id="ADG66370.1"
FT                   /translation="MTNNDSQAKVGSSWRKAGVLACGLSLAVSAFSGFSLFAQGALLAQ
FT                   EMEAKPGMSDKPGMSDKPGMLKPGAKAAEMKGDMEAMDGPAMKASGPKAAGGGDDLPAR
FT                   VKPATNKPGVRTAAADPVVQFINESLRQGWKDNDVEPSPMADDAEWIRRVYLDIVGRIP
FT                   SAEEVQDFVADKSKTKRSELIEALLEDPGYVRNFTTIWTNLCIGQRTPRRVSRTGMQKF
FT                   FREGFAKNRPWNEMVFDLVSAEGHFEKNGATNFILAQMQDNDDGVQLTAKTTRLFMGMQ
FT                   VQCTQCHNHPFNEWKQDQFWQFNSFFRQVRKMDHQKLDPRTGRQVDDYSEVLFRDFSGP
FT                   VFFEKRSGLMQVAYPIYLGAEVDASEGVDRRTELAKLMTSGEKPLVATAYVNRMWGHFF
FT                   GYGFTRPVDDMGPHNPSSNPALLDRLSDEFVKSGYDSRQLIRWIANAEAYSLTSRGIKK
FT                   NERDNPAAGETPLFSHIYVKPMRAEQLYDSLIVATNAHKTGRAGWEQSEEQRQEWLQQF
FT                   VQAFGTDDNEESSGFDGTIPQALMMMNGPLTRDAVALKPGSHLAEVLAGKGNERQKLNI
FT                   LYLSVLSRMPTAAEWARFQKYASSSGGNLIPVYQDMFWALLNSNEFIFIH"
FT   sig_peptide     651219..651335
FT                   /locus_tag="Plim_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.508 at
FT                   residue 39"
FT   gene            653217..654536
FT                   /locus_tag="Plim_0523"
FT   CDS_pept        653217..654536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0523"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   sus:Acid_3761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66371"
FT                   /db_xref="GOA:D5SQB9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQB9"
FT                   /inference="protein motif:PFAM:PF07394"
FT                   /protein_id="ADG66371.1"
FT                   /translation="MSIFQPDGMSRRHFVRHLAATAATIPALEFISHVRANAAELKKNQ
FT                   KSCILMWMSGGPPTIDIWDLKPGSKNGGEFKPISTKGDLQISEHMPKTAQVMNHLSVVR
FT                   AMSTREADHGRGTYFMHTGYVPNPTVVHPSFGSVVSYELGTKRKELEIPAFVSIGGGRE
FT                   GTGPGFLGMSNAPFVVDSNGGIRNADLNGVSAGQLGRRLDMLGSVEEGFINSQRGESGQ
FT                   SHKEIYQKAVNLMTSKQMDAFKVAQESPETLARYSPTPNGNAMGGGMGGISGFGRGLLM
FT                   ARRLVESGVPFVEVDFGGWDLHNDVFNSLKNRMLPQLDAGISALVTDLKERGMLDNTVI
FT                   VWMGEFGRTPRINQNTGRDHWAASWSTMIGGGGLRGGVAVGETDSDGIAVASGKSYLPG
FT                   DIWATAAHALGIPLDTVHTSKRGRPMKIANGGTPIKELIS"
FT   gene            654860..655468
FT                   /locus_tag="Plim_0524"
FT   CDS_pept        654860..655468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0524"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ilo:IL2423 DNA-directed RNA polymerase specialized sigma
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66372"
FT                   /db_xref="GOA:D5SQC0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014331"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC0"
FT                   /inference="protein motif:TFAM:TIGR02989"
FT                   /protein_id="ADG66372.1"
FT                   /translation="MSTSPSEQFEPQVNPGEGVEALTFQKDNGSEPASQAEFVQLFTRS
FT                   QRRLYLYILSQVPHPVEAEEILQEANVIAWTKSSQYRSGSNFFAWVCQIAHLEILKHRS
FT                   RQKRTKLRFSDEFIEQVASEVVEQVDELESRRLALKHCLGKLRDKDRDLIESRYAPGER
FT                   GKDLASQIGRPANSVYQSLGRIRRTLMECIQRQLAVEFH"
FT   gene            655600..658281
FT                   /locus_tag="Plim_0525"
FT   CDS_pept        655600..658281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0525"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="PFAM: protein of unknown function DUF1549; KEGG:
FT                   sus:Acid_5709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66373"
FT                   /db_xref="GOA:D5SQC1"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC1"
FT                   /inference="protein motif:PFAM:PF07587"
FT                   /protein_id="ADG66373.1"
FT                   /translation="MSTWNDELWQLLEALCEDRIHADELLRLEQIVLSSKEARLFYIRY
FT                   IDLHGSLYWNAAFGARQDEVSPTADGDSLLAATAEAGSDDTDAEVNRGLQSEESPGELT
FT                   WEQFSSLMVENISENEPLVSVSTDTEVALPETKDTLGPEGYLWQELPSRLTAVKAVPTA
FT                   SQLSPAGKSTPGSISWLSGMFGNRKSQRSRRLRKWVKSTGSAYAGIAAVLLVCLSVAYW
FT                   QPISGQSGQFLGSLWKPAAKLDSPLASHSDLSTSDPAGLQTKGDTTAHPAAEINGPLNR
FT                   SNSEATARTNGRTPVALPLSTLDKPQGVSQANPTEELIAQRAQALKEQQAMAEEAARIK
FT                   SLSESVSAFVKSPSKPSIAFTYPQGRLSSVQVVSQVNEYLTKTWKEQNLTPAPLASEAV
FT                   WHRRIYLDLVGHIPTSAETEAYLSDRSPGRRERLVDRLLDDPGFARYLATTWTNLLVGR
FT                   HELETADRQALHEYLRVSFAGHRPWNRIVEELVSASGRSHENGATNFLLANLNQDALAA
FT                   TTRTSRLFLGQSLDCVQCHQHPFDDARQAKFWELNSFFRQASSRPVLVLDQQTGKRVQV
FT                   AHELYDLPVAGPVYFETTNQTSVAAFPRWAGQEVDDSATTRRRVELGRILAEDHDHQLA
FT                   RAFVNRLWSQLFGRGFTTPVDDMGVHQPPVHPELLELLTRNFVQENYSIRELVRCMVNS
FT                   RPYQLASIMELDSAPRPLSNATGSESAVQEESTTFEFMRARPLSPEQIFDSFLIMKSPV
FT                   PGQQQFWMEAIEKRQEWIAPFIQQLPTEENLETSLYASPLQEVLTLMNGDLTQDLLSAT
FT                   SGTLLAETLKRYTKDVDRANALTMAIVSRKATETEMTILRTALTKIVGKVKNGENAEVL
FT                   TLDLWRDFAWALLNSSEFRMNH"
FT   gene            658305..659051
FT                   /locus_tag="Plim_0526"
FT   CDS_pept        658305..659051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0526"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: ade:Adeh_0070
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66374"
FT                   /db_xref="GOA:D5SQC2"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC2"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADG66374.1"
FT                   /translation="MQFMALLSNLRGLFVTGTDTDVGKTYVSCRIIEALLNTGHNVGAY
FT                   KPACSGAIVSSLAPSSQPEWHDVNELWSATGQRFPKSQICPQCFLEPLAPPLAAAREGR
FT                   TVSAQQLRSGVDWWLDRVDLLLIEGAGGIFAPISEQDVVLDLAVDLGFPMLIVARPGLG
FT                   TINHTLLTIAAIRQRGLPIAGVVMTSASPFDQPSVMENIKEITARSGVPVLAVIEPDRP
FT                   WPVTIDPADCFSHSRNLTHHEPTVGE"
FT   gene            complement(659099..660037)
FT                   /locus_tag="Plim_0527"
FT   CDS_pept        complement(659099..660037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0837 leucine-rich repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66375"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66375.1"
FT                   /translation="MVEITSNPGTLTTARLAWLALTLQLLVVLQPGCGSSKTAADHETM
FT                   PDPPSQDVAMAPLAPEQPEDPLQKFQRDLKARNPFLRLENMRAEQENGKIVRAEFENAD
FT                   LVDLSPLASTKLEALGIRNSLIQDLSPLKDLPLKALYLEECQVKDLSPLANSSISTLWV
FT                   TYAPLVDIKPLEGLPLKELNLLGTQVTDITPLAKSPLEMLWLNETKVSEIAPLAGLPLV
FT                   SLTLHKTPVKDLSPLAKNTSLKRLHIGETAVEDLTPLAGLKLDRLIFTPEKIQSGLEVI
FT                   RQMPSLKELDTHFGQTPLRTPAQFWAEANRP"
FT   gene            complement(660004..662922)
FT                   /locus_tag="Plim_0528"
FT   CDS_pept        complement(660004..662922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_2289 glycosy hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66376"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66376.1"
FT                   /translation="MSFDLRLFPLTFCILIWSHAASVWAAEAEFTARWSDGSTSRPAQL
FT                   RDWNDPAAEPRLGDLRLFEPSNPVVSLWRSPVPPAARRGIRVELSGGDRLAGEVLGWSN
FT                   GLEDPFETMPAYFLVRPLAPVYPPEARHQQTIRVQANHVRRIVWEAMAGETYQPGTVWL
FT                   RNGGRISFRTCRWSNSAVNLLAATGLKEIPLSDLAEIHLPLDDEWQRFFETAAALTPNG
FT                   KGRWIRLETMDGSLLTTSTQRLQGRHYGDRNRQADWYQLIQPAWALDPLWIRFPQVIGW
FT                   QTWIVTEPPLSWFYPAEIVYSPAFGKSWSPNWNSSVNGTRLTTGENFSQNGWGVFGTSQ
FT                   ITFQIPDFVEGLRTAWGFDPAAQKRGCASATIRVRAGETTSTLFESGEKSGAESAVHTD
FT                   WISIPTSAGGPRQLVLGTDMQANSSTPGADPLDLRDFTNWMEPQLRLNATTAGEMTSAA
FT                   AYQLISGWSGWSLTGWNQNGRVAAPVAVRNQLENWNTKEPRFRSLARLGGETLLLTRRL
FT                   QLKSTDRWIVIHAAREAETQAQIYCAVRLNGEGVGLATLPKREGAIDPQPVMFPIPALA
FT                   GQTASCEIVLFTDDKAAEFDFRGVALTPHQPGVLPVFDEQAEFASLLTSGEGTARISPD
FT                   LPYSGQVSLELRPTDRSGPTLYNQEIPIREHPKLGEFRFITFAWRKIDDDKKSRETIRL
FT                   MIAHEGRLGNEIAEAALDRLRGRPAITRTGGKPLEDRGMRHGYTYDAGDAKQSAGAPLR
FT                   VDWSLPRNWQWVSRDLFSDFGSISLTGFGFATTGETAAYFDSITLARTPDDVTRIRQKL
FT                   QASKESPKLPEGIQEIVTQEEDYSRLLKLVAPQFVAMNSQGGLHWARQYAGENDVVRSH
FT                   PLEANRPFRMFAHVTRTGNRPVTLTGKVRAENDRDFKLVILVQGRSIEERIISGKDQWV
FT                   ELNIDLTPYTQEKLPLSVEVRHEGHNWDNESAWWKSLQIQGL"
FT   sig_peptide     complement(662845..662922)
FT                   /locus_tag="Plim_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(663253..664737)
FT                   /locus_tag="Plim_0529"
FT   CDS_pept        complement(663253..664737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66377"
FT                   /db_xref="GOA:D5SQC5"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66377.1"
FT                   /translation="MEAILRGYDVNEPTWFYLSLLLIIAVFFKFDRIWSLRNFDLALLL
FT                   LLAPGLLLARYSEATVAFGYAWLFLVTGILLVRLLADGFFTRRPRLEQNLNVSGMAFLC
FT                   VSALAFQATKVMTLEPHAAVIETAHRADGLLKRQDGTGAAGSTSLASLNDDLSPGHSSH
FT                   QISPSNINPDTRTQPENLSESNSQNQAAKTELAEQDREDKPVESGPASMLLATPIVQMT
FT                   GGVTIWTTRVLAILAHLATCLGLIAVGRWHFSDTRLGLAMATLYLLLPVTAFDVNKVTH
FT                   LLPAALVVWAFASYKTPSVAGVLLGLACGSLFFAIFLLPVWIAFYWKRGAGRFSIALGA
FT                   VACVMLLCLMMTAADSHSLTRQIVGSIDWSVLKFDSGTGKGFWSQYDQAYRIPVFAAFM
FT                   IMLTVITFWPLRKNLEHLMAHSAAIIVATQFWYPHEGGVYILWYLPVMLIVMFRPRLAH
FT                   LPPRSHEEVSLLASDSTPRSRSESAASVSWRSQLYR"
FT   gene            665222..666121
FT                   /locus_tag="Plim_0530"
FT   CDS_pept        665222..666121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_1394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66378"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66378.1"
FT                   /translation="MPPSSHRMVLKFPQRWIEVLAQLGNWEKSSHGYLVPPAAWLAVHP
FT                   ATALGCSEISAAEIPPGSSANWSKGTVLLQSWMAALIEANGHQVAGRLETTQPMVEVQG
FT                   IECDDWALSAICPAEYWLALTHEIQQKEHPLKPQERSALRQSIRDFLRIAIPPESPQVQ
FT                   QVALCAGWLEVLGLSEESHQESQSIEGLGQPPHGDYWHAIHHRREPDPGNASYWFRRIS
FT                   KHRLLQELEQLLPVANAAFPEKSSHTPVSSWNQATLLYRWEEFPEDDLPEQRYGRLLQW
FT                   LEMSALIAANASSTHVLR"
FT   gene            complement(666340..666804)
FT                   /locus_tag="Plim_0531"
FT   CDS_pept        complement(666340..666804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66379"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC7"
FT                   /inference="similar to AA sequence:KEGG:PVX_000920"
FT                   /protein_id="ADG66379.1"
FT                   /translation="MAGRRLDQRRMAEAAEARGVDETAAPKKRATKKAAATPRVRKVKE
FT                   KVQARKRLLWVVFNGSMKEEARFPYDQYAEAEERLEALRQKSKKLYFIQPVKELIGDGA
FT                   PVASGALAISDDPEQAAALEELELEDEEELELEEEEDEEEEEEEEEDDDE"
FT   gene            667111..669063
FT                   /locus_tag="Plim_0532"
FT   CDS_pept        667111..669063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66380"
FT                   /db_xref="GOA:D5SQC8"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66380.1"
FT                   /translation="MSEMNIRRSSPSFPHSEKTRSMPLHAGFVMLLAGLMVGFDGISSA
FT                   EAGIWPWSRKKEEVSKPKDHPQAPPPDAGSLNAGIRNLLLDAHAAYQKGDLSTALRLAQ
FT                   RAEKLAKASQQVAGKPNELEGTASRFVVEITRQLEEKHKSLPVQEASKSPQVAATPKTS
FT                   PDAGKTHSEKATTEPAPTAVSVKTSEVPRETQVATASKSEDSADKAAVVPSAEIDADQG
FT                   LRTGNLLLQSTAPVMESISSSSVSSKTMVTRSGPENFQVKTEEPGTDFPDWAQDVRPAQ
FT                   GKGERLAEASMAAEEKTAPLAENLKSLNQNSGVTHKNSPKDVPSASTSRSMDFQSEQPE
FT                   QVAAKLEKATSKPVQNDLPTAHDLPAWALAAEPDEEQEARVSVDFGTSTVDQETPAGPS
FT                   SKNISRSVPVPPQVQAEVVSLREVVGEAQLPGWREITPMDIHQPARLDPLLRMQVEMAA
FT                   AATRDLRTRILDAPRLINSQARQVDHVAQGTITLTSNSRQVTPTAIPSSHEVSGSSMAG
FT                   DQYAALRPEGDQESRSPLSVIAVASSTTDSTNRTVVNAQPLSEPVVTSSVANRAWASQV
FT                   VVHTHEQNLRDNSSLVAESTAQSESSQARLVETAIHWLRSHPVRHRWMMAAVALSVFSL
FT                   LWWYGGRQLPGSRSV"
FT   sig_peptide     667111..667254
FT                   /locus_tag="Plim_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.514 at
FT                   residue 48"
FT   gene            complement(669010..669612)
FT                   /locus_tag="Plim_0533"
FT   CDS_pept        complement(669010..669612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66381"
FT                   /db_xref="GOA:D5SQC9"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66381.1"
FT                   /translation="MWNQFRDEIYALYLLSLKCLMNSPTSNFSTDDEERLEAVYPSIAC
FT                   TTIGKYLGKLYESLPHITPRIRLSYLVWIPPTWPIAIIAYVWLKLRGVRYVVTTSGVVI
FT                   ETILTRHIVTQIPWSEVTEIQVDPASFQSFYRSSDIVIRSRAAAEPLRLHAVPFADRFR
FT                   QLLQEAYRADQNTARAQAQISNRARARQLASAIPPQE"
FT   gene            complement(669700..670323)
FT                   /locus_tag="Plim_0534"
FT   CDS_pept        complement(669700..670323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66382"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66382.1"
FT                   /translation="MARQEADHDDLFSEAIALTSRALWKRIRPDHPANCQHSDDLDDPA
FT                   PARLQSVKEILIGTRANDWLSIYWDQSWMVQFNEMNQLRRAYVEPCLYRAQGGTLSRLT
FT                   RHRNPHETSLLRHDLNEAELHSFLASNSQQLTETFALLDCLESGEFKTFQLASFVHPID
FT                   SIQPEVAEQPETIHSTLTARSLVARLGQICMQKLVIAEPPRGRH"
FT   gene            complement(670464..673310)
FT                   /locus_tag="Plim_0535"
FT   CDS_pept        complement(670464..673310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0535"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: sus:Acid_6757 redoxin domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66383"
FT                   /db_xref="GOA:D5SQD1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD1"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADG66383.1"
FT                   /translation="MPYAATSQPAQTDHCDSKHADYSNHSEIDCLDFHRPSVVKGRHNT
FT                   SHGLWQSLWKLSAVVLAVLVFPITAQAQFDDLFGDSAGDSLLGGAAAKPEVSAQLILLP
FT                   EQASGLQAQHLQAQLSVTVVLPEGHYIYDVQGKFEGRTQIRTKLPEGVTAAGAFVSAKP
FT                   PQKIFEPLFGVDLFKLHDSATWTQVLNIAPTVDLKNLVISGGLEGQYCSAGEGGQCLPI
FT                   IPAIKFSTKLEGNIPERMAAKASTTTTVEQPAPAQMLPFRVTERLKRGVKPQPIEFTAQ
FT                   LTPENAKPGEKVELVLTAKIDPKYHTFSMTQPDGFGGSATVVDFEQLNGLSEAGPFVAD
FT                   HPHEIEPGAGGPLEVYHDRVTWTKPFVVNAGQTPGAYGLKAIVHSQACTQGSCVPMPKF
FT                   KLALGMQEPSRAGVEALPQERGSPAETGNTKAPVPPEESTRESTTGTAETSASQAGALS
FT                   GVTFWEDDGDAQEESSAAAGTLGYLLTAFLAGWLALLTPCAFPMVPITVGFFLKQGHGK
FT                   SVGLAVVYCLAIIGTFTLLGVGLSLIFGATFLTQLANNPWMNFAIGAIFVAFGLSMLGL
FT                   FEIQPPSWLLTYTANQEAAGGYLGVIFMALTFTLTSFTCTFPVAGTILVAASQGNVFWP
FT                   ILGMLAFSTAFAMPFFLLALFPSMLRKLPKSGGWLFTLKVVLGFVEIGAAIKFFSVADL
FT                   SLNPQPMLFDFAFVMVAWSVLAITAGLYLLGIFHLSHDQPQDRISPLQALAGTTFLGLS
FT                   LFLMVGVLTPEKSGGALMPQILAFAPPQLKQGFKETEELGPVMVHDGIPFALDVNRALS
FT                   LAKSKQQPLFFDFTGVNCVNCRLMEQKMKLPDNHSRLERFLATQLFADRVPHITDADYA
FT                   ESLRDRNIDLQVKWFGDVSLPSYAVVSPDGKTILAVYKGLERKEGEFAAFLDKGWNRFE
FT                   KWKAKQVASKEPASVERR"
FT   gene            complement(673397..673561)
FT                   /locus_tag="Plim_0536"
FT   CDS_pept        complement(673397..673561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66384"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66384.1"
FT                   /translation="MNRLQMRMGSIGTTHALFVGELVRNPRVEPIFCKVYAKLKEILKS
FT                   LFPDFQTEI"
FT   gene            673673..673871
FT                   /locus_tag="Plim_R0025"
FT   misc_RNA        673673..673871
FT                   /locus_tag="Plim_R0025"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score6
FT                   2.85"
FT   gene            674211..675509
FT                   /locus_tag="Plim_0537"
FT   CDS_pept        674211..675509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0537"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: gbm:Gbem_2447 AAA ATPase central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66385"
FT                   /db_xref="GOA:D5SQD3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD3"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG66385.1"
FT                   /translation="MSLFASIEASHLEDAKPLAARMRPRNLNEFIGQSHVLGEGTLLRR
FT                   MLIADRIHSVVFYGPPGVGKTTLAELIAKSSKRRFIALNAAATGVKELREALDESRERL
FT                   KSSGTKTLLFVDELHHFNKQQQNVLLPDVEQGVVSLVAATTANPFFALIAPLLSRSQIF
FT                   ELKPLSTEEIKAVLRQALSDETRGYGQKNLKVPEEVFDFLAASSDGDARRALLALEIAV
FT                   ESLDSRVLELTLEIAQESLQKKAIRYDKSGDDHYDVISAFIKSMRGSDADATIYWLARM
FT                   LEAGEEPRFIARRIVIAASEDVGMADPQALVVAMAAAQALEMIGMPEGRIPLAQAAIYV
FT                   ATAPKSNASYNAINQALSDIQKQYILPVPNHLRDGHYPGAKRLGHGEGYQYPHDAPDGW
FT                   VKQDYLTEPRSYYTPTDRGYEQEVSRRRQRQGD"
FT   gene            675635..675868
FT                   /locus_tag="Plim_0538"
FT   CDS_pept        675635..675868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66386"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66386.1"
FT                   /translation="MTSESLLRMIIFLNVGSVLAEACFADPPAPAVVPAGEDSVAAFIK
FT                   IDILARQTCTGLGACQGAALHDHGSGRLPRNE"
FT   sig_peptide     675635..675712
FT                   /locus_tag="Plim_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.659 at
FT                   residue 26"
FT   gene            676105..676803
FT                   /locus_tag="Plim_0539"
FT   CDS_pept        676105..676803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0539"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   cak:Caul_5154 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66387"
FT                   /db_xref="GOA:D5SQD5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD5"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADG66387.1"
FT                   /translation="MRAVLALMITFISLMGYGCGAIKETAPERSSTTVTTHEGGADVDS
FT                   SVITFHDEVISQDTPVVELSSLELTTPDGKPVRLSDFLKTGNLVVVVTSGYAGSICPVC
FT                   STQTSRFIANHEAIKSRGAEVVVIYPLGSENDRSRSGEFLAAANKRVALAPGAQPSFPL
FT                   LVDVGLKVVDLLGIRQDLSKPATYILDRTGAIRFAYVGESMADRPSVQAILRQLDTLNT
FT                   SMTNAARVGT"
FT   sig_peptide     676105..676167
FT                   /locus_tag="Plim_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.377 at
FT                   residue 21"
FT   gene            676867..678684
FT                   /locus_tag="Plim_0540"
FT   CDS_pept        676867..678684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0540"
FT                   /product="Serine/threonine protein kinase-related protein"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: afw:Anae109_0119
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66388"
FT                   /db_xref="GOA:D5SQD6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD6"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG66388.1"
FT                   /translation="MPLDDEFLAVAVRNGLLEQVVADQLGALSASSGISSAQAALNAGR
FT                   LSHDQIDVIEALRSPLDQIPGYELLSLLGQGGMGVVYKARQLAFDRIVALKLVRSGSAS
FT                   STAVARFENEIRTIGSFSHPHIVTAFDSGKHAGRLYLAMEYLDGQDAEVFIPKERFLPE
FT                   RIVWGMIRQVATGLAYAAERGVTHRDIKPANLLLVTPPSGYPLPEGVPFVKIADFGLAL
FT                   LQEDFDAQTRLTRENAAVGSPHYMSPEQIMGSQVGLKSDIYALGATAYHLLCGHPPYHG
FT                   YTLTQIYSRKMLRDPAALRELRPGLSADSVSLVERMIHREETERPNDYATLLHRIDTIQ
FT                   QSTDPAGVSASIPQRSSATPGTSPDRYRHSLVAWSRRLMTISAIVVGLAAIAAGFWWSL
FT                   PINPKLTGPRNWQATGWVRQCFDGASLNGWRTIRGAWVPGAKDEEGGFVLSGRGALGYP
FT                   LAKPVNGGMMRLDGFRLSVLWQRQSAQIVELQFPEEPSARHGETRSMVFQATPDSIRWG
FT                   RRMLPTGSLETVFAERFITLPADSVHELRVEFQGGEWLAYLDGQLFGSSPSGPLPSNEF
FT                   RLVAEVDPGDAEGAAWFSDILLEELGPPI"
FT   gene            678759..678881
FT                   /locus_tag="Plim_0541"
FT   CDS_pept        678759..678881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66389"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66389.1"
FT                   /translation="MRRSYFSDSSSEMNQVVLDPEKYGMGSIEMPGSLRALCKE"
FT   gene            679096..680385
FT                   /locus_tag="Plim_0542"
FT   CDS_pept        679096..680385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0542"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66390"
FT                   /db_xref="GOA:D5SQD8"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADG66390.1"
FT                   /translation="MNVVDRRQFLGLTLSAAAFSAASNLLPFDDRYAHGKVLGADGMPV
FT                   SPQVEGPETMFLTWPGDPTSTICIQWVDQDHGNELEIAYSPLESDNWQIAKVTTKPFPM
FT                   TKDKVYRASISSLQPGTEYRFRMGADAPTFRFRTMPKKLTDTFHFVSGGDAGTGSHAIG
FT                   TNQLAARQEPYFALLAGDLAYDNGKSPRTFIKFLKNYRAHMVDPQGRLIPLLACPGNHE
FT                   VDGAYKQPREKAGSYLSVFDCFFPDTTYGVYDIGDDFSLVLLDTDHISPIEGEQTSWLE
FT                   KTLAARQDKKHLFVANHVPAYPSYRAANIDSDKPGTGAAQRKLWCPLFERYNVDVVLEH
FT                   HDHLFKRSHPLTDGRKDKYGVPYLGDGSWGMLRPLKEPELRPYLAKVSSSYHMTAHHLE
FT                   GDERFHIALEENGRIADVCMTRNKRAARRG"
FT   sig_peptide     679096..679167
FT                   /locus_tag="Plim_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.548 at
FT                   residue 24"
FT   gene            complement(680415..681005)
FT                   /locus_tag="Plim_0543"
FT   CDS_pept        complement(680415..681005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0543"
FT                   /product="putative rRNA methylase"
FT                   /note="PFAM: putative rRNA methylase; KEGG: ppd:Ppro_0564
FT                   putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66391"
FT                   /db_xref="GOA:D5SQD9"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQD9"
FT                   /inference="protein motif:PFAM:PF06962"
FT                   /protein_id="ADG66391.1"
FT                   /translation="MRPVPLTTLAHELLRQHLQPGDFAIDATAGNGHDMEFLARTVGPA
FT                   GLVWAFDVQEQAIAASEYRRSQAGVNWVQLQQVSHSQMKAVIPEKYHGKLAAVMLNLGY
FT                   LPGGDKSITTTATETIAALEQALMLLSATGLLTVMLYPGHPAGAAETQAVREWAQGLPA
FT                   YFEVKTQQYAERGPLSAILMTIHKRPESALHTL"
FT   gene            681247..682200
FT                   /locus_tag="Plim_0544"
FT   CDS_pept        681247..682200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0544"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sfu:Sfum_1762
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66392"
FT                   /db_xref="GOA:D5SQE0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADG66392.1"
FT                   /translation="MLPELRTLGATDIRVTSIAMGCWPIAGITTQGVTKPRSLATLQAA
FT                   FDAGINFFDTAYCYGYEGESDRLITEALGHVRDKIVIASKGGIQWSADRVQVKDGRPET
FT                   IVRQCEESLQRLGTDVIDLYYLHGPDPQVPVEISAEAFVRLFEQGKIRSAGLSNATLEQ
FT                   LSAFHRVCPLSAYQPRYNMVQREIEQSQLPWCRENHVSCIVYWPLMKGLLAGHYPREHL
FT                   FPPTDSRHKYAVFQGQEWQRNQDLLDELKAIARRCELSVARLVLQWTIQQAGITSALCG
FT                   AHRPEQIQENAFAMAGKLNHETLMEIESAIARRDLP"
FT   gene            682342..682698
FT                   /locus_tag="Plim_0545"
FT   CDS_pept        682342..682698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0545"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66393"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE1"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADG66393.1"
FT                   /translation="MLYAVLVYETAHETEARNHPERAGAYWGAYKAYSDALVQAGVMAG
FT                   GNALQPISTATTVRIRDGKRDVQDGPFADTKEQLGGMFVIDVPHLEAALEWAARCPAAL
FT                   TGSAEVRPILPMNG"
FT   gene            682757..684046
FT                   /locus_tag="Plim_0546"
FT   CDS_pept        682757..684046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0546"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   mlo:mlr4613 ECF family RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66394"
FT                   /db_xref="GOA:D5SQE2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE2"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG66394.1"
FT                   /translation="MSGSQNAADYRVTSGEWHLAVERVARESYGRLIAIICRKTNDLAA
FT                   AEDALASALLTALETWPHSGLPVDPEAWLIRVAQRKWLDETRHTQLRDRVLREVISPVM
FT                   ALLQEKSAMHSTEVPLQDDRLAMMFACAHPAIEPSMRTPLILQAVLGIDASRIASAFLI
FT                   NPQTMSQRLVRVKNKLKVAKIPFELPPEHEWRDRLDDVLSAIYAAYGTAFDETMSGQSG
FT                   TRALAREAIWLAQVVQKILPQSAEAAGLYALLLFCEARRDARRGSEDQYVPLLEQSPEL
FT                   WDGAMLDEAEATLSAAFQQQAPGRFQWEAAIQSAHCARRHFTSGQAVVDWPAIAVLYEG
FT                   LLSFAPSLGARVAQVGALLQANQMEQAKERFALIPREACRTYQPWWVVSAELARRQGQN
FT                   SQAHSDLMIAMGLTEDAAVKDFLARKAANL"
FT   gene            complement(684100..685176)
FT                   /locus_tag="Plim_0547"
FT   CDS_pept        complement(684100..685176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0547"
FT                   /product="protein of unknown function DUF1559"
FT                   /note="PFAM: protein of unknown function DUF1559; KEGG:
FT                   sus:Acid_5705 Tfp pilus assembly protein PilE- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66395"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE3"
FT                   /inference="protein motif:PFAM:PF07596"
FT                   /protein_id="ADG66395.1"
FT                   /translation="MSRRSGFTLIELLVVIAIIAILIALLLPAVQQAREAARRTQCRNN
FT                   LKQLGLALHNYHDVFGSFVYRKGGTRGNGDASRNDGNYNRRTGMISLLPYLDQTPFYNS
FT                   IEAGNPAATPVPVAPGGAAPWAGWSGYNMNIAALKCPSDPFEVRPRGTVSYAFNMGDFI
FT                   TNNRDETRTNGLFACNATYGVRDVTDGTSNTLAFAERCIGNIDWQSQNSVDVRRGTLGG
FT                   VATITTNPGSCVTSVAAVSANRRFTTSTNVKGKFSSFWADAQAENVGFTPILSPNSPSC
FT                   TNDTNTTSDAASSVLSASSYHTGGVHALMADGAVRFISDNIDAGGLGANANTLGGPSPH
FT                   GVWGALGTRAGGEVTGDF"
FT   sig_peptide     complement(685075..685176)
FT                   /locus_tag="Plim_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.953 at
FT                   residue 34"
FT   gene            685561..687126
FT                   /locus_tag="Plim_0548"
FT   CDS_pept        685561..687126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0548"
FT                   /product="Flagellar basal body rod protein-like protein"
FT                   /note="KEGG: net:Neut_0339 flagellar basal body rod protein
FT                   FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66396"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE4"
FT                   /inference="protein motif:COG:COG4786"
FT                   /protein_id="ADG66396.1"
FT                   /translation="MSNESPSPQDSSPVTQFSQSSMLTKVLVVCASTIGVHIALLNLWP
FT                   HAESFPPRHRPAEDARAAAFAESRQAAKLSEKEAALSGSRLLASTGSRTNHSSGGTEPR
FT                   ISEPAPFQPHASPLPLSQADSGPPNELPLKEPATLPDLPLETPVQVPNSPSQAPKAPLD
FT                   HSAPRSPREMAARQQRLDVIKKELPNASEDELNIWVEQFQDVPVESLRDLIRLRQQFPV
FT                   GLPKSSLEIGSQNPGIPGNSDQPSGRDSNAIPSQPDETFPGEFGSHQIPAPSSGEVLRT
FT                   ADVIEAVAPEIRVLRAAQHIHRQNMAQAKTIGYRRRVVQLQSHGTPLADQVPTLSTTID
FT                   PTPGEWIITERPLDLAIQGYGWFVVRHDQQQLLTRVGHLVWNENRQLAIEIGTRSYPLD
FT                   PPIVAPEGCTQLLIEETGNVQAATAGSELSSLGVITMATVPDATQLLEKLPGLFATTGK
FT                   SGNLTFHTAETARSGKLIAGRLEQSNVNSELELQFHRDLDDQISLLRTAWEESLSRLNW
FT                   SRNE"
FT   gene            687193..688320
FT                   /locus_tag="Plim_0549"
FT   CDS_pept        687193..688320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0549"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: slo:Shew_0558 ribosome-associated
FT                   GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66397"
FT                   /db_xref="GOA:D5SQE5"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE5"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ADG66397.1"
FT                   /translation="MAKKPKPQLRANLLKNRSTRQRKNDFTRDVEVDADRVFELKSSER
FT                   VRGRNEMSRKRTISGATLDGNRIVLEIDPEKALYGRVLSSVGSTQCTVQVEDGRRFMCS
FT                   VRRIVRTVARETRNAVVAGDKVWITASDETTGVIERVEPREGVLSRGHQNREHILVANV
FT                   SQMLIVGSAAQPNLKPALIDRFLVSAGKGGVHPIVCVNKIDLVDPVELVSLLGWYSQIG
FT                   CDVVMTSVTTGYGVDRLRQLLKNEQTVFAGQSGVGKSSLLNAVQPGLSLQTGQVSEVTQ
FT                   KGKHTTRYTQLLPLIEGGWVVDTPGIRQMELWDVRPEEIEGYFVEFRPFVALCRFPSCR
FT                   HYREEDCAVIRAVQMDLIPRVRYESYLRMMLGDDA"
FT   gene            complement(688359..688976)
FT                   /locus_tag="Plim_0550"
FT   CDS_pept        complement(688359..688976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66398"
FT                   /db_xref="GOA:D5SQE6"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66398.1"
FT                   /translation="MPNPNHSSLNIDDLLIDSFTLKQDLPRFVIQKPPSVNDACSGYQL
FT                   AAGGKSQSLNLLFWCIVLAAAISFIAIQFSSIAHFESRILFFVLTGIMVIWIFLPNRRN
FT                   KKYFTMMAEKGLGIFEVGTTVIADEAVWLIYPDSTSRFAWQRFDLFQSNRDAIALRIRG
FT                   GPTFVILTRSQVDHPEDWEGLSNFIGGQFQKYSSKSNMTATS"
FT   gene            complement(689057..690025)
FT                   /locus_tag="Plim_0551"
FT   CDS_pept        complement(689057..690025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0551"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_1577 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66399"
FT                   /db_xref="GOA:D5SQE7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE7"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADG66399.1"
FT                   /translation="MPENLPISSRRQFFGDFTHGLTVAAATAAGLSASSGSLLASEPAV
FT                   PANELLKKKTRLSLAAYSWNARLAKAWDEKTPPKGATIPTFIDYCASLGLDGCELTSYY
FT                   FPKDVSPEYLYACKNQAFRKGLDITGTAIGNDFCLPEGPALDAQMAMTKQWIDNSVLLG
FT                   APVIRIFAGKVAKGDTEEIAFERCVKGITKAVEYAASKGVCLALENHGGITATPEQLLK
FT                   IYHAVPASPFFGINFDSGNFRTADPYADLEKIAPFAINAQLKVEMFKTDGKKELADIPR
FT                   ILSILKNAGYQGYLILEYEAAESPDEAIPRYVETLRKLLDA"
FT   sig_peptide     complement(689903..690025)
FT                   /locus_tag="Plim_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.992 at
FT                   residue 41"
FT   gene            complement(690143..691192)
FT                   /locus_tag="Plim_0552"
FT   CDS_pept        complement(690143..691192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0552"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sus:Acid_3554
FT                   ribokinase-like domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66400"
FT                   /db_xref="GOA:D5SQE8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE8"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADG66400.1"
FT                   /translation="MNIEDLQKLFCEFPLRRIAVLGDFFLDKYLEIDSGLLETSQETGR
FT                   KAHQVVGVRRSPSAAGTVINNLAALGAGELYALGAIGDDGEGYDLHQGLRKLGCSTDGL
FT                   LRCPEIRTPTSIKPTEIHIPGLQGEMHRYDVRNRHPTPQSVIAQLTAALTHILPRVDAL
FT                   IIMDQVEIQNTGVITSSMRDVLAELALRFPKVTFWADSRRNVRHFRNIIIKPNQFEAVG
FT                   RFKPLPGDELDEKDLIPVVPRLRAETGATVFVTLGEKGIIVSDPKQQLIPGLKVTGPVD
FT                   PTGAGDGATAGAVLTLASGGSVIDAAIVANLVAGVTVQQLGATGTATPAQVLAAFRQWQ
FT                   EQHGSLSFK"
FT   gene            691287..691550
FT                   /locus_tag="Plim_0553"
FT   CDS_pept        691287..691550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66401"
FT                   /db_xref="GOA:D5SQE9"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66401.1"
FT                   /translation="MVIGAAESRKGDRVISQELAMGLALIGMSLFFLQRAVWIVAETRK
FT                   GQWLKSRLGEDRAVMTVRLIAMSFALIGGLLAAGVIEPWRWE"
FT   gene            complement(691883..693067)
FT                   /locus_tag="Plim_0554"
FT   CDS_pept        complement(691883..693067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66402"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66402.1"
FT                   /translation="MRHRATPLVMLLTLILAISSASAEQRGRGGEGGGGDKSGGGRPGG
FT                   SSSSAEKSGSKPPGGAWSSPSGKKPGTSQGDLPGNEDKKNPFNANNPQGAAAAANKNKS
FT                   SNPSGAEDAAAGAAASRRNQPTASGAEGAAAGAAAANKNQPTMSGAQGAAVGATAAKNN
FT                   QPAVSGAAGYAAVRDSFDHPSLYTPEWHGDNQAAWTASNWPANAAYTNASHAAVAAHCG
FT                   YQTNAAVSYGYGDNVNYENQMVVVNGQVAGSAAAYSQQAAQMANNGRNATTTPADDWLP
FT                   LGVFALVPSEDQQPQLTVQLAINKQGVLRGNYTELVSDHTQLIHGMVDPQTQRAAWTVG
FT                   DSEGFYMEAGLKNLTDGDAPVLIHRRGKTERWVLVSLPQPQSAAANSNNPGNGN"
FT   sig_peptide     complement(692996..693067)
FT                   /locus_tag="Plim_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 24"
FT   gene            complement(693482..694258)
FT                   /locus_tag="Plim_0555"
FT   CDS_pept        complement(693482..694258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CCDC89; coiled-coil domain containing 89"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66403"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66403.1"
FT                   /translation="MLKIEQILKSAGRVAVAVAAVSCLWISTASAQPPGGGQRGGFQGS
FT                   MGGGMGGGPMGLLMMPEVQTELKITDDQKTKFRETMQGMREGMGNLRDMSREEREKAMT
FT                   EHTKKMTDSVKSILTPEQFTRLEQLQVQRAGVEALMIPTVAEKLALTADQKTKLEEIRT
FT                   SSRPNLEGMRDMSREERTKMMEEMRTKRTEAQAKMMEVLTAEQKTKLEELKGASFTFPE
FT                   NPGFGGRGGAPGQPGQRGQGRPGNRPAPAAAPADDL"
FT   sig_peptide     complement(694163..694258)
FT                   /locus_tag="Plim_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            694347..694523
FT                   /locus_tag="Plim_0556"
FT   CDS_pept        694347..694523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66404"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66404.1"
FT                   /translation="MLVASHICCGQGLSLSNTGHCQKFRRSLRLFAISCLLSIVELNRF
FT                   RFFSGVIEQITPS"
FT   gene            694572..695327
FT                   /locus_tag="Plim_0557"
FT   CDS_pept        694572..695327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0557"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bce:BC2480 TetR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66405"
FT                   /db_xref="GOA:D5SQF3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG66405.1"
FT                   /translation="MFVKFFPVGVPMNSPIKPGRPANPQLRKQREEEILQAAAALFAEK
FT                   GYAPTDLQELAQRLGVGKGTVYRYFPTKQDLFLATVKHEITRFTTTLESMVPRDAPLIE
FT                   QMSLVIEAYLQFFQQNPDVVELMVIERSHFKHRRPTYFDLEDDPSCARWDALVSALMEQ
FT                   GVMRSMPLEKVRRVVGDLIYGTMFSNYMAGRIANPQEQAQEIMDLLYGGLLTGEGWEVW
FT                   RTHMNTLCSLRHPNDNKEPPSSTPASHRN"
FT   gene            695399..696940
FT                   /locus_tag="Plim_0558"
FT   CDS_pept        695399..696940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0558"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   scl:sce1627 RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66406"
FT                   /db_xref="GOA:D5SQF4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF4"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADG66406.1"
FT                   /translation="MTATAQITDPNPPPAMIHPATPAKPGSSLTRGIVIVITLAVVSLV
FT                   GYWFWREKFSSGKTTTPRDSQSLLVTQETRLSEGESTHSVAASPGSNPQDSPDLAAKAK
FT                   PAVIVTTSPALVANVQRMLKAVGTLEGFEEISLSPQVGGRILAIHKEVGDLVAPGDLLM
FT                   EIDPQDALLTVKECQSALDLELSKLGLKEPPGQNFNVEAVPAVQKAMLLELNSLRTLER
FT                   VRQLASQKVTTQDDLERAETNYEVAKVEARQQRLLAGETIAAIRQKIALLKTAEKRLQD
FT                   TRVVVPTLTCLEGDVKVPCSPQLTVAERHASEGENVVVTQISPVFLLVIEHPLKLKVSL
FT                   PERVMGQVKTGQKVRVTIEAYPGEIFTGEVKRVNPTIQRSSRTFEVEVAIPNEDRRLKS
FT                   GSFAVAQILTDHRPTAVVVPESAIVRFAGVVKLFKVTPQKTVREVLVILGERIEQQVDG
FT                   KSVPYVEVTGDLQPGETVVTSGQSQLVDGIAITLREPAPNTTSEATAAPAKGAHQ"
FT   gene            696937..700125
FT                   /locus_tag="Plim_0559"
FT   CDS_pept        696937..700125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0559"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   scl:sce1628 RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66407"
FT                   /db_xref="GOA:D5SQF5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF5"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADG66407.1"
FT                   /translation="MTIWELCIRRPIFTTMLVSAPVILGLAAYPRLGVELFPNVDVPMV
FT                   TITTTLRGASVEEMETGVTKPIEEIVNTVAGIDELKSTTKEGSSQVVIGFDLDKNGDIA
FT                   AQEVDAKVRTILSQLPEGTDAPIIDKFAVDATPVLTVAISGKRDEREITEIARRQVKEI
FT                   LETVPGVGSVAMVGSRQRAINIWIDPDRLQKFPNLTIEDVRLALLRENQEQPGGRVDRG
FT                   TSEVVLRTMARMATPQEFESLIIANRGGQPVRISDVGRVEDSIEEPRGLSRLWTRAADG
FT                   KNVSQAGDAAVSLIIQKQSGTNTVKVVHEIKERIAELQAILPADIQLKVIRDQSRFIEN
FT                   SMHEVQVHLVLAAVLVSLTILLFMRDWRTTLIAALSIPTSMVATFAFMDFMGFTVNNIT
FT                   MLGLILAVGIVVDDAVVVHENIFRHMQEYQLSAMEAARSATAEIALAVVATTMSLLVIF
FT                   LPVIFMGGIVGRFFSSFGYVVGFSILMSMLISFTMTPMLCSRFLKLETGHHGEGGWFWQ
FT                   RIVAAYVAILRWAMRHRWVIVASSILVLFSTPVLFVAVGKDFVPKDDQSEFEVSVNLPE
FT                   DYTLQRADEVLTELDLRIRQLPGITDSFITIGDTTGRITKGQGEVNKATIYYRILPIAE
FT                   RDFSQFDVMSDARRLLVQYPDLRAAVQDVAVIQATGIRQVAIDLNLRGPDMEKLQEYSD
FT                   RIIAWMKERKHYVDVDTSLSFRKPELRVIPLRERASELGVSVAAISTTGNVLVGGLPVS
FT                   KYKEADQQYDVWLRAERDHRSSAAEIGRLTVPSTKTSTGVVELANVARFEDAFGPSTIE
FT                   RFSRQRQVVVMANLEGFALGKAVDELTAFVKSMDLPADYRWEFIGQARDMSDAMGYFFI
FT                   AFILSIIFMYMILAAQFESFIHPITILLSLPLTIPFAILSLILLGTNLDIYAMFGLFML
FT                   FGIVKKNGILQVDYTNVLRARGVPRDEAIIEANRTRLRPIMMTTVMLVAAMIPMALGEG
FT                   PGAAARAGMAKVILGGQALSLLLTLLLTPVAYSIWDDLAILSARWWPVGLRQKSKTPDL
FT                   VSDPAERLGTSFPV"
FT   gene            complement(700170..700559)
FT                   /locus_tag="Plim_0560"
FT   CDS_pept        complement(700170..700559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0560"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: CoA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66408"
FT                   /db_xref="GOA:D5SQF6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF6"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADG66408.1"
FT                   /translation="MTKPQPTVAIVGASADRTKYGNKSLRAHLAQGFQVFPVNPKGGEI
FT                   EGLKVYSKLSELPGPVDRVSMYVPPAVGLSMMDEIAKLKPQELWLNPGSESDELYEKAT
FT                   ALGLNVIIACSIIDIGTTPMAFGDA"
FT   gene            complement(700600..701190)
FT                   /locus_tag="Plim_0561"
FT   CDS_pept        complement(700600..701190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66409"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF7"
FT                   /inference="similar to AA sequence:KEGG:GSU2928"
FT                   /protein_id="ADG66409.1"
FT                   /translation="MKGASFDFCHAIRRLCDDLTIRLPEFRHIDMDQVAIGFAQARRSV
FT                   PYGLQAKLTPMRFENGNLVTRRGRHNWTIRRLFAGEQEILYILTFYLPRFQEQTFREKL
FT                   ITICHELYHISADFNGDIRRLGGRYHVHSHSQNEYDRQMGEFVDQYLKLNPPKELCHFL
FT                   NFNFRQLEQEYGSVVGLKIPIPKMLRIPDLRTA"
FT   gene            complement(701359..702345)
FT                   /locus_tag="Plim_0562"
FT   CDS_pept        complement(701359..702345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0562"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: abo:ABO_0350
FT                   carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66410"
FT                   /db_xref="GOA:D5SQF8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF8"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADG66410.1"
FT                   /translation="MKFDVYGVGNAITDIQARISDELLEKIGFTKGVMTLVESDKQGHV
FT                   LASLEGHPVNRCAGGSASNTIAGIADFGGTAAYAGKLADDEIGRFWLSDMQALGVTVDT
FT                   PLGTGVSGTSVILITEDAQRTMLTHLGISATLGPEDLSEEQIAASQYVYVEGYLFTGES
FT                   TRAAAYRAIELAKKHQVKVAFTVSDPFLIHLFRDEFLKLIAGPVDLLFCNLEEARSLTG
FT                   KTEPVDCAQQLHHLAADVALTLGGDGSLILRDNQVIPIEATPVRPIDTTGAGDMYAAGI
FT                   LYGLSNGLSYRQAGHLASQAAGRVVSQLGARLSRKFTPQEVARFASL"
FT   gene            702670..704010
FT                   /locus_tag="Plim_0563"
FT   CDS_pept        702670..704010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0563"
FT                   /product="metal-dependent phosphohydrolase HD sub domain
FT                   protein"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: hch:HCH_02459 HD-GYP domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66411"
FT                   /db_xref="GOA:D5SQF9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQF9"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADG66411.1"
FT                   /translation="MITASAPEAAPTDEDQTREVSIDDLIVGRPLTYPVNDTRGRLLLA
FT                   AGQELTRLAKRRLKSLGVHRVCAHAADSMIQNLNQIELRSASSLASHDEISAKLDHVVE
FT                   QGLFQIQNSGPAVRDRVRQHGATSFDRELQKDVSELRSETQAELSNLVKEALQGRNDTG
FT                   GAVAQMAAQFLAQSTEDTDCVLSVVLEAAKKPDLADHSLKMAVLAMAIGIEMGLDEDNS
FT                   RRLCVTGLVCDWGMYKLPDELLNADRILSVGDHLQIQKHSQYTAEILDRTTGLPSQTAV
FT                   IAYQVHERPNGRGYPKQRTSERINICSRILNVADTYTALTSPRAWRPALTPYAAMETIL
FT                   RMARTRDVDPDVTRSLLKVMSLFPIGSLVALNDGSVAQVIRRNGNQYDRPIIEVVQTAD
FT                   GQPVPLENRVAIDLMMSPLEVVQAIATPGSEEETWCEPYVMINRTLR"
FT   gene            complement(704086..706101)
FT                   /locus_tag="Plim_0564"
FT   CDS_pept        complement(704086..706101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0564"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase-like
FT                   glycosyltransferase of PMT family"
FT                   /note="KEGG: afw:Anae109_0521 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66412"
FT                   /db_xref="GOA:D5SQG0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG0"
FT                   /inference="protein motif:COG:COG1807"
FT                   /protein_id="ADG66412.1"
FT                   /translation="MNLTGQCSSAGGQTSPMRRFPDWMLEWPLYLLLAIVGIVYFSRIE
FT                   YPPLRGEETRRALVAINMQTSGDWVVPRMQGTPYFMSSRPPVHNWMIAGSMALRGSEDI
FT                   TSIRLPCLLAVALLSIILYGYARQSLSRVGAFATGLAYVTMIQVMELGRTGETDLPFTL
FT                   FLSSALLLWHTGWQKQWSAWIIWPVAYLLLTGAIMTKGPQAPVYFAATIGLYLLINGRA
FT                   RFALSWAHVSGIALCASLIAMWLVPFYLQLGMPGLRHVFTGDVVLYGGDRTIFTYLKHL
FT                   TEFPISLVVGCWAPWSLLLVNLCSKTWRQRMAPYHQVMLFAGLALVTSFPTVWLITGTR
FT                   TRFLMSVYPLAAVLIGVTIETLYQWVKASKAVELSLASTSSSRQENLSDNPGPILPLSR
FT                   FIGTFAILAWIAGGVMALLTVATALSLPVGNLSVPPVYGVFLMMAAALLGRTMWVCRST
FT                   ATEARCIQGLAALGLFVGGTFVTAVVDDYTRRSSRIDLAVEKLLKDLPEGAELVSLGEV
FT                   HHNFEYQYYRRTGRFIRRIDPEPVQPQSISNSVESAAGAASINNNQRSIISRFSPEQLS
FT                   GLTYLCTSYPRYLESDYLPVACEQVCVVACGRFLGKDPDMGVVVARLPVEHQLAQELQN
FT                   STGLPAQIQKSSQPSGAISEPGTILPVSATQESIPK"
FT   gene            complement(706253..708226)
FT                   /locus_tag="Plim_0565"
FT   CDS_pept        complement(706253..708226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66413"
FT                   /db_xref="GOA:D5SQG1"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66413.1"
FT                   /translation="MSSIREQDAPRKSQDARRQRLCRSLETNTEIAPSTADRLERAFRP
FT                   QPVVSRRQHPLIQRLVQLTRQPLAYWIWATVLIGISLRFLRFAMVRPLWCDEAYLATSI
FT                   LSRDFKTLFTPLEYGQIAPSGFLLGTWLNVATWGASEVSLRTPAIIMGVAALAFFPWAI
FT                   RPLAKREVCWVATVLLAVSIFPVRLASELKPYSIDLCLSVLLLGCAIRSLADSSVRRTL
FT                   IKPQHRGNHTWFWFGLFVILCVATPWISFPGVFVAGGMIVGRFFWQLSPPLPRLPAGLL
FT                   LQIPVNDRSTITRILPYHFESRSLRLQRALMGGFLVGIPLVLSTFLMWNCFGKSAYEHG
FT                   NQVMNLKVFWQDAMPRSFSAQEILRWLAEAHTGSMVAYPVGAEHGGSAATSIFLVLGIV
FT                   LLAFRQRQILLLLVSPFLLTALAAALQKYPYGGSARIAQHLAPMICLLVAWGVIAIFPR
FT                   TTITGRRLCRLLVAVIGLGFVVGQGIYFIQKPAKDPNDTSIRETLASIYLQTPITQSIR
FT                   CAADDHHVAFAEHQLCSEQGAKFRANRLLEEANRKQQLNSVVPTSEKVLFFSHQPIHEL
FT                   SPEIQLELAQAFPSTIYTPSRTYPLVHSNRDGRHAGYFFTFERALSELQPPAVDHPLPE
FT                   SHPSSGQDNLDFVSNSNFPRLP"
FT   gene            complement(708508..709539)
FT                   /locus_tag="Plim_0566"
FT   CDS_pept        complement(708508..709539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0566"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mll3915 alcohol dehydrogenase (NADPH quinone
FT                   oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66414"
FT                   /db_xref="GOA:D5SQG2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADG66414.1"
FT                   /translation="MHDIDVFEYAPTADKYRLERKRRPMAKLGFHQVRVAVKAVSLNYR
FT                   DHIALHNLARRQVGGRIPCSDGAGVVEEVGEGVTRWKVGDRVMGSFFATWGKGPFQMAY
FT                   HQHDLGGTVDGMLGSFVTLEESSLVATPGYLSDLEASTLPCAALTAYHALFVRGQLSAG
FT                   QTVLCLGTGGVSVFALQFAAAAGAQVLITSSSDEKLARAVELGATHTINYRSHAEWQKV
FT                   VDELTAHRGVDHVVEVGGPGTFDRSLQSVAAGGHIALIGVLTGFGPPTGSLFPLVARNI
FT                   RLNGIYVGSQEMFKEMNQFLESHQLHPVIDRVFPYDQSRQAFEWLASGHHFGKVVIDLS
FT                   ATH"
FT   gene            complement(709603..710685)
FT                   /locus_tag="Plim_0567"
FT   CDS_pept        complement(709603..710685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0567"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   xca:xccb100_3168 putative NADPH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66415"
FT                   /db_xref="GOA:D5SQG3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG3"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG66415.1"
FT                   /translation="MSQLFSTYQLKDVSFRNRIAVSPMCQYSSHDGHADDWHLVHLGAR
FT                   AVGGAGLIVAEATAVSPEGRISPGDAGLWTDSQIEPLARINRFIKAHGAVAGIQIAHAG
FT                   RKASADLPWQGGGHLANDQGGWDVIAPSAEAFGDNLTKVPQALSIEEIHQVQRHFVAAA
FT                   KRAIEAGYQLLELHFAHGYLAHEFWSPLSNHRTDQYGGSWENRARFLVETLDAVRAVWP
FT                   EHLPLIARLSVTDWIDGGVTVDESIELAAVLKKRGLDLLDVSHGFVTPDISHVPWGPGF
FT                   LVPIAEKIRRAAEIPVAVGWMITEPQQAEAIIAHGQADFIMLARASLANPHWPYVAARE
FT                   LSVERPMNVLPIQYSSALRR"
FT   gene            711128..713584
FT                   /locus_tag="Plim_0568"
FT   CDS_pept        711128..713584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0568"
FT                   /product="Protein of unknown function DUF1592"
FT                   /note="PFAM: Protein of unknown function DUF1592; Protein
FT                   of unknown function DUF1588; Protein of unknown function
FT                   DUF1587; Planctomycete cytochrome C; Protein of unknown
FT                   function DUF1595; protein of unknown function DUF1585;
FT                   KEGG: sus:Acid_4307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66416"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG4"
FT                   /inference="protein motif:PFAM:PF07631"
FT                   /protein_id="ADG66416.1"
FT                   /translation="MKSVVTFNSALLSAVLTVVLSFEIQGSIQAADAIESFIAQHCIRC
FT                   HGPQKEEGDIRIDQLSRDFKAGLDSHHWAEALDKVNTGEMPPKEEPQPTQAEIAAFVTA
FT                   LDGRLKEGRASRMAARAAVTHYRLSRKEYQNTVYDLLGVRYDPAKPQELNEDTLWHGFE
FT                   RIGSELTLSPSHIDRYYKAAGTVLDRAFPATTVEARKVRKTAVDLRYRGGKEQQAAMDR
FT                   LGIQRPLRYLLFPGRVENALSPNWFGKTGPEHSGLYRLRLQASGIRPPGGQPAHLSIGK
FT                   ATGEETVDGLIEFDLTASEDSPQVFEFEVFLEMPISLDFCVVATDVIDRRGGAAFRNAL
FT                   ASPSYMFTHSSETRLLNPNAPQMFDGQGNGLFSTVLLDWIEWEGPLVTEAEKSRRDNLI
FT                   PPDGASPQIVAEYLQRFAERAWRRPVKPEELDQYLQSYLEELAAGEKTFEAYRVALQGL
FT                   LTSRHFIYLVEGSPTPREQLTHAELASRLSYFLWSSMPDEELLTAARNDQLQGEVLSKE
FT                   VDRLLADSKANRFVDDFTRQWLQLHKLGMFPPDKKLYKNYDDWLEESMRAEPVEYFREM
FT                   FSKNLPIDELIQSDWTMANARLCDFYGLPEPREGGFQRVTLQPEDHRGGLLTMGAILSL
FT                   TSDGTRHRPVHRGVWLSEAIFARTPPPPPANVSAIEPSPPESPKATLRQKIEAHRNHAS
FT                   CAACHAKIDPLGLAWDNYDAIGQWRTRERVEKGVGEDPQIDPSGVLPDGRSFADAVEFR
FT                   QLLLEDRDKVAKAFIEHLCTYALRRVLTVDDQDDLKAIEIEAKKSDYRVKDIIRAVALS
FT                   GMMRKR"
FT   sig_peptide     711128..711220
FT                   /locus_tag="Plim_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.883 at
FT                   residue 31"
FT   gene            713667..715025
FT                   /locus_tag="Plim_0569"
FT   CDS_pept        713667..715025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0569"
FT                   /product="protein of unknown function DUF1552"
FT                   /note="PFAM: protein of unknown function DUF1552; KEGG:
FT                   sus:Acid_0842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66417"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG5"
FT                   /inference="protein motif:PFAM:PF07586"
FT                   /protein_id="ADG66417.1"
FT                   /translation="MSNFLSQSWLIDRRHALRALGTCISLPFLECMVPLKAAEGVTATP
FT                   RRSAFIYLANGVHSLNYQITTPGKDYQFSPSLKPLEKHREVITPISGLHHPGALSHHHN
FT                   CISVWLTGGKLGPSDRNTISVDQKIAEITAPHTRYPSMEVALTGESLGWTADGVRLPSM
FT                   RRCSEIFASLFAEPKGGTATQRRALRRKASVLDANLMEVRQLEQAMGAADKGRLDQYLT
FT                   SVREAEIRTKRADAWLDTPLPALSEEDRKRTNRDVAATMAGDYFRTVYDLMVLAFQTDV
FT                   TRVATFSLGGEGDAFSIPEIGITESRHQLSHHGGDAGYMEKLTKYDTFAIEQFSYFLTR
FT                   LAETKDLNGKSLLGTTMALFGSGMSYGHSHGNANLPLVLAGGSDLGLKHGSHLDFNQGH
FT                   FSGYRLDKPGEHYSLCSRPANPNAHMSNLLLLMAQRMGVETDKFGDSNQVIAL"
FT   gene            715151..716428
FT                   /locus_tag="Plim_0570"
FT   CDS_pept        715151..716428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66418"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66418.1"
FT                   /translation="MAFWLIVFCLVLSCVFTESVRGEEPFRPEVGKFPPLEKAYKYRGE
FT                   LVFVDHPNRRGSIRVQASGMFFRNDPHPVAMLPYAEIRYHNAPADLRDIPLGTVLHVYA
FT                   FLPPDPKTSAVPVLPVNNKAIDGNHNRGAGIAPAENHVLLLEDEVSHCLREGKIWKLKE
FT                   IDMQNHEGMIVATCEPKSSQEAAQNSGTQIPEEKLTFDGATRIWRGKERLEVADLIAAG
FT                   VWPASGKKSLAGMAVQLGITWKPTPDGIFTRFHISDIWLDEASIQHAARHQAEVHKAFI
FT                   RTRWMPAFVDAVEYGKFGRATVTATLFGRMDPALYADFQKGASAMMNAAENTLKHAGGS
FT                   YGPAHMASRGTILEVNTSPHPPVGSSGIQIRFETDLIIEGIRPGRVVRVRPGNWPLVDI
FT                   PREEYLGDGSLNHEDRFPTPAIFPKY"
FT   sig_peptide     715151..715219
FT                   /locus_tag="Plim_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.930 at
FT                   residue 23"
FT   gene            716499..718052
FT                   /locus_tag="Plim_0571"
FT   CDS_pept        716499..718052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0571"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: cps:CPS_2364 sulfatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66419"
FT                   /db_xref="GOA:D5SQG7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQG7"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADG66419.1"
FT                   /translation="MFILARESFASVENVVSQENCLWRWIKFLCLGLIAVNSQAVRAED
FT                   GKNPTRPNVIFIMADDLGYTDLGCFGSRYYETPHIDQLARQGVRFLNHHHCQNCAPTRA
FT                   AIMTGQYGPRTGVYTVGSIDRFDWQSRPLRPVENVEKLPLDPATIAQQVQRSGYQTGMF
FT                   GKWHLGLNGSYHPSQRGFHEAVESSGQHFNFKTTPAQKDTEGKYLADYLTDRAIDFIER
FT                   HQSEPFFLYLPHFGVHSPFQAKKEWIEKFENKPGVGGHRNPVYAAMIASVDESVGRILD
FT                   KLDELKLADKTVVIFASDNGGVGGYEREGLHKANDVTDNAPLRSGKGSLYEGGTRVPLI
FT                   VRWPGVAPAGVECRTPTIHVDLYPTFLEITSAEHPGHPLDGESLVKLIKDPGAKLHREA
FT                   IFQHFPGYLGSGQNQWRTTPVSLIQSGDWKLMEFLEDGRLELYNLTSDVGEQKNLAATY
FT                   PDKVNELQSRLKAWREEIKAPMPAKNASPSESNNGVRKGRASQKKSQKGKAKAAASSED
FT                   "
FT   gene            complement(718129..718596)
FT                   /locus_tag="Plim_0572"
FT   CDS_pept        complement(718129..718596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66420"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66420.1"
FT                   /translation="MKSFVQFILIGVVLLAIVGFSRQWFAVVTTNRPEEGKVDLHLEVN
FT                   KQKIQEDARQARTALQSAADRTIRRNSANQQPQDDQFSRDWPEEQGNVEPPRSSANPNS
FT                   TVRDGFRNGNDQWSAPKNNDSNSDGDAPLFVPPTRRTAQQENDLLDAAKPQ"
FT   gene            complement(718803..719819)
FT                   /locus_tag="Plim_0573"
FT   CDS_pept        complement(718803..719819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: MAGEE1; melanoma antigen family E, 1"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66421"
FT                   /db_xref="GOA:D5SQV3"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG66421.1"
FT                   /translation="MRRIDLPDSPSSPDDRHARSLSLSCRPVGLGWVFTLICCCTLVTS
FT                   APLFAQQIAAISGDAVSGAEADNKPVPPFDPVEESFLVPPQPVGSTPGELPPAFDSDDA
FT                   FEEWASEVLPVSNQSAPQSPLPLPPSTQVNTPAAEQIQPPLPPAPDAGKTAGTTATEDP
FT                   NSPVPWAGNDRPVVSLKASIALPAGEIPRNRAREMASTLPTQVMVTGISRPWMWQEVEW
FT                   EAAATRHLPLYFEEPMLERLGYTHGWGRETCDYCATDCDRMKAEAFQPFVSAAAFFGRV
FT                   PILPYQMGVDLPWEPIYTLGEPLPGSPAPYEKRLIPWSLRGALFQAGATTGAVFIVP"
FT   gene            720435..742151
FT                   /locus_tag="Plim_0574"
FT   CDS_pept        720435..742151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0574"
FT                   /product="Hemagluttinin repeat-containing protein"
FT                   /note="PFAM: Haemagluttinin repeat-containing protein;
FT                   KEGG: dal:Dalk_0372 filamentous hemagglutinin family outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66422"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQV4"
FT                   /inference="protein motif:PFAM:PF05594"
FT                   /protein_id="ADG66422.1"
FT                   /translation="MSVTQWLQNLVASKQRDVATCLKPGSLRSTLLQVEPLEERRVFSV
FT                   TPVLNGSVLEITLDADGDTAYLRTDDLNNELEVYDQTNTLIDSFDYSTFHSISLIGDGA
FT                   NSGVQTVVFDNSTSLNLAGDITTSSDDIEIISINGDLNLTGELSLTVGESIFVGTNRIV
FT                   SADDGISLLALSGTNATEVNLAADSSLTTLGKIELRSDAGDIHAGFLTAGDQIEVVAQD
FT                   QITFASDIAFTTSGIVNLAVTSTLGDIELNGSIDADSSTGGAYLFNLGPSGTLFLNGDI
FT                   HAPASAGQTTVDGNLTFGNGFSFDQFFLTGSTPNGDYDTTGSAFLVTGANRVVDLGNAD
FT                   FTFTREPGYLAVVGDQFQVIALADSSSSITGNFSNRSEGDEFYSEGVRYKYSQAGGDGN
FT                   DVALTILSPTTVWVDDDFAALLNGDDPAGPRVMFGYDSFALVQQGVDQVADMGLVNVAA
FT                   HATSYNEEVVVTGKSLTLVGESASTTTIFSSTGTAFSASNAADIRLEQLTFSGVNSLDL
FT                   SAIDATTLTNITTTGPATITGTQLILISDGASNDVFTINDSGISSSGLLIIDQLDFTVD
FT                   TLEVDAGDGDDQIFVRPQPSTTILIDGGDGVDTLEADFYGLYGFANTPDGMIAGAGALT
FT                   AADREDVTYASIENYSALVEANAVIVAQNPDDNVADNWLVKRSDSDPSILEVYVNGVLA
FT                   FQQDYASTNSLTINGSGDDDTLVMDLSNGEIDLAGGLHFNGGNGNDAIELNGSQTFTKV
FT                   THTFVSENDGSIEVIGNGTTSISYTGLEPIVDNLSATTREFIFTGGNETISLTDDAAAG
FT                   YNLIDSSLSESVLFLNPTDTLIITVQNGTDTFTASSLDAAFGANIFVTMDDADSAGADA
FT                   LIWNADTTLGSVLVAGTFELVVETGTIDMNAAVDNTAGGGSIRLEASDGITQQGSLTTA
FT                   SNITIASTGGTVTTELLEATDAVSEITITGTSVTLAGNVTSGSLVDITATAGSIEQTGG
FT                   LVTSPTLILDAQTGIFGTTAMVARAMEISASTITAKTNTGGMQVENAATTATTATLTAT
FT                   TGNILFNQTGGQSLTLTNVATSGNANLTNNATMTLNSALISGSGELTLEGTQVILGGNI
FT                   TASGRATITATDSITQTAGTLTSPILELDAQNGIGLAADAMEISTSDISATTATVGVFL
FT                   SNASNITTGAVTASNLQATTSGNISFVQTGGQSLSVTNVSTTSGDATISNAGDLTVAAA
FT                   MVLGTNGQLSLTTTAGGNLSLGTATTDGNLLVTSAGAFTQTGNTTVGGLLDVDAVNAID
FT                   IQGTQGITGTTSITSSGSTVRLRQALTSGGAVTLAGTGGITLDATGDVTSTAGGITIIG
FT                   DLTTAANLVTDDQPIEVQGNVLLTGSVLFDSDSTNTGTGADVTVTGDIDLATFTLTIDA
FT                   GPDGDFSVGDVTGTTGDLVIEEAHSLSFGSLTADTINIGPITGDVTIGAGGLTANSASF
FT                   DLDGNFTNSGATNVTNHLLVQAGGSIEFVGDVEAGSLELDAGTTIDLGNVVVDTTTVLT
FT                   SVGVLTVGGTLNTGGTLTVESTAGDVRFVQTVTAGGEVQLTADQELRLDNLLTVTAGGA
FT                   SLTGATVLLDNATIVQLNGAGDDLSITGTLTTGANLFTTGGDITITGNTTLTEGINVGS
FT                   TGGDILFNGLVTGAGFDLSIDSAAGSLELGGAVTAVDDLVLKGASVTTLSLSAATLNGT
FT                   TTAGPWETTGNITITAAMELDATGGLSIIGSISAGSLQAVATGTSLFTGTITTTTGNVI
FT                   VGTTTSGAIDFQDDVTSAGNVTVTSLGAVDFGGHLFANGVTGTIEVIGASVDFADDVEA
FT                   ATSIEITANTGAINQTGGTFTTLTLILDAGAGIGTTGVVNTSARTITATTNTGGINLAN
FT                   LSTVTNGAVTATLTATTSGNIQLVQTGGQGLTITSAETNNGDIVISNTGANLTVTTAEA
FT                   LGADGDITLSTITSGNLELGTADATGDLNITSAGSYTQSGNVEADGLVDIQSDDLLLTQ
FT                   GTVTAGTTINLESTNGGIEVQQAVEADGNVDLQALSNILLTGSVTTASNITIESTIGDI
FT                   TTAVLTATGLTSEIRINGQDISLGGDIDAGSLVSIFAGDRINQTAGTITSPTLVLDALS
FT                   GIGTISTIQVASNNIDAKASSGRIFLVNDSSVLTGGVTAILQGNSGNIQFTQTGGQELT
FT                   VTSATTTVGNITLSNDGADLNANNTTTSSGGISLLTTTSGSITAGLVGSGGGSGAISII
FT                   SAQSVTTTNQIITDGTIVITAGTTTADDIILGGNLRGAGGPNQPVSITLTAGGKIDSIG
FT                   SMTTNGLLQAEAGTSIEIDGTITANALDLTAGTTALDSITLGVVDVNTTTSLTSGGALQ
FT                   VTGNFDTGTTTTINTGSATFSGTYRSGNRTELTSTGDVLFEQTLNVDGGGMELFATGTT
FT                   TFYAAVTVVGDALIGDSLTGGTVQAQGPVDVTGWLTINSQDNVLLDDTVDVGGDLVVHA
FT                   GRDGTGDLVIGGDIGVTRTPTGITLTAGDLIDVAGSITTTGLSGNLFLTSGTTMTLTGP
FT                   VNASAEVRLENCGLLSITDPAGITAAGRIMQAGAGDVSLHGNITSTSGEVNFAEDVVLT
FT                   SDVVVTSGSSITFQKTINGTTAGSEDLTLDATTTVTLGGAVGAVTRLGVLTIDGTTVTT
FT                   AGITAAALDGETTSSGNWDTTGDVDITGLAKVIAAGSFTLTGNLNAAEVEATANSDLTI
FT                   TGTTSTSAGGDVTLTTLTTGNVEVGAIDADGDVRVTTVGSYTQNGNVEAAGLIDIQSNG
FT                   LLLTVRTVTAGTTLDLESTNNAIEIQQAVSAGGNITLIGSTNVTLGVNGDVAATNAGST
FT                   ITVTGDLTTAGDLVTNNGAILINDDVTLTGNAKFDSNSSDGVGGGADITVSGAGGIDLG
FT                   AFTLTIDAGFVGDFATDLVTGTPLSALVITNAQDASVGTGNLTAGTVTIDLVGNFTNHG
FT                   TATVNDLIDVAAGGNILFQQAIDAESVDLSANEDVTLNGDVTAVTSVKMVANADGTLPG
FT                   GNVTTQAITTSGLSSTIELRGDAVDLGGDIEAGESVLVVATSGAITQLAGTTITTDNLG
FT                   LFAAGDIGTGLQFFQTDVNRLAVRSTSGDVFLENASDLEIGGVTFESFTGASAVNLTVN
FT                   VVAGALNVSGNVNTTDDITLDATSGITISGDVLSTGGTILLDADSDADANGVFNVTATG
FT                   SVEATSEAIRITASDVMLAGSLTASGAGTFGPNNAPVGFVEIRQSTAAATIGLGLAAGD
FT                   LSLDAAELANITTNQLIVGRTDGGDVSIAAAGNLSPHIGTLVLLTNGNVAGAVDGSPDV
FT                   SVGQLAIVAGGQVALDFDVTTLALSAGNAVTGHVLQDTAGSLTIGSLAEAVGGTLVAGV
FT                   QTGTGQTTIEALGGDTGDLIINSLIVAGGNSLTLMADDDVTVNADVTLATGTLVIEADA
FT                   DGSSNGEITIASGADVAVTSGLATDSITLCAADLDVAGTVNVGLGTVELLTSTAAGTFG
FT                   LGSGSGSYEVTQSELDQITANRLLVGSATKTNAGIELGDVSWSGAGKEARLTTDGAITQ
FT                   DAGSTLAITTPTLVLDAATGINLQVNADSLSARNRTSGDIVLVDTTGGLTIANDLVVGG
FT                   LVNQTAGGAIDLRVAANTLTTLAGAQIATNVGHIRLRADEYVLGAGINAGTETVLLQND
FT                   TAGRTISLNGAAAGINLSQAELQGIVAGTLEVGRADTGDVSVGDIDGLNVTTLAIITNG
FT                   SIEQNLTSVITVANLALVAQTGINLTTRVDTLALRNGTSGSVTINQGNRALTLGEVNLK
FT                   ASTVTGTTQNGSGDLEITAANSVTITEEITSSGNVLIDAVGAISQQADIDATGETVTLE
FT                   SDATIGMASGTSITATSATLTAVGDVTLAEIVAGTIEVTSTGGSIQDVDVSDSTVNLNA
FT                   GAGSITLAAATGIGTTGGAAGTLELSGKTISATSTNGGMNLSNASNITTGAVTASNLQA
FT                   TTSGNISFVQTGGQSLSVTNVSTTSGDATISNAGDLTVAAAMVLGTNGQLSLTTTAGGN
FT                   LSLGTATTDGNLLVTSAGAFTQTGNTTVGGLLDVDAVNAIDIQGTQGITGTTSITSSGS
FT                   TVRLRQALTSGGAVTLAGTGGITLDATGDVTSTAGGITIIGDLTTAANLVTDDQPIEVQ
FT                   GNVLLTGSVLFDSDSTNTGTGADVTVTGDIDLATFTLTIDAGPDGDFSVGDVTGTTGDL
FT                   VIEEAHSLSFGSLTADTINIGPITGDVTIGAGGLTANSASFDLDGNFTNSGATNVTNHL
FT                   LVQAGGSIEFVGDVEAGSLELDAGTTIDLGNVVVDTTTVLTSVGTLTVGGDFDTGTTSD
FT                   ISSGDVTFVGTYRSGGRTEIASTGNVLFQSTLDVDADGLEIIADGTTTFDQAVTVVGNA
FT                   VIGDTNSGTVQAVGLVDVAGDLTIMTAGDIDLDDTVDVGGNLLFDAGQNVNVAGATDVV
FT                   GNATVTADDDIDFGSTLDVGGVLSLTAGTANTDDIRLAGNVGATRTPTSITLDAGGLIQ
FT                   ALGTVTTSGLLEADAGTSIEVQGLLTANALDLDAVTDITLDDVSVMTNSLLRAGDAILV
FT                   NGTFNTGSLDAVAAGTTTFNEAVTVTTGNGVIGDATSGTVQALAALDVSGDLTITTAAD
FT                   IDLDGTVDVGGNLLFDAGQNVNVEGATDVVGSATVTADDDIDFGSTLDVGGALSLTAGV
FT                   ANTDDIRLAGNVGATRTPTSITLDAGGLIDASGTVAAGGILTADAGTSLNFDQAVTTTG
FT                   AGSDILLTSGTTMRLAGAVNSSGEVELDNGGLLSILDPAGITAAGRVVQIGTGDVSLHG
FT                   DITSTSGEVNFAEDVVLTSDVVVTSGSTITFQKTINGTTAGAEDLTLDAVGDVTLGGAV
FT                   GNTTRLGALVIEAAAVSTQALTVASLDGTSQTGNWTTTGNIDATGAVLLEVAGNLDING
FT                   NLEADSLDAVADGTSLFAGTVDVTNNAVIGAATSGAVTINDLVTVGGDLTVRSADDITI
FT                   GDGLLTDGMDVTGAVVMNSVSGDVTVRGTTEAGSLNTNAGNDILFDGSVTTVGGMVLTA
FT                   GQDIDVTGAVDAGATFSATATAGAISLDSTLTTGAAADLTSGTTTTVLGVASIDGNLDV
FT                   LAGDTIRFAQTLDATGAVTLETGASATDEILLEGAVGGVASPTSITLTSGGKVLASSRV
FT                   TTSGTLEADAGTSIEVQGLLTANALDLDAGTDITLDDVLVTTSSLLRAGGNIEVNGTFD
FT                   TGSLDAIAGGTTTFNDSVTVTAGNAVIGDTNSGTVQALDSLDVAGDLTITTAGDIDLDG
FT                   TVDVGGNLLFDAGLSVNVAGATDVVGAATVTADDDIDFGSTLDVGGALSLTAGMANTDD
FT                   IRLAGNVGSTRTPTSITLNAGGLIQALGSITTSGLLEADAGTSIEVVGDLDAGSLELDA
FT                   GTTIDLGNVTVDTTTVLTSVGTLTVGGDFDTGTTSTISSGDATFTGTYRSGGRTEIAST
FT                   GNVLFQSTLDVDADGLEIIADGTTTFSQTVTVVGNAVIGDTNSGTVQALAALDVAGDLT
FT                   ITTAADIDLDGTVDVGGNLLFDAGQNVNVAGATDVVGNATVTADDDIDFGSTLDVGGAL
FT                   SLTAGTANTDDIRLAGNVGATRTPTSITLDAGGLIQALGTVTTSGTLEADAGTSIEVQG
FT                   PLTADSLDLDAVTDITLDDVDVTNASVIAAVGDLLVNGTYDVGTTSTITANDATFVGAY
FT                   ETGGRSELDLTGDFEAQSTFTVVSGGLELLANGTTTFVGVVEITGAAVIGELTSGTINA
FT                   QETFTVTGGDLTLQSADDIDFDRALDVSGAIVATAGNDFLAQETIDAASLTIDASRDVL
FT                   IDGAVATSGLVDVTAGRDAVFGDTLDAGTTLTVKATTGDVRFVGAVTAGSVVVVTATVG
FT                   EIRVDDLLTVTDGFVLLEGSSVLLDNDTVVQLNGAGRGLTILGTLTTGADLLTNGGDIL
FT                   TGGGGMTLTDSITIETAGGNLEFNSTINGQVASTFDLTIDTDDGRVDFNNSVGDINPLR
FT                   NLVISEAGDVLLTDVQADLLSIADSSGTVTFVGDVITTAANGLDVTAEAIVMLAGSSLN
FT                   STGQDVVLTANDIDLNGDGITATGVTVFLQTRDDATAIGLENSSTAMNFTDAQLDKILS
FT                   NSLVIGTATNTGGITVGTDAPLTMNQPEVQLLTAGDVTVNGSLTVLGTGTLAVDAGDDV
FT                   AVFGTLATTNGALVVNADDNITMGAAGRVTSTGGTITLAADADLNGAGSFTMTNGAIVE
FT                   SQTQLVTITAAGNVTVGQVISGRTGGLAIDVVSRNGAIIDGGDTGGSDLIANGAGAITR
FT                   LDAATGIGSATGLASDAALETTVFELQATNRTSGDIRIDETDALRLQDIDNQGPGAIAV
FT                   QSVGTMTLLTGFDVTAASGLVSLLATGAAADLLLNGSVTTTTSSITLGAGRNVQFSGVT
FT                   TIQTNGNIGITATNGTVRMLNGSVVNAGAGTIAVTANGDVSISRLVTTNATTSAVQITS
FT                   QTGGIRDSGESGGADIQADSAGALVTLRAATGIGSVSDGGADAPLELQVARLDAINSTN
FT                   GDIRFSEATGLNIERLTQQGAGQIEGVVNGATIITAAGQGISSQTGDISLTVNGADADL
FT                   TVLNNVSTTGGDITLNVRGDVTAAANVTIASQGGNIVIAADSDLNNVGGIALADGSLID
FT                   AGAGTIVLSAAENIAVSRLVSTNAGGAAVSLTSRLGAITDAGDTGGVDIDAPTVVLRAA
FT                   TGIGSGNALETNIATLAARNTTSGGIQIDNTAGAGLNVATVDGLTGITNAGANGLVSLV
FT                   TSGDVFINGAVLNTAGGTIEITSLTGDITLNQRLAAKGGNGSISLDADEDINLNDTGSQ
FT                   PDVEVQGAGSVVGVAGGLVNFAPNVQVASQTGAVTDVPPLLINVQTPQVQADGSAQVSG
FT                   TFGRPGEKNFIITVDWGDGTVETFYFDQPGNFLFKHTYNGNPDPNNPASPIPITVTIEQ
FT                   DPLIRFFEARVVEQNTTTVTSFASVPGEGLAGSIPFDLTPPVRPVPEPAQTRLDEALLS
FT                   QSVGLSLSDVLQDESTAGEAVGDDEIQVVIQVLGADGEVLQSVALNESVLDDLPKIFKK
FT                   LPDGQYKVVVREPGEPVERTVLEVELRQGRIVNEQEQDLDRPPRETGNPSGVNPEANMP
FT                   GAGNHRAAGESERMAQFSREGQENQQAAQGFGYRSWRIQSRLDEALGAKSVEQETGRGQ
FT                   DVLFEVKNSESSRDASLMRVLSLVTDVSDPLMKEVNEAEIPLNEDFDSMERRESLEIDT
FT                   EIACMEENSGGYWITQVAIAGTIMLGGVAVTNSLTDKVSPLARGRRLMRRLSGR"
FT   gene            742365..747935
FT                   /locus_tag="Plim_0575"
FT   CDS_pept        742365..747935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Plim_0575"
FT                   /product="Serine/threonine protein kinase-related protein"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; WD-40 repeat protein; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   WD-40 repeat protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Plim_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG66423"
FT                   /db_xref="GOA:D5SQV5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D5SQV5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG66423.1"
FT                   /translation="MLRCPSCGTRVTGADLVSGICSRCHSRLSDENDHSELESDTLDTM
FT                   LSDPGIVEPAAASDDSLDLSGAGHPSSASLAQPEKPLPEKPSDSAMATPVLPGETISPP
FT