(data stored in ACNUC7421 zone)

EMBL: CP001746

ID   CP001746; SV 1; circular; genomic DNA; STD; PRO; 5196054 BP.
XX
AC   CP001746;
XX
PR   Project:PRJNA36309;
XX
DT   13-JUL-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Bacillus cereus biovar anthracis str. CI, complete genome.
XX
KW   .
XX
OS   Bacillus cereus biovar anthracis str. CI
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5196054
RX   DOI; 10.1371/journal.pone.0010986.
RX   PUBMED; 20634886.
RA   Klee S.R., Brzuszkiewicz E.B., Nattermann H., Bruggemann H., Dupke S.,
RA   Wollherr A., Franz T., Pauli G., Appel B., Liebl W., Couacy-Hymann E.,
RA   Boesch C., Meyer F.D., Leendertz F.H., Ellerbrok H., Gottschalk G.,
RA   Grunow R., Liesegang H.;
RT   "The genome of a Bacillus isolate causing anthrax in chimpanzees combines
RT   chromosomal properties of B. cereus with B. anthracis virulence plasmids";
RL   PLoS One 5(7):E10986-E10986(2010).
XX
RN   [2]
RP   1-5196054
RA   Klee S.R., Brzuszkiewicz E.B., Nattermann H., Brueggemann H., Dupke S.,
RA   Franz T., Pauli G., Appel B., Liebl W., Couacy-Hymann E., Meyer F.-D.,
RA   Leendertz F.H., Gottschalk G., Grunow R., Liesegang H.;
RT   ;
RL   Submitted (11-SEP-2009) to the INSDC.
RL   Goettingen Genomics Laboratory, Georg-August University Goettingen,
RL   Grisebachstrasse 8, Goettingen, Lower Saxony D-37077, Germany
XX
DR   MD5; 7d8c069233c792787d0edd4346cc7697.
DR   BioSample; SAMN02603256.
DR   EnsemblGenomes-Gn; BACI_c00070.
DR   EnsemblGenomes-Gn; BACI_c00080.
DR   EnsemblGenomes-Gn; BACI_c00090.
DR   EnsemblGenomes-Gn; BACI_c00100.
DR   EnsemblGenomes-Gn; BACI_c00110.
DR   EnsemblGenomes-Gn; BACI_c00190.
DR   EnsemblGenomes-Gn; BACI_c00250.
DR   EnsemblGenomes-Gn; BACI_c00310.
DR   EnsemblGenomes-Gn; BACI_c00320.
DR   EnsemblGenomes-Gn; BACI_c00330.
DR   EnsemblGenomes-Gn; BACI_c00340.
DR   EnsemblGenomes-Gn; BACI_c00700.
DR   EnsemblGenomes-Gn; BACI_c00710.
DR   EnsemblGenomes-Gn; BACI_c00890.
DR   EnsemblGenomes-Gn; BACI_c00900.
DR   EnsemblGenomes-Gn; BACI_c00910.
DR   EnsemblGenomes-Gn; BACI_c00920.
DR   EnsemblGenomes-Gn; BACI_c00930.
DR   EnsemblGenomes-Gn; BACI_c00940.
DR   EnsemblGenomes-Gn; BACI_c00950.
DR   EnsemblGenomes-Gn; BACI_c00960.
DR   EnsemblGenomes-Gn; BACI_c00970.
DR   EnsemblGenomes-Gn; BACI_c00980.
DR   EnsemblGenomes-Gn; BACI_c00990.
DR   EnsemblGenomes-Gn; BACI_c01000.
DR   EnsemblGenomes-Gn; BACI_c01010.
DR   EnsemblGenomes-Gn; BACI_c01020.
DR   EnsemblGenomes-Gn; BACI_c01030.
DR   EnsemblGenomes-Gn; BACI_c01800.
DR   EnsemblGenomes-Gn; BACI_c01810.
DR   EnsemblGenomes-Gn; BACI_c01820.
DR   EnsemblGenomes-Gn; BACI_c01830.
DR   EnsemblGenomes-Gn; BACI_c01840.
DR   EnsemblGenomes-Gn; BACI_c01850.
DR   EnsemblGenomes-Gn; BACI_c01860.
DR   EnsemblGenomes-Gn; BACI_c01870.
DR   EnsemblGenomes-Gn; BACI_c01880.
DR   EnsemblGenomes-Gn; BACI_c01890.
DR   EnsemblGenomes-Gn; BACI_c01900.
DR   EnsemblGenomes-Gn; BACI_c01910.
DR   EnsemblGenomes-Gn; BACI_c01970.
DR   EnsemblGenomes-Gn; BACI_c02870.
DR   EnsemblGenomes-Gn; BACI_c02880.
DR   EnsemblGenomes-Gn; BACI_c02890.
DR   EnsemblGenomes-Gn; BACI_c02900.
DR   EnsemblGenomes-Gn; BACI_c02910.
DR   EnsemblGenomes-Gn; BACI_c02920.
DR   EnsemblGenomes-Gn; BACI_c02930.
DR   EnsemblGenomes-Gn; BACI_c02940.
DR   EnsemblGenomes-Gn; BACI_c02950.
DR   EnsemblGenomes-Gn; BACI_c02960.
DR   EnsemblGenomes-Gn; BACI_c02970.
DR   EnsemblGenomes-Gn; BACI_c02980.
DR   EnsemblGenomes-Gn; BACI_c02990.
DR   EnsemblGenomes-Gn; BACI_c03000.
DR   EnsemblGenomes-Gn; BACI_c03010.
DR   EnsemblGenomes-Gn; BACI_c03020.
DR   EnsemblGenomes-Gn; BACI_c03230.
DR   EnsemblGenomes-Gn; BACI_c03240.
DR   EnsemblGenomes-Gn; BACI_c03250.
DR   EnsemblGenomes-Gn; BACI_c03280.
DR   EnsemblGenomes-Gn; BACI_c03290.
DR   EnsemblGenomes-Gn; BACI_c03300.
DR   EnsemblGenomes-Gn; BACI_c04230.
DR   EnsemblGenomes-Gn; BACI_c04360.
DR   EnsemblGenomes-Gn; BACI_c05300.
DR   EnsemblGenomes-Gn; BACI_c05310.
DR   EnsemblGenomes-Gn; BACI_c05320.
DR   EnsemblGenomes-Gn; BACI_c05330.
DR   EnsemblGenomes-Gn; BACI_c05340.
DR   EnsemblGenomes-Gn; BACI_c05350.
DR   EnsemblGenomes-Gn; BACI_c05360.
DR   EnsemblGenomes-Gn; BACI_c05370.
DR   EnsemblGenomes-Gn; BACI_c05380.
DR   EnsemblGenomes-Gn; BACI_c05390.
DR   EnsemblGenomes-Gn; BACI_c05400.
DR   EnsemblGenomes-Gn; BACI_c05410.
DR   EnsemblGenomes-Gn; BACI_c05420.
DR   EnsemblGenomes-Gn; BACI_c05430.
DR   EnsemblGenomes-Gn; BACI_c05440.
DR   EnsemblGenomes-Gn; BACI_c05450.
DR   EnsemblGenomes-Gn; BACI_c05460.
DR   EnsemblGenomes-Gn; BACI_c05470.
DR   EnsemblGenomes-Gn; BACI_c05530.
DR   EnsemblGenomes-Gn; BACI_c07280.
DR   EnsemblGenomes-Gn; BACI_c07290.
DR   EnsemblGenomes-Gn; BACI_c07300.
DR   EnsemblGenomes-Gn; BACI_c07310.
DR   EnsemblGenomes-Gn; BACI_c07320.
DR   EnsemblGenomes-Gn; BACI_c07330.
DR   EnsemblGenomes-Gn; BACI_c07340.
DR   EnsemblGenomes-Gn; BACI_c07350.
DR   EnsemblGenomes-Gn; BACI_c07360.
DR   EnsemblGenomes-Gn; BACI_c07370.
DR   EnsemblGenomes-Gn; BACI_c07380.
DR   EnsemblGenomes-Gn; BACI_c07390.
DR   EnsemblGenomes-Gn; BACI_c07400.
DR   EnsemblGenomes-Gn; BACI_c07410.
DR   EnsemblGenomes-Gn; BACI_c07420.
DR   EnsemblGenomes-Gn; BACI_c07430.
DR   EnsemblGenomes-Gn; BACI_c07440.
DR   EnsemblGenomes-Gn; BACI_c07450.
DR   EnsemblGenomes-Gn; BACI_c07460.
DR   EnsemblGenomes-Gn; BACI_c07470.
DR   EnsemblGenomes-Gn; BACI_c07480.
DR   EnsemblGenomes-Gn; BACI_c07490.
DR   EnsemblGenomes-Gn; BACI_c10270.
DR   EnsemblGenomes-Gn; BACI_c10460.
DR   EnsemblGenomes-Gn; BACI_c13070.
DR   EnsemblGenomes-Gn; BACI_c13890.
DR   EnsemblGenomes-Gn; BACI_c16030.
DR   EnsemblGenomes-Gn; BACI_c16190.
DR   EnsemblGenomes-Gn; BACI_c16200.
DR   EnsemblGenomes-Gn; BACI_c24190.
DR   EnsemblGenomes-Gn; BACI_c25600.
DR   EnsemblGenomes-Gn; BACI_c26210.
DR   EnsemblGenomes-Gn; BACI_c26630.
DR   EnsemblGenomes-Gn; BACI_c27250.
DR   EnsemblGenomes-Gn; BACI_c28260.
DR   EnsemblGenomes-Gn; BACI_c30210.
DR   EnsemblGenomes-Gn; BACI_c31650.
DR   EnsemblGenomes-Gn; BACI_c35280.
DR   EnsemblGenomes-Gn; BACI_c35790.
DR   EnsemblGenomes-Gn; BACI_c42460.
DR   EnsemblGenomes-Gn; BACI_c44710.
DR   EnsemblGenomes-Gn; BACI_c44720.
DR   EnsemblGenomes-Gn; BACI_c48770.
DR   EnsemblGenomes-Gn; BACI_c48780.
DR   EnsemblGenomes-Gn; BACI_c48790.
DR   EnsemblGenomes-Gn; BACI_c48800.
DR   EnsemblGenomes-Gn; BACI_c48810.
DR   EnsemblGenomes-Gn; BACI_c48820.
DR   EnsemblGenomes-Gn; BACI_c48830.
DR   EnsemblGenomes-Gn; BACI_c48840.
DR   EnsemblGenomes-Gn; BACI_c48850.
DR   EnsemblGenomes-Gn; BACI_c48860.
DR   EnsemblGenomes-Gn; BACI_c48870.
DR   EnsemblGenomes-Gn; BACI_c48880.
DR   EnsemblGenomes-Gn; BACI_c48890.
DR   EnsemblGenomes-Gn; BACI_c48900.
DR   EnsemblGenomes-Gn; BACI_c48910.
DR   EnsemblGenomes-Gn; BACI_c48920.
DR   EnsemblGenomes-Gn; BACI_c48930.
DR   EnsemblGenomes-Gn; BACI_c48940.
DR   EnsemblGenomes-Gn; BACI_c48950.
DR   EnsemblGenomes-Gn; BACI_c48960.
DR   EnsemblGenomes-Gn; BACI_c48970.
DR   EnsemblGenomes-Gn; BACI_c48980.
DR   EnsemblGenomes-Gn; BACI_c48990.
DR   EnsemblGenomes-Gn; BACI_c49000.
DR   EnsemblGenomes-Gn; BACI_c49010.
DR   EnsemblGenomes-Gn; BACI_c51250.
DR   EnsemblGenomes-Gn; BACI_c54690.
DR   EnsemblGenomes-Gn; BACI_c54700.
DR   EnsemblGenomes-Gn; BACI_c54710.
DR   EnsemblGenomes-Gn; BACI_c54720.
DR   EnsemblGenomes-Gn; EBG00001151717.
DR   EnsemblGenomes-Gn; EBG00001151718.
DR   EnsemblGenomes-Gn; EBG00001151719.
DR   EnsemblGenomes-Gn; EBG00001151720.
DR   EnsemblGenomes-Gn; EBG00001151721.
DR   EnsemblGenomes-Gn; EBG00001151722.
DR   EnsemblGenomes-Gn; EBG00001151723.
DR   EnsemblGenomes-Gn; EBG00001151724.
DR   EnsemblGenomes-Gn; EBG00001151725.
DR   EnsemblGenomes-Gn; EBG00001151726.
DR   EnsemblGenomes-Gn; EBG00001151727.
DR   EnsemblGenomes-Gn; EBG00001151728.
DR   EnsemblGenomes-Gn; EBG00001151729.
DR   EnsemblGenomes-Gn; EBG00001151730.
DR   EnsemblGenomes-Gn; EBG00001151731.
DR   EnsemblGenomes-Gn; EBG00001151732.
DR   EnsemblGenomes-Gn; EBG00001151733.
DR   EnsemblGenomes-Gn; EBG00001151734.
DR   EnsemblGenomes-Gn; EBG00001151735.
DR   EnsemblGenomes-Gn; EBG00001151736.
DR   EnsemblGenomes-Gn; EBG00001151737.
DR   EnsemblGenomes-Gn; EBG00001151738.
DR   EnsemblGenomes-Gn; EBG00001151739.
DR   EnsemblGenomes-Gn; EBG00001151740.
DR   EnsemblGenomes-Gn; EBG00001151741.
DR   EnsemblGenomes-Gn; EBG00001151742.
DR   EnsemblGenomes-Gn; EBG00001151743.
DR   EnsemblGenomes-Gn; EBG00001151744.
DR   EnsemblGenomes-Gn; EBG00001151745.
DR   EnsemblGenomes-Gn; EBG00001151746.
DR   EnsemblGenomes-Gn; EBG00001151747.
DR   EnsemblGenomes-Gn; EBG00001151748.
DR   EnsemblGenomes-Gn; EBG00001151749.
DR   EnsemblGenomes-Gn; EBG00001151750.
DR   EnsemblGenomes-Gn; EBG00001151751.
DR   EnsemblGenomes-Gn; EBG00001151752.
DR   EnsemblGenomes-Gn; EBG00001151753.
DR   EnsemblGenomes-Gn; EBG00001151754.
DR   EnsemblGenomes-Gn; EBG00001151755.
DR   EnsemblGenomes-Gn; EBG00001151756.
DR   EnsemblGenomes-Gn; EBG00001151757.
DR   EnsemblGenomes-Gn; EBG00001151758.
DR   EnsemblGenomes-Gn; EBG00001151759.
DR   EnsemblGenomes-Gn; EBG00001151760.
DR   EnsemblGenomes-Gn; EBG00001151761.
DR   EnsemblGenomes-Gn; EBG00001151762.
DR   EnsemblGenomes-Gn; EBG00001151763.
DR   EnsemblGenomes-Gn; EBG00001151764.
DR   EnsemblGenomes-Gn; EBG00001151765.
DR   EnsemblGenomes-Gn; EBG00001151766.
DR   EnsemblGenomes-Gn; EBG00001151767.
DR   EnsemblGenomes-Gn; EBG00001151768.
DR   EnsemblGenomes-Gn; EBG00001151769.
DR   EnsemblGenomes-Gn; EBG00001151770.
DR   EnsemblGenomes-Gn; EBG00001151771.
DR   EnsemblGenomes-Gn; EBG00001151772.
DR   EnsemblGenomes-Gn; EBG00001151773.
DR   EnsemblGenomes-Gn; EBG00001151774.
DR   EnsemblGenomes-Gn; EBG00001151775.
DR   EnsemblGenomes-Gn; EBG00001151776.
DR   EnsemblGenomes-Gn; EBG00001151777.
DR   EnsemblGenomes-Gn; EBG00001151778.
DR   EnsemblGenomes-Gn; EBG00001151779.
DR   EnsemblGenomes-Gn; EBG00001151780.
DR   EnsemblGenomes-Gn; EBG00001151781.
DR   EnsemblGenomes-Gn; EBG00001151782.
DR   EnsemblGenomes-Gn; EBG00001151783.
DR   EnsemblGenomes-Gn; EBG00001151784.
DR   EnsemblGenomes-Gn; EBG00001151785.
DR   EnsemblGenomes-Gn; EBG00001151786.
DR   EnsemblGenomes-Gn; EBG00001151787.
DR   EnsemblGenomes-Gn; EBG00001151788.
DR   EnsemblGenomes-Gn; EBG00001151789.
DR   EnsemblGenomes-Gn; EBG00001151790.
DR   EnsemblGenomes-Gn; EBG00001151791.
DR   EnsemblGenomes-Gn; EBG00001151792.
DR   EnsemblGenomes-Gn; EBG00001151793.
DR   EnsemblGenomes-Gn; EBG00001151794.
DR   EnsemblGenomes-Gn; EBG00001151795.
DR   EnsemblGenomes-Gn; EBG00001151796.
DR   EnsemblGenomes-Gn; EBG00001151797.
DR   EnsemblGenomes-Gn; EBG00001151798.
DR   EnsemblGenomes-Gn; EBG00001151799.
DR   EnsemblGenomes-Gn; EBG00001151800.
DR   EnsemblGenomes-Gn; EBG00001151801.
DR   EnsemblGenomes-Gn; EBG00001151802.
DR   EnsemblGenomes-Gn; EBG00001151803.
DR   EnsemblGenomes-Gn; EBG00001151804.
DR   EnsemblGenomes-Gn; EBG00001151805.
DR   EnsemblGenomes-Gn; EBG00001151806.
DR   EnsemblGenomes-Gn; EBG00001151807.
DR   EnsemblGenomes-Gn; EBG00001151808.
DR   EnsemblGenomes-Gn; EBG00001151809.
DR   EnsemblGenomes-Gn; EBG00001151810.
DR   EnsemblGenomes-Gn; EBG00001151811.
DR   EnsemblGenomes-Gn; EBG00001151812.
DR   EnsemblGenomes-Gn; EBG00001151813.
DR   EnsemblGenomes-Gn; EBG00001151814.
DR   EnsemblGenomes-Gn; EBG00001151815.
DR   EnsemblGenomes-Gn; EBG00001151816.
DR   EnsemblGenomes-Gn; EBG00001151817.
DR   EnsemblGenomes-Gn; EBG00001151818.
DR   EnsemblGenomes-Gn; EBG00001151819.
DR   EnsemblGenomes-Gn; EBG00001151820.
DR   EnsemblGenomes-Gn; EBG00001151821.
DR   EnsemblGenomes-Gn; EBG00001151822.
DR   EnsemblGenomes-Gn; EBG00001151823.
DR   EnsemblGenomes-Gn; EBG00001151824.
DR   EnsemblGenomes-Gn; EBG00001151825.
DR   EnsemblGenomes-Gn; EBG00001151826.
DR   EnsemblGenomes-Gn; EBG00001151827.
DR   EnsemblGenomes-Gn; EBG00001151828.
DR   EnsemblGenomes-Gn; EBG00001151829.
DR   EnsemblGenomes-Gn; EBG00001151830.
DR   EnsemblGenomes-Gn; EBG00001151831.
DR   EnsemblGenomes-Gn; EBG00001151832.
DR   EnsemblGenomes-Gn; EBG00001151833.
DR   EnsemblGenomes-Gn; EBG00001151834.
DR   EnsemblGenomes-Gn; EBG00001151835.
DR   EnsemblGenomes-Gn; EBG00001151836.
DR   EnsemblGenomes-Gn; EBG00001151837.
DR   EnsemblGenomes-Gn; EBG00001151838.
DR   EnsemblGenomes-Gn; EBG00001151839.
DR   EnsemblGenomes-Gn; EBG00001151840.
DR   EnsemblGenomes-Gn; EBG00001151841.
DR   EnsemblGenomes-Gn; EBG00001151842.
DR   EnsemblGenomes-Gn; EBG00001151843.
DR   EnsemblGenomes-Gn; EBG00001151844.
DR   EnsemblGenomes-Gn; EBG00001151845.
DR   EnsemblGenomes-Gn; EBG00001151846.
DR   EnsemblGenomes-Gn; EBG00001151847.
DR   EnsemblGenomes-Gn; EBG00001151848.
DR   EnsemblGenomes-Gn; EBG00001151849.
DR   EnsemblGenomes-Gn; EBG00001151850.
DR   EnsemblGenomes-Gn; EBG00001151851.
DR   EnsemblGenomes-Gn; EBG00001151852.
DR   EnsemblGenomes-Gn; EBG00001151853.
DR   EnsemblGenomes-Gn; EBG00001151854.
DR   EnsemblGenomes-Gn; EBG00001151855.
DR   EnsemblGenomes-Gn; EBG00001151856.
DR   EnsemblGenomes-Gn; EBG00001151857.
DR   EnsemblGenomes-Gn; EBG00001151858.
DR   EnsemblGenomes-Gn; EBG00001151859.
DR   EnsemblGenomes-Gn; EBG00001151860.
DR   EnsemblGenomes-Gn; EBG00001151861.
DR   EnsemblGenomes-Gn; EBG00001151862.
DR   EnsemblGenomes-Gn; EBG00001151863.
DR   EnsemblGenomes-Gn; EBG00001151864.
DR   EnsemblGenomes-Gn; EBG00001151865.
DR   EnsemblGenomes-Gn; EBG00001151866.
DR   EnsemblGenomes-Gn; EBG00001151867.
DR   EnsemblGenomes-Gn; EBG00001151868.
DR   EnsemblGenomes-Gn; EBG00001151869.
DR   EnsemblGenomes-Gn; EBG00001151870.
DR   EnsemblGenomes-Gn; EBG00001151871.
DR   EnsemblGenomes-Gn; EBG00001151872.
DR   EnsemblGenomes-Gn; EBG00001151873.
DR   EnsemblGenomes-Gn; EBG00001151874.
DR   EnsemblGenomes-Gn; EBG00001151875.
DR   EnsemblGenomes-Gn; EBG00001151876.
DR   EnsemblGenomes-Gn; EBG00001151877.
DR   EnsemblGenomes-Gn; EBG00001151878.
DR   EnsemblGenomes-Gn; EBG00001151879.
DR   EnsemblGenomes-Gn; EBG00001151880.
DR   EnsemblGenomes-Gn; EBG00001151881.
DR   EnsemblGenomes-Gn; EBG00001151882.
DR   EnsemblGenomes-Gn; EBG00001151883.
DR   EnsemblGenomes-Gn; EBG00001151884.
DR   EnsemblGenomes-Gn; EBG00001151885.
DR   EnsemblGenomes-Gn; EBG00001151886.
DR   EnsemblGenomes-Gn; EBG00001151887.
DR   EnsemblGenomes-Gn; EBG00001151888.
DR   EnsemblGenomes-Gn; EBG00001151889.
DR   EnsemblGenomes-Gn; EBG00001151890.
DR   EnsemblGenomes-Gn; EBG00001151891.
DR   EnsemblGenomes-Tr; BACI_c00070-1.
DR   EnsemblGenomes-Tr; BACI_c00080-1.
DR   EnsemblGenomes-Tr; BACI_c00090-1.
DR   EnsemblGenomes-Tr; BACI_c00100-1.
DR   EnsemblGenomes-Tr; BACI_c00110-1.
DR   EnsemblGenomes-Tr; BACI_c00190-1.
DR   EnsemblGenomes-Tr; BACI_c00250-1.
DR   EnsemblGenomes-Tr; BACI_c00310-1.
DR   EnsemblGenomes-Tr; BACI_c00320-1.
DR   EnsemblGenomes-Tr; BACI_c00330-1.
DR   EnsemblGenomes-Tr; BACI_c00340-1.
DR   EnsemblGenomes-Tr; BACI_c00700-1.
DR   EnsemblGenomes-Tr; BACI_c00710-1.
DR   EnsemblGenomes-Tr; BACI_c00890-1.
DR   EnsemblGenomes-Tr; BACI_c00900-1.
DR   EnsemblGenomes-Tr; BACI_c00910-1.
DR   EnsemblGenomes-Tr; BACI_c00920-1.
DR   EnsemblGenomes-Tr; BACI_c00930-1.
DR   EnsemblGenomes-Tr; BACI_c00940-1.
DR   EnsemblGenomes-Tr; BACI_c00950-1.
DR   EnsemblGenomes-Tr; BACI_c00960-1.
DR   EnsemblGenomes-Tr; BACI_c00970-1.
DR   EnsemblGenomes-Tr; BACI_c00980-1.
DR   EnsemblGenomes-Tr; BACI_c00990-1.
DR   EnsemblGenomes-Tr; BACI_c01000-1.
DR   EnsemblGenomes-Tr; BACI_c01010-1.
DR   EnsemblGenomes-Tr; BACI_c01020-1.
DR   EnsemblGenomes-Tr; BACI_c01030-1.
DR   EnsemblGenomes-Tr; BACI_c01800-1.
DR   EnsemblGenomes-Tr; BACI_c01810-1.
DR   EnsemblGenomes-Tr; BACI_c01820-1.
DR   EnsemblGenomes-Tr; BACI_c01830-1.
DR   EnsemblGenomes-Tr; BACI_c01840-1.
DR   EnsemblGenomes-Tr; BACI_c01850-1.
DR   EnsemblGenomes-Tr; BACI_c01860-1.
DR   EnsemblGenomes-Tr; BACI_c01870-1.
DR   EnsemblGenomes-Tr; BACI_c01880-1.
DR   EnsemblGenomes-Tr; BACI_c01890-1.
DR   EnsemblGenomes-Tr; BACI_c01900-1.
DR   EnsemblGenomes-Tr; BACI_c01910-1.
DR   EnsemblGenomes-Tr; BACI_c01970-1.
DR   EnsemblGenomes-Tr; BACI_c02870-1.
DR   EnsemblGenomes-Tr; BACI_c02880-1.
DR   EnsemblGenomes-Tr; BACI_c02890-1.
DR   EnsemblGenomes-Tr; BACI_c02900-1.
DR   EnsemblGenomes-Tr; BACI_c02910-1.
DR   EnsemblGenomes-Tr; BACI_c02920-1.
DR   EnsemblGenomes-Tr; BACI_c02930-1.
DR   EnsemblGenomes-Tr; BACI_c02940-1.
DR   EnsemblGenomes-Tr; BACI_c02950-1.
DR   EnsemblGenomes-Tr; BACI_c02960-1.
DR   EnsemblGenomes-Tr; BACI_c02970-1.
DR   EnsemblGenomes-Tr; BACI_c02980-1.
DR   EnsemblGenomes-Tr; BACI_c02990-1.
DR   EnsemblGenomes-Tr; BACI_c03000-1.
DR   EnsemblGenomes-Tr; BACI_c03010-1.
DR   EnsemblGenomes-Tr; BACI_c03020-1.
DR   EnsemblGenomes-Tr; BACI_c03230-1.
DR   EnsemblGenomes-Tr; BACI_c03240-1.
DR   EnsemblGenomes-Tr; BACI_c03250-1.
DR   EnsemblGenomes-Tr; BACI_c03280-1.
DR   EnsemblGenomes-Tr; BACI_c03290-1.
DR   EnsemblGenomes-Tr; BACI_c03300-1.
DR   EnsemblGenomes-Tr; BACI_c04230-1.
DR   EnsemblGenomes-Tr; BACI_c04360-1.
DR   EnsemblGenomes-Tr; BACI_c05300-1.
DR   EnsemblGenomes-Tr; BACI_c05310-1.
DR   EnsemblGenomes-Tr; BACI_c05320-1.
DR   EnsemblGenomes-Tr; BACI_c05330-1.
DR   EnsemblGenomes-Tr; BACI_c05340-1.
DR   EnsemblGenomes-Tr; BACI_c05350-1.
DR   EnsemblGenomes-Tr; BACI_c05360-1.
DR   EnsemblGenomes-Tr; BACI_c05370-1.
DR   EnsemblGenomes-Tr; BACI_c05380-1.
DR   EnsemblGenomes-Tr; BACI_c05390-1.
DR   EnsemblGenomes-Tr; BACI_c05400-1.
DR   EnsemblGenomes-Tr; BACI_c05410-1.
DR   EnsemblGenomes-Tr; BACI_c05420-1.
DR   EnsemblGenomes-Tr; BACI_c05430-1.
DR   EnsemblGenomes-Tr; BACI_c05440-1.
DR   EnsemblGenomes-Tr; BACI_c05450-1.
DR   EnsemblGenomes-Tr; BACI_c05460-1.
DR   EnsemblGenomes-Tr; BACI_c05470-1.
DR   EnsemblGenomes-Tr; BACI_c05530-1.
DR   EnsemblGenomes-Tr; BACI_c07280-1.
DR   EnsemblGenomes-Tr; BACI_c07290-1.
DR   EnsemblGenomes-Tr; BACI_c07300-1.
DR   EnsemblGenomes-Tr; BACI_c07310-1.
DR   EnsemblGenomes-Tr; BACI_c07320-1.
DR   EnsemblGenomes-Tr; BACI_c07330-1.
DR   EnsemblGenomes-Tr; BACI_c07340-1.
DR   EnsemblGenomes-Tr; BACI_c07350-1.
DR   EnsemblGenomes-Tr; BACI_c07360-1.
DR   EnsemblGenomes-Tr; BACI_c07370-1.
DR   EnsemblGenomes-Tr; BACI_c07380-1.
DR   EnsemblGenomes-Tr; BACI_c07390-1.
DR   EnsemblGenomes-Tr; BACI_c07400-1.
DR   EnsemblGenomes-Tr; BACI_c07410-1.
DR   EnsemblGenomes-Tr; BACI_c07420-1.
DR   EnsemblGenomes-Tr; BACI_c07430-1.
DR   EnsemblGenomes-Tr; BACI_c07440-1.
DR   EnsemblGenomes-Tr; BACI_c07450-1.
DR   EnsemblGenomes-Tr; BACI_c07460-1.
DR   EnsemblGenomes-Tr; BACI_c07470-1.
DR   EnsemblGenomes-Tr; BACI_c07480-1.
DR   EnsemblGenomes-Tr; BACI_c07490-1.
DR   EnsemblGenomes-Tr; BACI_c10270-1.
DR   EnsemblGenomes-Tr; BACI_c10460-1.
DR   EnsemblGenomes-Tr; BACI_c13070-1.
DR   EnsemblGenomes-Tr; BACI_c13890-1.
DR   EnsemblGenomes-Tr; BACI_c16030-1.
DR   EnsemblGenomes-Tr; BACI_c16190-1.
DR   EnsemblGenomes-Tr; BACI_c16200-1.
DR   EnsemblGenomes-Tr; BACI_c24190-1.
DR   EnsemblGenomes-Tr; BACI_c25600-1.
DR   EnsemblGenomes-Tr; BACI_c26210-1.
DR   EnsemblGenomes-Tr; BACI_c26630-1.
DR   EnsemblGenomes-Tr; BACI_c27250-1.
DR   EnsemblGenomes-Tr; BACI_c28260-1.
DR   EnsemblGenomes-Tr; BACI_c30210-1.
DR   EnsemblGenomes-Tr; BACI_c31650-1.
DR   EnsemblGenomes-Tr; BACI_c35280-1.
DR   EnsemblGenomes-Tr; BACI_c35790-1.
DR   EnsemblGenomes-Tr; BACI_c42460-1.
DR   EnsemblGenomes-Tr; BACI_c44710-1.
DR   EnsemblGenomes-Tr; BACI_c44720-1.
DR   EnsemblGenomes-Tr; BACI_c48770-1.
DR   EnsemblGenomes-Tr; BACI_c48780-1.
DR   EnsemblGenomes-Tr; BACI_c48790-1.
DR   EnsemblGenomes-Tr; BACI_c48800-1.
DR   EnsemblGenomes-Tr; BACI_c48810-1.
DR   EnsemblGenomes-Tr; BACI_c48820-1.
DR   EnsemblGenomes-Tr; BACI_c48830-1.
DR   EnsemblGenomes-Tr; BACI_c48840-1.
DR   EnsemblGenomes-Tr; BACI_c48850-1.
DR   EnsemblGenomes-Tr; BACI_c48860-1.
DR   EnsemblGenomes-Tr; BACI_c48870-1.
DR   EnsemblGenomes-Tr; BACI_c48880-1.
DR   EnsemblGenomes-Tr; BACI_c48890-1.
DR   EnsemblGenomes-Tr; BACI_c48900-1.
DR   EnsemblGenomes-Tr; BACI_c48910-1.
DR   EnsemblGenomes-Tr; BACI_c48920-1.
DR   EnsemblGenomes-Tr; BACI_c48930-1.
DR   EnsemblGenomes-Tr; BACI_c48940-1.
DR   EnsemblGenomes-Tr; BACI_c48950-1.
DR   EnsemblGenomes-Tr; BACI_c48960-1.
DR   EnsemblGenomes-Tr; BACI_c48970-1.
DR   EnsemblGenomes-Tr; BACI_c48980-1.
DR   EnsemblGenomes-Tr; BACI_c48990-1.
DR   EnsemblGenomes-Tr; BACI_c49000-1.
DR   EnsemblGenomes-Tr; BACI_c49010-1.
DR   EnsemblGenomes-Tr; BACI_c51250-1.
DR   EnsemblGenomes-Tr; BACI_c54690-1.
DR   EnsemblGenomes-Tr; BACI_c54700-1.
DR   EnsemblGenomes-Tr; BACI_c54710-1.
DR   EnsemblGenomes-Tr; BACI_c54720-1.
DR   EnsemblGenomes-Tr; EBT00001740673.
DR   EnsemblGenomes-Tr; EBT00001740674.
DR   EnsemblGenomes-Tr; EBT00001740675.
DR   EnsemblGenomes-Tr; EBT00001740676.
DR   EnsemblGenomes-Tr; EBT00001740677.
DR   EnsemblGenomes-Tr; EBT00001740678.
DR   EnsemblGenomes-Tr; EBT00001740679.
DR   EnsemblGenomes-Tr; EBT00001740680.
DR   EnsemblGenomes-Tr; EBT00001740681.
DR   EnsemblGenomes-Tr; EBT00001740682.
DR   EnsemblGenomes-Tr; EBT00001740683.
DR   EnsemblGenomes-Tr; EBT00001740684.
DR   EnsemblGenomes-Tr; EBT00001740685.
DR   EnsemblGenomes-Tr; EBT00001740686.
DR   EnsemblGenomes-Tr; EBT00001740687.
DR   EnsemblGenomes-Tr; EBT00001740688.
DR   EnsemblGenomes-Tr; EBT00001740689.
DR   EnsemblGenomes-Tr; EBT00001740690.
DR   EnsemblGenomes-Tr; EBT00001740691.
DR   EnsemblGenomes-Tr; EBT00001740692.
DR   EnsemblGenomes-Tr; EBT00001740693.
DR   EnsemblGenomes-Tr; EBT00001740694.
DR   EnsemblGenomes-Tr; EBT00001740695.
DR   EnsemblGenomes-Tr; EBT00001740696.
DR   EnsemblGenomes-Tr; EBT00001740697.
DR   EnsemblGenomes-Tr; EBT00001740698.
DR   EnsemblGenomes-Tr; EBT00001740699.
DR   EnsemblGenomes-Tr; EBT00001740700.
DR   EnsemblGenomes-Tr; EBT00001740701.
DR   EnsemblGenomes-Tr; EBT00001740702.
DR   EnsemblGenomes-Tr; EBT00001740703.
DR   EnsemblGenomes-Tr; EBT00001740704.
DR   EnsemblGenomes-Tr; EBT00001740705.
DR   EnsemblGenomes-Tr; EBT00001740706.
DR   EnsemblGenomes-Tr; EBT00001740707.
DR   EnsemblGenomes-Tr; EBT00001740708.
DR   EnsemblGenomes-Tr; EBT00001740709.
DR   EnsemblGenomes-Tr; EBT00001740710.
DR   EnsemblGenomes-Tr; EBT00001740711.
DR   EnsemblGenomes-Tr; EBT00001740712.
DR   EnsemblGenomes-Tr; EBT00001740713.
DR   EnsemblGenomes-Tr; EBT00001740714.
DR   EnsemblGenomes-Tr; EBT00001740715.
DR   EnsemblGenomes-Tr; EBT00001740716.
DR   EnsemblGenomes-Tr; EBT00001740717.
DR   EnsemblGenomes-Tr; EBT00001740718.
DR   EnsemblGenomes-Tr; EBT00001740719.
DR   EnsemblGenomes-Tr; EBT00001740720.
DR   EnsemblGenomes-Tr; EBT00001740721.
DR   EnsemblGenomes-Tr; EBT00001740722.
DR   EnsemblGenomes-Tr; EBT00001740723.
DR   EnsemblGenomes-Tr; EBT00001740724.
DR   EnsemblGenomes-Tr; EBT00001740725.
DR   EnsemblGenomes-Tr; EBT00001740726.
DR   EnsemblGenomes-Tr; EBT00001740727.
DR   EnsemblGenomes-Tr; EBT00001740728.
DR   EnsemblGenomes-Tr; EBT00001740729.
DR   EnsemblGenomes-Tr; EBT00001740730.
DR   EnsemblGenomes-Tr; EBT00001740731.
DR   EnsemblGenomes-Tr; EBT00001740732.
DR   EnsemblGenomes-Tr; EBT00001740733.
DR   EnsemblGenomes-Tr; EBT00001740734.
DR   EnsemblGenomes-Tr; EBT00001740735.
DR   EnsemblGenomes-Tr; EBT00001740736.
DR   EnsemblGenomes-Tr; EBT00001740737.
DR   EnsemblGenomes-Tr; EBT00001740738.
DR   EnsemblGenomes-Tr; EBT00001740739.
DR   EnsemblGenomes-Tr; EBT00001740740.
DR   EnsemblGenomes-Tr; EBT00001740741.
DR   EnsemblGenomes-Tr; EBT00001740742.
DR   EnsemblGenomes-Tr; EBT00001740743.
DR   EnsemblGenomes-Tr; EBT00001740744.
DR   EnsemblGenomes-Tr; EBT00001740745.
DR   EnsemblGenomes-Tr; EBT00001740746.
DR   EnsemblGenomes-Tr; EBT00001740747.
DR   EnsemblGenomes-Tr; EBT00001740748.
DR   EnsemblGenomes-Tr; EBT00001740749.
DR   EnsemblGenomes-Tr; EBT00001740750.
DR   EnsemblGenomes-Tr; EBT00001740751.
DR   EnsemblGenomes-Tr; EBT00001740752.
DR   EnsemblGenomes-Tr; EBT00001740753.
DR   EnsemblGenomes-Tr; EBT00001740754.
DR   EnsemblGenomes-Tr; EBT00001740755.
DR   EnsemblGenomes-Tr; EBT00001740756.
DR   EnsemblGenomes-Tr; EBT00001740757.
DR   EnsemblGenomes-Tr; EBT00001740758.
DR   EnsemblGenomes-Tr; EBT00001740759.
DR   EnsemblGenomes-Tr; EBT00001740760.
DR   EnsemblGenomes-Tr; EBT00001740761.
DR   EnsemblGenomes-Tr; EBT00001740762.
DR   EnsemblGenomes-Tr; EBT00001740763.
DR   EnsemblGenomes-Tr; EBT00001740764.
DR   EnsemblGenomes-Tr; EBT00001740765.
DR   EnsemblGenomes-Tr; EBT00001740766.
DR   EnsemblGenomes-Tr; EBT00001740767.
DR   EnsemblGenomes-Tr; EBT00001740768.
DR   EnsemblGenomes-Tr; EBT00001740769.
DR   EnsemblGenomes-Tr; EBT00001740770.
DR   EnsemblGenomes-Tr; EBT00001740771.
DR   EnsemblGenomes-Tr; EBT00001740772.
DR   EnsemblGenomes-Tr; EBT00001740773.
DR   EnsemblGenomes-Tr; EBT00001740774.
DR   EnsemblGenomes-Tr; EBT00001740775.
DR   EnsemblGenomes-Tr; EBT00001740776.
DR   EnsemblGenomes-Tr; EBT00001740777.
DR   EnsemblGenomes-Tr; EBT00001740778.
DR   EnsemblGenomes-Tr; EBT00001740779.
DR   EnsemblGenomes-Tr; EBT00001740780.
DR   EnsemblGenomes-Tr; EBT00001740781.
DR   EnsemblGenomes-Tr; EBT00001740782.
DR   EnsemblGenomes-Tr; EBT00001740783.
DR   EnsemblGenomes-Tr; EBT00001740784.
DR   EnsemblGenomes-Tr; EBT00001740785.
DR   EnsemblGenomes-Tr; EBT00001740786.
DR   EnsemblGenomes-Tr; EBT00001740787.
DR   EnsemblGenomes-Tr; EBT00001740788.
DR   EnsemblGenomes-Tr; EBT00001740789.
DR   EnsemblGenomes-Tr; EBT00001740790.
DR   EnsemblGenomes-Tr; EBT00001740791.
DR   EnsemblGenomes-Tr; EBT00001740792.
DR   EnsemblGenomes-Tr; EBT00001740793.
DR   EnsemblGenomes-Tr; EBT00001740794.
DR   EnsemblGenomes-Tr; EBT00001740795.
DR   EnsemblGenomes-Tr; EBT00001740796.
DR   EnsemblGenomes-Tr; EBT00001740797.
DR   EnsemblGenomes-Tr; EBT00001740798.
DR   EnsemblGenomes-Tr; EBT00001740799.
DR   EnsemblGenomes-Tr; EBT00001740800.
DR   EnsemblGenomes-Tr; EBT00001740801.
DR   EnsemblGenomes-Tr; EBT00001740802.
DR   EnsemblGenomes-Tr; EBT00001740803.
DR   EnsemblGenomes-Tr; EBT00001740804.
DR   EnsemblGenomes-Tr; EBT00001740805.
DR   EnsemblGenomes-Tr; EBT00001740806.
DR   EnsemblGenomes-Tr; EBT00001740807.
DR   EnsemblGenomes-Tr; EBT00001740808.
DR   EnsemblGenomes-Tr; EBT00001740809.
DR   EnsemblGenomes-Tr; EBT00001740810.
DR   EnsemblGenomes-Tr; EBT00001740811.
DR   EnsemblGenomes-Tr; EBT00001740812.
DR   EnsemblGenomes-Tr; EBT00001740813.
DR   EnsemblGenomes-Tr; EBT00001740814.
DR   EnsemblGenomes-Tr; EBT00001740815.
DR   EnsemblGenomes-Tr; EBT00001740816.
DR   EnsemblGenomes-Tr; EBT00001740817.
DR   EnsemblGenomes-Tr; EBT00001740818.
DR   EnsemblGenomes-Tr; EBT00001740819.
DR   EnsemblGenomes-Tr; EBT00001740820.
DR   EnsemblGenomes-Tr; EBT00001740821.
DR   EnsemblGenomes-Tr; EBT00001740822.
DR   EnsemblGenomes-Tr; EBT00001740823.
DR   EnsemblGenomes-Tr; EBT00001740824.
DR   EnsemblGenomes-Tr; EBT00001740825.
DR   EnsemblGenomes-Tr; EBT00001740826.
DR   EnsemblGenomes-Tr; EBT00001740827.
DR   EnsemblGenomes-Tr; EBT00001740828.
DR   EnsemblGenomes-Tr; EBT00001740829.
DR   EnsemblGenomes-Tr; EBT00001740830.
DR   EnsemblGenomes-Tr; EBT00001740831.
DR   EnsemblGenomes-Tr; EBT00001740832.
DR   EnsemblGenomes-Tr; EBT00001740833.
DR   EnsemblGenomes-Tr; EBT00001740834.
DR   EnsemblGenomes-Tr; EBT00001740835.
DR   EnsemblGenomes-Tr; EBT00001740836.
DR   EnsemblGenomes-Tr; EBT00001740837.
DR   EnsemblGenomes-Tr; EBT00001740838.
DR   EnsemblGenomes-Tr; EBT00001740839.
DR   EnsemblGenomes-Tr; EBT00001740840.
DR   EnsemblGenomes-Tr; EBT00001740841.
DR   EnsemblGenomes-Tr; EBT00001740842.
DR   EnsemblGenomes-Tr; EBT00001740843.
DR   EnsemblGenomes-Tr; EBT00001740844.
DR   EnsemblGenomes-Tr; EBT00001740845.
DR   EnsemblGenomes-Tr; EBT00001740846.
DR   EnsemblGenomes-Tr; EBT00001740847.
DR   EuropePMC; PMC2901330; 20634886.
DR   EuropePMC; PMC5433235; 28515790.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001746.
DR   SILVA-SSU; CP001746.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5196054
FT                   /organism="Bacillus cereus biovar anthracis str. CI"
FT                   /strain="CI"
FT                   /mol_type="genomic DNA"
FT                   /note="biovar: anthracis"
FT                   /db_xref="taxon:637380"
FT   gene            101..1441
FT                   /gene="dnaA"
FT                   /locus_tag="BACI_c00010"
FT   CDS_pept        101..1441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BACI_c00010"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02815"
FT                   /db_xref="GOA:D8GUW3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW3"
FT                   /protein_id="ADK02815.1"
FT                   /translation="MENISDLWNSALKELEKKVSKPSYETWLKSTTAHNLKKDVLTITA
FT                   PNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEEIDLPPAKTNAAQDDSN
FT                   HLPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIEHNPNAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPNSKPKIISIYDIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEINDILK"
FT   gene            1620..2759
FT                   /gene="dnaN1"
FT                   /locus_tag="BACI_c00020"
FT   CDS_pept        1620..2759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN1"
FT                   /locus_tag="BACI_c00020"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02816"
FT                   /db_xref="GOA:D8GUW4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW4"
FT                   /protein_id="ADK02816.1"
FT                   /translation="MRFSIQKDYLVRSVQDVMKAVSSRTTIPILTGIKVVATEEGVTLT
FT                   GSDADISIESFIPVEEDGKEIVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMT
FT                   KITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILT
FT                   GVNWKVYNSELTCIATDSHRLALRKAKIEGIVDEFQANVVIPGKSLNELSKILDESEEM
FT                   VDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASL
FT                   LARDGRNNVVKLSTLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDAL
FT                   KALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVRTY"
FT   gene            2887..3099
FT                   /gene="yaaA"
FT                   /locus_tag="BACI_c00030"
FT   CDS_pept        2887..3099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="BACI_c00030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02817"
FT                   /db_xref="GOA:D8GUW5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW5"
FT                   /protein_id="ADK02817.1"
FT                   /translation="MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNQELE
FT                   NRRGRKLYANDIIEIPGSGSFQVQS"
FT   gene            3112..4239
FT                   /gene="recF"
FT                   /locus_tag="BACI_c00040"
FT   CDS_pept        3112..4239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BACI_c00040"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02818"
FT                   /db_xref="GOA:D8GUW6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW6"
FT                   /protein_id="ADK02818.1"
FT                   /translation="MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKL
FT                   SQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHL
FT                   LKKMQGNSKNEETMLDVFTLQLIEHGTKILQKRFEFLHLLQEWAAPIHRGISRGLEELE
FT                   IVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQV
FT                   FGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQT
FT                   FVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRA"
FT   gene            4278..6200
FT                   /gene="gyrB"
FT                   /locus_tag="BACI_c00050"
FT   CDS_pept        4278..6200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BACI_c00050"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02819"
FT                   /db_xref="GOA:D8GUW7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW7"
FT                   /protein_id="ADK02819.1"
FT                   /translation="MEQKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLV
FT                   WEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKIIG
FT                   DTDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEF
FT                   HYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHT
FT                   YEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEG
FT                   QTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIIN
FT                   VEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYK
FT                   GLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYV
FT                   KNLDI"
FT   gene            6289..8760
FT                   /gene="gyrA"
FT                   /locus_tag="BACI_c00060"
FT   CDS_pept        6289..8760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BACI_c00060"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02820"
FT                   /db_xref="GOA:D8GUW8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW8"
FT                   /protein_id="ADK02820.1"
FT                   /translation="MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKP
FT                   VHRRVLYAMNDLGITADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYML
FT                   VDGHGNFGSVDGDSAAAMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPA
FT                   RFPNLLVNGTTGIAVGMATNIPPHQLGEVIDGVLALSHNPDITIAELMECIPGPDFPTA
FT                   GLILGRSGIRRAYETGRGSIILRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAEL
FT                   VRDKKIEGITDLRDESDRNGMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVN
FT                   GEPQVLNLKQNLYHYLEHQKVVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIR
FT                   SSKTAEIAKQGLMERFGLSEKQAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAI
FT                   LADEEKVLEIIREELTEVKERFNDKRRTEITIGGMESIEDEDLIPEQNIAITLTHNGYI
FT                   KRLPASTYKTQNRGGRGVQGMGTNDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIP
FT                   EYSRTAKGIPIINLLGVDKGEWINAIIPIREFGDDEFLFFTTKQGISKRTPLSSFANIR
FT                   TNGLIAISLREEDEVISVRLTSGDKDIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITL
FT                   GEEDQVVGMEIVEEDVNVLIVTKNGYGKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVA
FT                   VKSVTGEEDIMLITAAGVIIRMPVDQISQMGRNTQGVRLIRLEDEQEVATVAKAQKDDE
FT                   EETSEEVSSEE"
FT   gene            9029..10548
FT                   /locus_tag="BACI_c00070"
FT   rRNA            9029..10548
FT                   /locus_tag="BACI_c00070"
FT                   /product="16S ribosomal RNA"
FT   gene            10686..10762
FT                   /locus_tag="BACI_c00080"
FT   tRNA            10686..10762
FT                   /locus_tag="BACI_c00080"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            10771..10846
FT                   /locus_tag="BACI_c00090"
FT   tRNA            10771..10846
FT                   /locus_tag="BACI_c00090"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            10929..13848
FT                   /locus_tag="BACI_c00100"
FT   rRNA            10929..13848
FT                   /locus_tag="BACI_c00100"
FT                   /product="23S ribosomal RNA"
FT   gene            13900..14014
FT                   /locus_tag="BACI_c00110"
FT   rRNA            13900..14014
FT                   /locus_tag="BACI_c00110"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14048..15049)
FT                   /gene="yaaC"
FT                   /locus_tag="BACI_c00120"
FT   CDS_pept        complement(14048..15049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BACI_c00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02821"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUW9"
FT                   /protein_id="ADK02821.1"
FT                   /translation="MHQTHCTWQQLSFFFSSQNVQRYLARCYEKSSIQDAEKKSFENCY
FT                   PFIYYLEHGKNYYELYKVAPFSIQPMLLFYGISQLFKACLLTIDPNYPESTTVLAHGVT
FT                   TRKRKKQGYQFLEDEVKVQKNGLFTHVAEQLFHMKHLESEKFNMLDLMGNIPELQNLFR
FT                   YSQRGATLYKIDSPNTNELSFSVNILDRLHMTTERFSRYIESICKHLSIQYVPRKTSAS
FT                   NLLFTAPIQSWNPIYSTPLYYEYLADTYYLPLTTDPRNPKPALPELLVHYLLLYNLSMI
FT                   SRYETDWWYDLLGSYGSEDYPFIYQFLTISAQKVPYYISSFLLAEPGLFHGK"
FT   gene            15165..16628
FT                   /gene="guaB"
FT                   /locus_tag="BACI_c00130"
FT   CDS_pept        15165..16628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BACI_c00130"
FT                   /product="inositol-5-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02822"
FT                   /db_xref="GOA:D8GUX0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX0"
FT                   /protein_id="ADK02822.1"
FT                   /translation="MWESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVLSESLQLNIP
FT                   LISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQEYSIKISDVMTKEQLI
FT                   TAPVGTTLSEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLL
FT                   VGAAVGVTADAMTRIDALVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNV
FT                   ATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIA
FT                   DGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEK
FT                   GSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENA
FT                   QFIRMSGAGLLESHPHHVQITKEAPNYSL"
FT   gene            16742..18049
FT                   /gene="dacA1"
FT                   /locus_tag="BACI_c00140"
FT   CDS_pept        16742..18049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA1"
FT                   /locus_tag="BACI_c00140"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02823"
FT                   /db_xref="GOA:D8GUX1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX1"
FT                   /protein_id="ADK02823.1"
FT                   /translation="MFCKRFIALVTMLTLACSMLLPYSNASAETGAALNIEAGAAILVE
FT                   ANSGKILYQKNADELLSIASMTKMMSEYLVHEAVDKGKLKWDQKIKVSEYAYKVSQDAS
FT                   LSNVALENGGSYTVKELYEAMAIFSANGATIALAEAIASKEVDFVKMMNDKSKELGLKN
FT                   YKFVNSTGLTNKDLKGMHPEGTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIPKKE
FT                   FRPEKEKFAMSNWNWMLKGLVKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISVVIK
FT                   TSSHTARFDETKKLYDYGFANFEMKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQAIS
FT                   LPVPKGSKEVYKTELKESSKGQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVDLVT
FT                   TSEVEEANWFTRAMRGIGSFFSGIWNSAVDTVKGWF"
FT   gene            18211..19098
FT                   /gene="pdx1"
FT                   /locus_tag="BACI_c00150"
FT   CDS_pept        18211..19098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdx1"
FT                   /locus_tag="BACI_c00150"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02824"
FT                   /db_xref="GOA:D8GUX2"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX2"
FT                   /protein_id="ADK02824.1"
FT                   /translation="MTNVTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMA
FT                   LERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDE
FT                   SEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVR
FT                   HMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSENPAKFARAIVEATTHYEDYELIASLSKGLGNAMKGIEI
FT                   STLLPEQRMQERGW"
FT   gene            19117..19707
FT                   /gene="guaA1"
FT                   /locus_tag="BACI_c00160"
FT   CDS_pept        19117..19707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA1"
FT                   /locus_tag="BACI_c00160"
FT                   /product="glutamine-hydrolyzing GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02825"
FT                   /db_xref="GOA:D8GUX3"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX3"
FT                   /protein_id="ADK02825.1"
FT                   /translation="MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIGQLEEIDGLILP
FT                   GGESTTMRRLIDKYDFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAHIGAMDITV
FT                   ERNAFGRQKDSFEAALSIKGVGEDFVGVFIRAPYVVDVADDVEVLSTHGDRMVAVRQGP
FT                   FLAASFHPELTDDHRVTAYFVEMVKEAKMKKVV"
FT   misc_binding    19762..19983
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="BACI_c00170; T-box leader, RF00230"
FT   gene            20035..21309
FT                   /gene="serS"
FT                   /locus_tag="BACI_c00180"
FT   CDS_pept        20035..21309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BACI_c00180"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02826"
FT                   /db_xref="GOA:D8GUX4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX4"
FT                   /protein_id="ADK02826.1"
FT                   /translation="MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQT
FT                   EELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSI
FT                   PNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRF
FT                   VFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIE
FT                   SEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTIIIPEVLRPYMGGKTVIK"
FT   gene            21469..21558
FT                   /locus_tag="BACI_c00190"
FT   tRNA            21469..21558
FT                   /locus_tag="BACI_c00190"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCA"
FT   gene            21665..22117
FT                   /locus_tag="BACI_c00200"
FT   CDS_pept        21665..22117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02827"
FT                   /db_xref="GOA:D8GUX5"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR024256"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX5"
FT                   /protein_id="ADK02827.1"
FT                   /translation="MSLLHTHIPMIIFIDMKGVNMDLIIQTFPLDGKTLYYVQCPVCKN
FT                   NRILNSGANVSRIISDDTFRKLCGCTCDVKQTATKVEAPKKVKKEAVKKEAAPKRTGKV
FT                   LTAVINGKEMTVKEIAEAYDISTSTVRQRINAGKSESEIIAPTKKK"
FT   gene            complement(22153..22821)
FT                   /gene="dck"
FT                   /locus_tag="BACI_c00210"
FT   CDS_pept        complement(22153..22821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BACI_c00210"
FT                   /product="deoxynucleoside kinase"
FT                   /EC_number="2.7.1.145"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02828"
FT                   /db_xref="GOA:D8GUX6"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX6"
FT                   /protein_id="ADK02828.1"
FT                   /translation="MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKV
FT                   DSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   HEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTP
FT                   IEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
FT                   "
FT   gene            complement(22824..23459)
FT                   /gene="dgk"
FT                   /locus_tag="BACI_c00220"
FT   CDS_pept        complement(22824..23459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BACI_c00220"
FT                   /product="deoxyguanosine kinase"
FT                   /EC_number="2.7.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02829"
FT                   /db_xref="GOA:D8GUX7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX7"
FT                   /protein_id="ADK02829.1"
FT                   /translation="MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGK
FT                   FYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNVIFASRTLKDSQ
FT                   YDKYMQIYRILTQDMPVPNVIVYLTASLETLQRRIAMRGREFEKNMDPNYLLQLTKDYE
FT                   TAMDAFKKDHPDIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESK"
FT   gene            complement(23585..24124)
FT                   /gene="pncA"
FT                   /locus_tag="BACI_c00230"
FT   CDS_pept        complement(23585..24124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="BACI_c00230"
FT                   /product="nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="pyrazinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02830"
FT                   /db_xref="GOA:D8GUX8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX8"
FT                   /protein_id="ADK02830.1"
FT                   /translation="MKNTALLIIDMINDFQFSHGPILAKKCEMITNPILQLKKTMKSFG
FT                   YPIIYINDHYQLWRSDIDQLITHCTNEYSENIIHKIAPSSDDYIFIKPHYSAFYETPLN
FT                   SLLGYLKIENLILTGVAGNICILFTANDAHMRNYTLYVPQDCIASNHDQDNLHALKIME
FT                   TTLKANIVPSSQIKFN"
FT   gene            24232..24732
FT                   /gene="yaaJ"
FT                   /locus_tag="BACI_c00240"
FT   CDS_pept        24232..24732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="BACI_c00240"
FT                   /product="probable cytidine/deoxycytidylate deaminase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02831"
FT                   /db_xref="GOA:D8GUX9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUX9"
FT                   /protein_id="ADK02831.1"
FT                   /translation="MERDQDIYFMQLAIEEAKKAEAIQEVPIGAVIVLNGEVISAAHNL
FT                   RETEQRSIAHAELLAIDEACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVNRVVYGA
FT                   GDPKGGCAGTLMNLLTDERFNHQCEVVAGVLEEECGTLLTNFFRELRKKRKAIKKLEKS
FT                   NEN"
FT   gene            24925..25027
FT                   /gene="srp"
FT                   /locus_tag="BACI_c00250"
FT   ncRNA           24925..25027
FT                   /gene="srp"
FT                   /locus_tag="BACI_c00250"
FT                   /product="signal recognition particle RNA"
FT                   /note="RF00169"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            25209..26897
FT                   /gene="dnaX"
FT                   /locus_tag="BACI_c00260"
FT   CDS_pept        25209..26897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BACI_c00260"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02832"
FT                   /db_xref="GOA:D8GUY0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUY0"
FT                   /protein_id="ADK02832.1"
FT                   /translation="MSYQALYRTWRPQKFEDVVGQKHVTKTLQNALLQEKVSHAYLFSG
FT                   PRGTGKTTIAKVFAKAINCEHAPVAEPCNECPSCLGITQGSISDVLEIDAASNNGVDEI
FT                   RDIRDKVKYAPSAVEYKVYIIDEVHMLSMGAFNALLKTLEEPPGHVIFILATTEPHKIP
FT                   PTIISRCQRFEFRKISVNDIVERLSTVVTNEGTQVEDEALQIVARAAEGGMRDALSLID
FT                   QAISYSDERVTTEDVLAVTGSVSQQYLGNLVECIRENDVSRALRIIDEMMGKGKDPVRF
FT                   MEDFIYYYRDMLLYQTSSQLEHMLERVMVDEQFRMLSEEMQPEVIYEIIHTLSKGQQEM
FT                   KWTNHPRIFLEVVMVQLCQQFMMQANGADRLQAIMNRMQQLEKELEQVKKNGVPVGVQP
FT                   EVRETRAAPKPVRTGSMKIPVGRVNEVLKQAKRQDLEQLKAVWGELLGRLKAYNKVAFA
FT                   VLLENSEPVAASDDTYVLAFQYEIHCKMASENREAMDTVEQALFELLSKRLNMIAIPKS
FT                   EWGKIREDFLQREGGSSEESPEKKEDPLIEEAVKLVGQELIEIKE"
FT   gene            26920..27249
FT                   /gene="yaaK"
FT                   /locus_tag="BACI_c00270"
FT   CDS_pept        26920..27249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaK"
FT                   /locus_tag="BACI_c00270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02833"
FT                   /db_xref="GOA:D8GUY1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUY1"
FT                   /protein_id="ADK02833.1"
FT                   /translation="MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMIT
FT                   VIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNL
FT                   PGGMF"
FT   gene            27264..27860
FT                   /gene="recR"
FT                   /locus_tag="BACI_c00280"
FT   CDS_pept        27264..27860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BACI_c00280"
FT                   /product="recombination protein R"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02834"
FT                   /db_xref="GOA:D8GUY2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUY2"
FT                   /protein_id="ADK02834.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAK
FT                   ALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVY
FT                   HVLRGAISPMEGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"
FT   gene            27875..28096
FT                   /gene="yaaL"
FT                   /locus_tag="BACI_c00290"
FT   CDS_pept        27875..28096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BACI_c00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02835"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUY3"
FT                   /protein_id="ADK02835.1"
FT                   /translation="MFFQKKGKLRKEYDDKLIVLLEKVKNEWLRQKRMVEQSVEPSQDV
FT                   LCSLKIAEAKYFFLLKEAKRRPVKMEQW"
FT   gene            28312..28581
FT                   /gene="bofA"
FT                   /locus_tag="BACI_c00300"
FT   CDS_pept        28312..28581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BACI_c00300"
FT                   /product="sigma-K factor processing regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02836"
FT                   /db_xref="GOA:D8GUY4"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D8GUY4"
FT                   /protein_id="ADK02836.1"
FT                   /translation="MNSTIIIVGILALIFIFLVFGVSSKPLRFIGKALFHVTLGVALLF
FT                   IVNVVGTYFDFHIPINLGTATITSLLGLPGVVALVVIKLYIMPR"
FT   gene            28807..30346
FT                   /locus_tag="BACI_c00310"
FT   rRNA            28807..30346
FT                   /locus_tag="BACI_c00310"
FT                   /product="16S ribosomal RNA"
FT   gene            30484..30559
FT                   /locus_tag="BACI_c00320"
FT   tRNA            30484..30559
FT                   /locus_tag="BACI_c00320"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            30642..33561
FT                   /locus_tag="BACI_c00330"
FT   rRNA            30642..33561
FT                   /locus_tag="BACI_c00330"
FT                   /product="23S ribosomal RNA"
FT   gene            33613..33727
FT                   /locus_tag="BACI_c00340"
FT   rRNA            33613..33727
FT                   /locus_tag="BACI_c00340"
FT                   /product="5S ribosomal RNA"
FT   gene            33917..34096
FT                   /locus_tag="BACI_c00350"
FT   CDS_pept        33917..34096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00350"
FT                   /product="putative CsfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02837"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWH4"
FT                   /protein_id="ADK02837.1"
FT                   /translation="MKSQNEVCIVCETERKEGIYVYNNLICYECEKDMVNTETDDPKYI
FT                   YYLKQLRKLEVSYF"
FT   gene            34169..35590
FT                   /gene="cad1"
FT                   /locus_tag="BACI_c00360"
FT   CDS_pept        34169..35590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cad1"
FT                   /locus_tag="BACI_c00360"
FT                   /product="lysine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02838"
FT                   /db_xref="GOA:D8GWH5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWH5"
FT                   /protein_id="ADK02838.1"
FT                   /translation="MNQNRIPLYEALIEFKERRPLSFHVPGHKNGLNFPKEVVEEFKDI
FT                   LSIDVTELSGLDDLHSPFECIDEAQQLLADVYGVNKSYFLINGSTVGNLAMILSCCGEH
FT                   DIVLVQRNCHKSIINGLKLAGANPIFLDPWIDEAYNVPVGIHDEIIKEAIEKYPNAKAL
FT                   ILTHPNYYGMGMDLEASIAYAHTHKIPVLVDEAHGAHFCLGGAFPQSALAYGADIVVHS
FT                   AHKTLPAMTMGSYLHINSRLVKEEKVSTYLSMLQSSSPSYPIMASLDIARFTIARIKEK
FT                   GHDEIVEFLQEFKEELSTIPQIAILQYPLQDGLKITVQTRCQLSGYELQSVFEKVGIYT
FT                   EMADPYNVLFILPLQVNKKYMKAIEMIRVALQYYEVKDKMESIRYTYKGEFSPLPYTYK
FT                   QLEEYETKVVPVEEAVGMVAAEMVIPYPPGIPLIMYGERITSEHKEQIMYLEKAGARFQ
FT                   GSTKYMKVYDIESRF"
FT   gene            35592..36218
FT                   /gene="tdk1"
FT                   /locus_tag="BACI_c00370"
FT   CDS_pept        35592..36218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk1"
FT                   /locus_tag="BACI_c00370"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02839"
FT                   /db_xref="GOA:D8GWH6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWH6"
FT                   /protein_id="ADK02839.1"
FT                   /translation="MKGLFVTIEGPEGSGKTTLIQSLLPYFEQKEQKVMATREPGGIAI
FT                   SEDIRTILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAY
FT                   QGYARGLGMDKVFEINRFATEDCMPNLTIYLDIEPEVGLARIAKDAGREVNRLDMEDIS
FT                   FHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVIQVIEDKLL"
FT   gene            36254..37237
FT                   /gene="holB"
FT                   /locus_tag="BACI_c00380"
FT   CDS_pept        36254..37237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BACI_c00380"
FT                   /product="DNA polymerase III subunit delta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02840"
FT                   /db_xref="GOA:D8GWH7"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWH7"
FT                   /protein_id="ADK02840.1"
FT                   /translation="MTKTWEQLSAIQPIGVKMLMNSIAKERISHAYLLEGGKGTGKFAT
FT                   AIQMAKSFLCSQRNGVEPCHVCTNCKRIDSGNHPNLHIVKPDGLSIKKQQIHDLQEEFS
FT                   KTGLEANKKVYIIEHADRMTANAANTLLKFLEEPSSDTTAILLTEQSHQILNTILSRCQ
FT                   VVTFRPLPTESLIRRLQDEGITVSLSTLAAQLTNSFDEALTLCNDEWFAQARALVIKLC
FT                   EALEKDKASIFFVQEKWGKHFGEKEQLQQGLDMLLLIYKDLLYVQLGEEDRLVFREQKE
FT                   MFESFSYAQKRIVSALFNILEAKNRINANVNAQLVFEQLVLRLQEG"
FT   gene            37243..38070
FT                   /locus_tag="BACI_c00390"
FT   CDS_pept        37243..38070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00390"
FT                   /product="signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02841"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWH8"
FT                   /protein_id="ADK02841.1"
FT                   /translation="MYDVVGVRFKKAGKVYYFDPNQFDISENEFVIVETVRGIEYGKVV
FT                   ITKKQVDENDVVLPLKKVIRIANENDRTIVEENKHAAKEAYQVCQQKVVEHNLDMKLVD
FT                   VEYTFDRNKIIFYFTADGRIDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDEYEAAKEQLPDL
FT                   DQRIQTPHGTGRVIGLNILERLIQVELVDKERIVEYTLDELVNKGVVSSQTTD"
FT   gene            38085..38435
FT                   /gene="yabA"
FT                   /locus_tag="BACI_c00400"
FT   CDS_pept        38085..38435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BACI_c00400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02842"
FT                   /db_xref="GOA:D8GWH9"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWH9"
FT                   /protein_id="ADK02842.1"
FT                   /translation="MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMEN
FT                   ENLRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGSVRKEG
FT                   DCLFCLSFLNKK"
FT   gene            38556..39296
FT                   /gene="yabB"
FT                   /locus_tag="BACI_c00410"
FT   CDS_pept        38556..39296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="BACI_c00410"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02843"
FT                   /db_xref="GOA:D8GWI0"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI0"
FT                   /protein_id="ADK02843.1"
FT                   /translation="MNLYEDERLDYLLAQDMKIIQSPSVFNFSLDAVLLADFAWVPIQK
FT                   GNLLDLCTGNAVVPLLLSTRTKGNITGVEIQERLYDMGIRSVQYNKLEERIHLIHGDLK
FT                   DMPEKLGRHQYDVVTCNPPYFQTPATSEKNMNEHLAIARHEIMCTLEDVVSASSQLVKQ
FT                   GGKVAFVHRPGRLLDIVTLMRKYKIEPKRVRFVYPKAGKEANTLLIEGIKDGNADLKIL
FT                   PPLFVYEENNEYTKEIRSILYGEE"
FT   gene            39283..39573
FT                   /gene="yazA"
FT                   /locus_tag="BACI_c00420"
FT   CDS_pept        39283..39573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BACI_c00420"
FT                   /product="excinuclease ABC, C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02844"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI1"
FT                   /protein_id="ADK02844.1"
FT                   /translation="MEKNKHCFYVVECSDGSYYAGYTNHIEKRIGTHNSGRGAKYTRAR
FT                   LPVVLKYVEFHEDKRTAMQAEYYFKQLNRKQKEEYMQKGERYVATKKLSTK"
FT   gene            39623..40417
FT                   /locus_tag="BACI_c00430"
FT   CDS_pept        39623..40417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00430"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02845"
FT                   /db_xref="GOA:D8GWI2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI2"
FT                   /protein_id="ADK02845.1"
FT                   /translation="MTFRAIRILKEADLIAAEDTRQTKKLCNYFEIETPVMSYHEHNKE
FT                   VSGKKILEKLDEGKTVALVSDAGMPCISDPGYDIVVEAVAEQYHVIPLPGANAALTALI
FT                   ASGLQTKQFYFYGFLQRNKKERKMELEKLRYVQTTMMFYEAPHRLDDTLISMQEVLGNR
FT                   EIVLCRELTKKFEEFIRGTVEEAIEWTKQNEVRGEFCILVAGSTEEPAPEEQWWESISV
FT                   YNHIEHYINEKGMNSKEAIKTVAKDRDLSKRDVYQIYHVDKK"
FT   gene            complement(40438..40722)
FT                   /gene="abrB1"
FT                   /locus_tag="BACI_c00440"
FT   CDS_pept        complement(40438..40722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB1"
FT                   /locus_tag="BACI_c00440"
FT                   /product="transition state transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02846"
FT                   /db_xref="GOA:D8GWI3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI3"
FT                   /protein_id="ADK02846.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDGNLSLAEGKIILSKEGAEQILNELQDYIETAK"
FT   gene            41213..43195
FT                   /gene="metRS"
FT                   /locus_tag="BACI_c00450"
FT   CDS_pept        41213..43195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metRS"
FT                   /locus_tag="BACI_c00450"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02847"
FT                   /db_xref="GOA:D8GWI4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI4"
FT                   /protein_id="ADK02847.1"
FT                   /translation="MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYN
FT                   VHYLTGTDEHGQKIQKKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHK
FT                   DVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD
FT                   VELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSF
FT                   DWGVRVPGNPKHVIYVWVDALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTI
FT                   YWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLRE
FT                   VPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETL
FT                   VTFAKDTLKKVEEAMENMEFSVALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASV
FT                   MAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQ
FT                   PIFPRLEMDVEVAYIKEQMKASAPKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEP
FT                   VKKADKLLKIQLDLGTEKRQVVSGIAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGEENGVLSLASIDQNLPNGTKIK"
FT   gene            43361..44128
FT                   /locus_tag="BACI_c00460"
FT   CDS_pept        43361..44128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00460"
FT                   /product="TatD related DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02848"
FT                   /db_xref="GOA:D8GWI5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI5"
FT                   /protein_id="ADK02848.1"
FT                   /translation="MLFDTHSHLNAEQFEEDLQEVIARMKEAGVTYTVVVGFDEATIKK
FT                   AIELAEAYDFIYAAVGWHPVDAIDMTEEHLAWLEELASHPKVVALGEMGLDYHWDKSPK
FT                   EIQKEVFRKQITLAKKVKLPIIIHNRDATQDIVDILEEENAAEVGGIMHCFSGSVEVAE
FT                   RCVDMNFLISLGGPVTFKNAKKPKEVATEIPLEKLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KLVAEEIANLKGISYEEVAEITTKNAKALFGVE"
FT   gene            44342..44899
FT                   /gene="rnmV"
FT                   /locus_tag="BACI_c00470"
FT   CDS_pept        44342..44899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BACI_c00470"
FT                   /product="ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02849"
FT                   /db_xref="GOA:D8GWI6"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI6"
FT                   /protein_id="ADK02849.1"
FT                   /translation="MKIKEIIVVEGKDDTVAIKRAVDADTIETNGSAIGDHVIEQVKLA
FT                   LQKRGVIIFTDPDYPGERIRKIISDKVPGCKHAFLPKEEALAKRKKGVGIEHASNESIR
FT                   RALENIHEEMEAYKSEISWSDLVDAGLVGGEMAKSRRERMGKLLKIGYTNAKQLHKRLQ
FT                   MFQVSKESFAEAYKQVIQEERK"
FT   gene            44896..45774
FT                   /gene="ksgA"
FT                   /locus_tag="BACI_c00480"
FT   CDS_pept        44896..45774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BACI_c00480"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02850"
FT                   /db_xref="GOA:D8GWI7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI7"
FT                   /protein_id="ADK02850.1"
FT                   /translation="MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDTNVLNRIVDHAEI
FT                   GSESGAIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILDETLAPYGNVTVINKDVLK
FT                   ADVHEVFSEQFEEGQDVMVVANLPYYITTPILFKLLEEKLPVRGFVVMMQKEVGDRLAA
FT                   KPGTKEYGSLSIAIQYYTEVETVMTVPRTVFVPQPNVDSAIIRLLKRPKPVVEVTDETF
FT                   FFEVVRASFAQRRKTLMNNLSNNLNGFPKDKELLDRILTEVGIDPKRRGETLSIEEFAT
FT                   LSNALVLHKLS"
FT   gene            45885..46748
FT                   /gene="yabG"
FT                   /locus_tag="BACI_c00490"
FT   CDS_pept        45885..46748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabG"
FT                   /locus_tag="BACI_c00490"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible sporulation-specific protease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02851"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI8"
FT                   /protein_id="ADK02851.1"
FT                   /translation="MALHVGELVERYSHNRDILFRIIEIKGEIAILFGEEIRLVADAPL
FT                   EDLISIDQREHKKRAKREKETMERTYRLFQQDYVLMKQRHEHTSTGGYTSEVNYFQMPG
FT                   RVLHIDGDPLYLRKCLDLYNKIGVPVQGIHCKETEMHEKVVDLIDHFRPDILVITGHDA
FT                   YTKSKGVKGDLAAYRHSRHFVQAVREVRKKYPSLDQLVIFAGACQSHFEALIRAGANFA
FT                   SSPSRINIHALDPVYVVGKISFTSFMERVNVWDVVRNTITGEKGLGGIETRGILRTGLP
FT                   FQHYEE"
FT   gene            46987..47247
FT                   /gene="veg"
FT                   /locus_tag="BACI_c00500"
FT   CDS_pept        46987..47247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BACI_c00500"
FT                   /product="veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02852"
FT                   /db_xref="GOA:D8GWI9"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWI9"
FT                   /protein_id="ADK02852.1"
FT                   /translation="MSKRLDEIKSELDHHLGQRLMLKANSGRRKTVEQSGVLAETYRSV
FT                   FVVQLDQQEDALQRVSYSYADVLTETVELTFYGEPHNEVIL"
FT   gene            47339..47518
FT                   /gene="sspF"
FT                   /locus_tag="BACI_c00510"
FT   CDS_pept        47339..47518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BACI_c00510"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02853"
FT                   /db_xref="GOA:D8GWJ0"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ0"
FT                   /protein_id="ADK02853.1"
FT                   /translation="MSRRRGVMSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKR
FT                   AIEIAEQQLMKQNQ"
FT   gene            47715..48584
FT                   /gene="ispE"
FT                   /locus_tag="BACI_c00520"
FT   CDS_pept        47715..48584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BACI_c00520"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02854"
FT                   /db_xref="GOA:D8GWJ1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ1"
FT                   /protein_id="ADK02854.1"
FT                   /translation="MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELME
FT                   LAEDRIEILSHNRYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSS
FT                   DAAATLRGLNKLWNLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPS
FT                   CWVILAKPHIGVSTADVYGNLKLNRVTHPNVDEMVDVINAGDYKGICDTVGNVLEDVTF
FT                   AMHPEVARIKAQMKRFGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRL
FT                   LGERETLE"
FT   gene            48639..49487
FT                   /gene="purR1"
FT                   /locus_tag="BACI_c00530"
FT   CDS_pept        48639..49487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR1"
FT                   /locus_tag="BACI_c00530"
FT                   /product="purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02855"
FT                   /db_xref="GOA:D8GWJ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ2"
FT                   /protein_id="ADK02855.1"
FT                   /translation="MKIRRSTRLVDMTYYLLQNPRQLVSLTFFAERYQSAKSSISEDLV
FT                   IIKQTFEQQGVGTLQTIPGAAGGVKYIPYISEEEADLIIGELCSLFENPDRILPGGYLY
FT                   MTDLLSNPRHINGAGRLFASVFARQPIDAVMTVATKGIPLAYAVANYLDVPVVIARKDN
FT                   KVTEGPTVSINYVSGSSKRIQTMTLAKRSLPEGSNVLIIDDFMKAGGTIQGMMSMLEEF
FT                   KANVVGIGVLVESTDIEERLINNFVSLIRLSEVDVKEKAIQVEKGNYSLAPFDEGIVEA
FT                   E"
FT   gene            49610..49984
FT                   /gene="purR2"
FT                   /locus_tag="BACI_c00540"
FT   CDS_pept        49610..49984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR2"
FT                   /locus_tag="BACI_c00540"
FT                   /product="purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02856"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ3"
FT                   /protein_id="ADK02856.1"
FT                   /translation="MKVVQTNNAPQAIGPYSQGIIVNNMFYSSGQIPLTASGELVAGDV
FT                   TVQTEQVFQNLQAVLEEAGASFDTVVKTTVFLKDMDDFNAVNEVYGSYFSAHKPARSCV
FT                   QVAKLPKDVSVEIEVIALVK"
FT   gene            50137..50430
FT                   /gene="spoVG"
FT                   /locus_tag="BACI_c00550"
FT   CDS_pept        50137..50430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BACI_c00550"
FT                   /product="stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02857"
FT                   /db_xref="GOA:D8GWJ4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ4"
FT                   /protein_id="ADK02857.1"
FT                   /translation="MEVTDVRLRRVNTEGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRSKIQDAVLTEYHRLGELEEVEFEEAGAS"
FT   gene            50753..52132
FT                   /gene="gcaD"
FT                   /locus_tag="BACI_c00560"
FT   CDS_pept        50753..52132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BACI_c00560"
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   uridyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02858"
FT                   /db_xref="GOA:D8GWJ5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ5"
FT                   /protein_id="ADK02858.1"
FT                   /translation="MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLG
FT                   LQKLVTVVGHGAEMVQEQLGNVSEFALQAEQLGTAHAVDQAAGVLANEEGTTLVICGDT
FT                   PLITAETMEALLQQHKEAGAMATVLTAYIEEPAGYGRIVRNENGHVEKIVEHKDANEKE
FT                   LAIKEINTGTYCFDNKALFASLSKVSNDNVQGEYYLPDVIEILKNEGHIVSAYQTEHFD
FT                   ETLGVNDRVALSQAEIIMKNRINRKNMVNGVTIIDPSNTYISADAIIGSDTVLHPGTII
FT                   EGNTVIGSDCEIGPHTVIRDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVIGD
FT                   EVRVGNFVEIKKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKNKFKTVIGN
FT                   GVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKEDYVDQLLNKKK
FT                   S"
FT   gene            52151..53104
FT                   /gene="prs"
FT                   /locus_tag="BACI_c00570"
FT   CDS_pept        52151..53104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BACI_c00570"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02859"
FT                   /db_xref="GOA:D8GWJ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ6"
FT                   /protein_id="ADK02859.1"
FT                   /translation="MSTQYLNSNLKVFSLNSNKELAEQIAKHIGVGLGKCSVDRFSDGE
FT                   VQINIEESIRGCDVFIIQSTSFPVNEHIMELLIMIDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITSKLVANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFET
FT                   KGLKDIVIVSPDHGGVTRARKMADRLKAPIAIIDKRRPRPNVSEVMNIIGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGASEVYACCTHPVLSGPAIERIQNSNIKELVVTNSIVL
FT                   PEEKKIDKVHELSVAPLIGEAIIRVYEEESVSVLFN"
FT   gene            53114..53737
FT                   /gene="spoVC"
FT                   /locus_tag="BACI_c00580"
FT   CDS_pept        53114..53737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BACI_c00580"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02860"
FT                   /db_xref="GOA:D8GWJ7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ7"
FT                   /protein_id="ADK02860.1"
FT                   /translation="MRRNQDWLRLFVSKKESSGTRMKLIVGLGNPGREYELTRHNIGFM
FT                   AIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDV
FT                   EDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKV
FT                   VDYVLGRFTSKEIPDVNHSIEKAADACEEWLNKPFLQIMNTFNS"
FT   gene            53808..54032
FT                   /gene="yabK"
FT                   /locus_tag="BACI_c00590"
FT   CDS_pept        53808..54032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabK"
FT                   /locus_tag="BACI_c00590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02861"
FT                   /db_xref="GOA:D8GWJ8"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ8"
FT                   /protein_id="ADK02861.1"
FT                   /translation="MEGYYYCRHCGSNVGSVTAEKVYSDVLFQLTEQEVVEMIHFHENG
FT                   NIYIKTICELCQETLASYPEYYEYEKFLQ"
FT   gene            54138..57668
FT                   /gene="mfd"
FT                   /locus_tag="BACI_c00600"
FT   CDS_pept        54138..57668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BACI_c00600"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02862"
FT                   /db_xref="GOA:D8GWJ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWJ9"
FT                   /protein_id="ADK02862.1"
FT                   /translation="MIGLLEQFYKNEEIQSVINGLEDGLKEQLVSGMATSSRSLLMAAL
FT                   YKKTKKSQLIVTHNLYQAQKVHEDLVALLGEKDVWLYPVNELIASELGVASPELKAQRI
FT                   EVLNRLAAGEHGIIVAPVAGLRRFLPMKELWKQRQIEISLGQEIDLDTFLHTLHHIGYE
FT                   RKSMVEAPGEFSLRGGILDIYPLTEELPFRIEFFDTEVDSIRLFDVDEQRSQDKKESVR
FT                   FGPATEFLFSQEELKSGIKHLEEGLTKTMQKLSDDKLKTTVLETVSHEIEMLKNGQSIE
FT                   QMFKYLSIFYNEPASLIDYLPEDGVVILDEISRIQETASHLESEEAEWYISLLGEGTII
FT                   QDLSFSHSFEEFLHHKKRSFVYLTLFLRHIAHTHPQNIVNVTCKTMQDFHGQMQLLKTE
FT                   IDRWNEGHFTTVVLGTDDERVKKLQHILSDYDIDADIVEGTDILLPGRLQIAVGDLHAG
FT                   FEMPMQKLVVITEKELFHKKVKKSQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFL
FT                   GIETLEINGVHKDYLNIKYQGNDKLYVPIEQIDQVQKYVGSEGKDPKVYKLGGNDWKKV
FT                   KTKVEKSVQDIADDLIKLYAEREASKGYAYTPDTAEQQEFESSFPYQETEDQLRSIEEI
FT                   KKDMERGRPMDRLLCGDVGYGKTEVAIRAAFKAIMDEKQVAILVPTTILAQQHYETIRE
FT                   RFQDYPINIGLLSRFRTRKQQNETIKGLKDGTVDIVIGTHRILSKDVTYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNPALMREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDARVTYAHGKMNES
FT                   ELESVMLSFLEGQHDVLVSTTIIETGVDIPNVNTLIVFDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFAYKRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IDSVGFDLYSQMLKDAIEQRRGTDGVENTVNVEIDLEVDAYLPDAYISDSKQKIMMYKQ
FT                   FRGVSAIEDIEELQEEMIDRFGDYPQEVGYLLQIANIKVLAMKEQIELIKQNKFEVTIL
FT                   FSEQASQNIDGGKLFMLGNSFGRMIGLGMEGSQLKIVMKTNGLETSKWLTIAENLLKGL
FT                   PDVKKEVINA"
FT   gene            57804..58340
FT                   /gene="spoVT"
FT                   /locus_tag="BACI_c00610"
FT   CDS_pept        57804..58340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BACI_c00610"
FT                   /product="stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02863"
FT                   /db_xref="GOA:D8GWK0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK0"
FT                   /protein_id="ADK02863.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSLGHNVLVCDRDSIIAVSGVSKKEYLNKSVGDLIEK
FT                   TMEERKSVIMTDESDVSIIDGVTEKVHSYTVGPIVANGDPIGAVIIFSKEAIISEIEHK
FT                   AVNTAASFLAKQMEQ"
FT   gene            58571..60172
FT                   /locus_tag="BACI_c00620"
FT   CDS_pept        58571..60172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00620"
FT                   /product="integral membrane protein; stage V sporulation
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02864"
FT                   /db_xref="GOA:D8GWK1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK1"
FT                   /protein_id="ADK02864.1"
FT                   /translation="MESKKYQAFWRGAIILTIASFVTKVLSAFYRIPYQNIAGDIGFYI
FT                   YQQIYPFYGFCLILATYGFPIIISKMVAERLERGKKQEAEEIICVSFWFLLGIGFIGFF
FT                   TLFFGAEAIATAMGDVHLDKLLRVISFSFILMPFLSVARGYFQGFNNMMPTAVSQVIEQ
FT                   TIRVSIIVFLSLFLIAHEFDLYTVGAGAMLGSIAGGLIGIIVLILYMRHDFRSIFFKSV
FT                   KRIKGKKKIIKILFWQGLAICVSNLVLIFIQMADSVSFYSLLIGAGEPAESAKVLKGVY
FT                   DRSIPLMQLGTVVTTSFSLSLIPIITAAKERGDLTFIREKVRLAMKITFVIGFAAAIGL
FT                   TCIIQPTNIMLFENSDGSDVLSILSLSILFSSLSITTASILQGLGQTLKPAIFVVFGGC
FT                   LKLVLNYILMPYFGAKGAAIATLVALIVISVLNSMLLMRAVSESLIDKRNMLGIVISGF
FT                   SMGFVLIMFMRVLQMSGLVMDTSHRGVATFEALLGVAIGGLAYMFLILKLRVFTKAEIG
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60185..61246
FT                   /locus_tag="BACI_c00630"
FT   CDS_pept        60185..61246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00630"
FT                   /product="tetrapyrrole"
FT                   /note="similar to N-terminal part of Corrin/Porphyrin
FT                   methylase and MazG nucleotide pyrophosphohydrolase domain
FT                   fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02865"
FT                   /db_xref="GOA:D8GWK2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK2"
FT                   /protein_id="ADK02865.1"
FT                   /translation="MSGIITILGLGAGELDQLTMGVYRKIKEADHMFVRTKEHPVIEEL
FT                   EKEGIQYTAFDNVYEAHDTFEIVYETIADTLLEQAEGAEIIYAVPGHPLVAERTVQLLL
FT                   EKGEVANVEVRIEGGQSFLDPMFASLKIDPIEGFQLIDATSFERGQLELRQHLIFCQVY
FT                   DAFVASDVKLTLMEMLPDDYEVYIVTAAGTSFEQVKKVPLYMLDHETELNNLTSVYVPP
FT                   VQERASLYQQFDVLREIIADLRGPNGCPWDKKQTHQSLKKYLIEEAYEVLEAIDEEDDD
FT                   HLVEELGDILLQVMLHAQIGEDEGWFSIDDIIRTLSEKMVRRHPHVFGNTDVNNADEVI
FT                   ANWEEIKKKKKDL"
FT   gene            61279..61644
FT                   /locus_tag="BACI_c00640"
FT   CDS_pept        61279..61644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00640"
FT                   /product="tetrapyrrole"
FT                   /note="similar to C-terminal part of Corrin/Porphyrin
FT                   methylase and MazG nucleotide pyrophosphohydrolase domain
FT                   fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02866"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK3"
FT                   /protein_id="ADK02866.1"
FT                   /translation="MPQLLRAYEIQKKAGKVGFDWVDVQPMIEKALEEWQEFQQEVTNM
FT                   DEAKMLSEFGDLLFAFVNIARHYKIDPEEALRSTNEKFVGRFLYMEAKVAEMNKEMQDL
FT                   SLEQLDVLWEEAKQTER"
FT   gene            61659..61934
FT                   /gene="hslR"
FT                   /locus_tag="BACI_c00650"
FT   CDS_pept        61659..61934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="BACI_c00650"
FT                   /product="S4 domain protein; probable heat shock protein
FT                   15"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02867"
FT                   /db_xref="GOA:D8GWK4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK4"
FT                   /protein_id="ADK02867.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVAD
FT                   ELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF"
FT   gene            61993..62301
FT                   /locus_tag="BACI_c00660"
FT   CDS_pept        61993..62301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00660"
FT                   /product="yabP family protein involved in spore coat
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02868"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK5"
FT                   /protein_id="ADK02868.1"
FT                   /translation="MNNGYSPMSSNQQNVSVEHDIIMRGRRVIDITGVKQVESFDSEEF
FT                   LLETVMGFLTIRGQNLQMKNLDVEKGVVSIKGKVHEMLYIDENQGEKTKGFFSKLFK"
FT   gene            62298..62951
FT                   /locus_tag="BACI_c00670"
FT   CDS_pept        62298..62951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00670"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02869"
FT                   /db_xref="GOA:D8GWK6"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK6"
FT                   /protein_id="ADK02869.1"
FT                   /translation="MSLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQERKRWLVFIHD
FT                   ILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGFAAYQSLLKAIYMRLLNFLIYIFVQ
FT                   TTHFFVQIIKLLMIKPVIIIAQLFIAFILFLFRILLSIGHVLWKMVIWILLFIWKVFFW
FT                   PVRFIASLIWKLLPNRVKLFIMKHVGFLQYIAKLKGHIFQLWERIKKKLGGPRK"
FT   gene            62948..63307
FT                   /gene="divIC1"
FT                   /locus_tag="BACI_c00680"
FT   CDS_pept        62948..63307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC1"
FT                   /locus_tag="BACI_c00680"
FT                   /product="cell division protein DIVIC"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02870"
FT                   /db_xref="GOA:D8GWK7"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK7"
FT                   /protein_id="ADK02870.1"
FT                   /translation="MRELRQRTIEKQSPNPVKEHIIQTDENRKRLYRRLAVFLVFAFTI
FT                   IASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKLNDEEYVLKIARRD
FT                   YFFSGKGEIIFPVSK"
FT   gene            63395..63877
FT                   /gene="yabR"
FT                   /locus_tag="BACI_c00690"
FT   CDS_pept        63395..63877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BACI_c00690"
FT                   /product="S1 RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02871"
FT                   /db_xref="GOA:D8GWK8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK8"
FT                   /protein_id="ADK02871.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPEGLTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKEREKTEGDRPRGEYQRGGDQQRSGRPQ
FT                   RNRSFNRDNRGGGNDRAPKETFEQKMARFLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            64038..64111
FT                   /locus_tag="BACI_c00700"
FT   tRNA            64038..64111
FT                   /locus_tag="BACI_c00700"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            64125..64196
FT                   /locus_tag="BACI_c00710"
FT   tRNA            64125..64196
FT                   /locus_tag="BACI_c00710"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            64232..64432
FT                   /locus_tag="BACI_c00720"
FT   CDS_pept        64232..64432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02872"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWK9"
FT                   /protein_id="ADK02872.1"
FT                   /translation="MLNKLRHTTLLQNHPIFSECSIKILKIKYILCIYVELFRIKSRTI
FT                   IKVKTVVLTKIPIIIFYNDSN"
FT   gene            64480..66927
FT                   /gene="spoIIE"
FT                   /locus_tag="BACI_c00730"
FT   CDS_pept        64480..66927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BACI_c00730"
FT                   /product="serine/threonine specific protein phosphatase;
FT                   stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02873"
FT                   /db_xref="GOA:D8GWL0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL0"
FT                   /protein_id="ADK02873.1"
FT                   /translation="MNTSALAMNEGQLGGVKWTSKLRMKFEQVFFRWGFIIVVIGFLLG
FT                   RAYILTNILPFALPFFAAVYVMKRDKMPLAFLALMGGALSVSIDNLFFTFASIFTFFIY
FT                   NIFFSRFTRKTVGLVPFQVFISALTAHLVVVYFAQQTVTMYDLLVSTIEAGLSFVLTMI
FT                   FLQSVPLLVERKGKQQALETEEIVCLIILLASVLTGTTDWFVYDASIQHIFTRYLVLVF
FT                   AFIAGAATGSTVGVVTGLILSLANVSSLSQLSLLAFSGLLGGLLKEGKRIGVSLGLLIG
FT                   TSLITLYVDKQTNIVTTLIESGVAIAFFLLTPKLVMDRIAKFMPGTQEHSQDQQQYLRR
FT                   MRDVTANKINQFANVFAALSNSFSVYGYVEEEDKETEADLFLSTITAKTCQTCFKKDQC
FT                   WVVNFDKTYDYMKQIMSETEEGTLQHNRKLVREWDKHCVRGKKVTDLVAGELDHFYEGQ
FT                   KLRKQMKENRRIVAEQLLGVSKVMEDFAKEIQRERENHQVQEEQILQAFRDFGVEIEHV
FT                   DIYCLDRGSIDIEMLIPVASNEHGECEKLVAPMLSDILKENIVVKHEEKSSYPNGHSLI
FT                   SFGSAKTYSLDTGLATAAKGGGFVSGDSYAMMDLSVGKYALAISDGMGNGQRAHMESKE
FT                   TVKLLQKILQSGIDEEIAIKSINSILSLRTTEEMFTTLDLAMVDLRDASAKFLKIGSTP
FT                   SFVKRANNILKIEASNLPMGIIEDVEVDVVGEQLKTGDILIMMSDGIFEGAQHVENHEL
FT                   WMKRKIKELQTEDPQEIADIIMEEVIRSGDGYINDDMTIVVAKVKKNMPKWATIPIVGM
FT                   QAQ"
FT   gene            67161..68591
FT                   /gene="mesJ"
FT                   /locus_tag="BACI_c00740"
FT   CDS_pept        67161..68591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="BACI_c00740"
FT                   /product="cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02874"
FT                   /db_xref="GOA:D8GWL1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL1"
FT                   /protein_id="ADK02874.1"
FT                   /translation="MKDTFVEKVDDFVRQHDVLKERSTIVVGVSGGPDSLALLYYLLEK
FT                   RAAKQFEIVVAHVDHMFRGDESHEDLQFVQDLCKGLGVICETIRINVSQYQKQYGMNAQ
FT                   VAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFH
FT                   NGYLIRPLLGVTKEEIVNYCNELKIIPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQVH
FT                   EKFQKFSMQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLI
FT                   LNYLYEYKIPSSLSSIHIDKVIEFFKRTQPSGSLDFPGDLKIVRAYEECSFGFKQEIVS
FT                   PFLQDLSVPGTITLSNGDKLVTEVSEDIPSDMNETVFVAKYNDISYPIRIRSRENGDRM
FT                   SIQGMNGTKKIKAIFIEAKVPREKREEWPVVCDASGNIIWLPLLKRSAFAISKETAKKD
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68588..69130
FT                   /gene="hprT"
FT                   /locus_tag="BACI_c00750"
FT   CDS_pept        68588..69130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BACI_c00750"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02875"
FT                   /db_xref="GOA:D8GWL2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL2"
FT                   /protein_id="ADK02875.1"
FT                   /translation="MMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVPLAIGVLKGA
FT                   MPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDS
FT                   GLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQ
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69216..71117
FT                   /gene="ftsH"
FT                   /locus_tag="BACI_c00760"
FT   CDS_pept        69216..71117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BACI_c00760"
FT                   /product="cell division protein"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02876"
FT                   /db_xref="GOA:D8GWL3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL3"
FT                   /protein_id="ADK02876.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGIVSYFNGSTQKTTSVSYDKFITKLE
FT                   KGEVRNVQLQPKNGVFEVKGQFNNSSQGEQFVTYAPNTEELQKKINDKAQGAEVKYQPA
FT                   EETSAWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYNDEKKKVRFRD
FT                   VAGADEEKQELVEVVEFLKDPRKFAEVGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGANEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVNGREAV
FT                   LKVHARNKPLDENINLRAIATRTPGFSGADLENLLNEAALVAARQDKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERNIVAFHEAGHTVIGVVLDEADVVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATGIARRMVTEFGM
FT                   SDKLGPMQFGSSQGGQVFLGRDFHSEQNYSDAIAHEIDMEMQTIMKECYARAKQILTDN
FT                   RDKLDLVAKTLLEVETLDAEQINHLCDYGRLPERPTSSADVKVNINMKKDDEESEDK"
FT   gene            71342..72130
FT                   /gene="yacB"
FT                   /locus_tag="BACI_c00770"
FT   CDS_pept        71342..72130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacB"
FT                   /locus_tag="BACI_c00770"
FT                   /product="transcriptional activator, Bvg accessory
FT                   factor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02877"
FT                   /db_xref="GOA:D8GWL4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL4"
FT                   /protein_id="ADK02877.1"
FT                   /translation="MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQ
FT                   LLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYS
FT                   RAAKLPRIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGG
FT                   LAKLISEESNVIDVVDPFLTLKGLYMLYERNANLQHEKGE"
FT   gene            72137..73012
FT                   /gene="hslO"
FT                   /locus_tag="BACI_c00780"
FT   CDS_pept        72137..73012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BACI_c00780"
FT                   /product="Hsp33-like chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02878"
FT                   /db_xref="GOA:D8GWL5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL5"
FT                   /protein_id="ADK02878.1"
FT                   /translation="MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGR
FT                   SLTAGTMMGAMLKGDQKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGK
FT                   LRVYQAVGTEGFVTVIKDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVL
FT                   VNGDDSILAAGGFILQIMPGAQEETISFIEERLQKIPPVSTLIEQGLSPEELLYAVLGE
FT                   DKVKVLETMDVQFNCTCSRERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSK
FT                   EDITNLIENL"
FT   gene            73117..74040
FT                   /gene="cysK1"
FT                   /locus_tag="BACI_c00790"
FT   CDS_pept        73117..74040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="BACI_c00790"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02879"
FT                   /db_xref="GOA:D8GWL6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL6"
FT                   /protein_id="ADK02879.1"
FT                   /translation="MRVAQSVSELIGKTPIVKLNRIVESDSADIYLKLEFMNPGSSVKD
FT                   RIALAMIEDAEKKGLLKEGDTIIEPTSGNTGIGLAMVAAAKGYKAILVMPETMSVERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRQATELAKEHGYFIPQQFKNQSNPEIHRLTTGPEIVE
FT                   QMGDQLDAFIAGIGTGGTITGAGEVLKEAYKDIKIYAVEPADSPVLSGGKPGPHKIQGI
FT                   GAGFVPETLDVEVYDEIIQVKTEQAFEYARRVAKEEGILVGISSGAVIYAATEVAKKLG
FT                   KGKKVLVIIPSNGERYLSTPLYQFES"
FT   gene            74261..75658
FT                   /gene="pabB"
FT                   /locus_tag="BACI_c00800"
FT   CDS_pept        74261..75658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BACI_c00800"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02880"
FT                   /db_xref="GOA:D8GWL7"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010118"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL7"
FT                   /protein_id="ADK02880.1"
FT                   /translation="MQRRKSLALSIPYQLDFFKQYKFLSKDKPQHILLESGRGGRYNIV
FT                   GLNPVAVIRGKGETLHISESGKETIKQGNPLDLMQEYMERWKTDYNPEYPPFQGGAIGY
FT                   FSYDCIRYIEKLPSLAEDDINIPDIFFLLFDDVFVYDQKEKVLWIITHYVDKHEEAKER
FT                   LNQWKILWAAEAPEVNIPFACPEKKNEAVAFTEESFMKAVECIQAYIGAGDVFQVNLST
FT                   RQERTLQTHPLEIYTSLREINPSPYMGYLELGDFQIVSGSPELLIKKQGTEVSTRPIAG
FT                   TRSRGANEQEDEELARELIENEKERAEHVMLVDLERNDLGRVCKYGTVEVDEFMVIEKY
FT                   SHVMHIVSNVRGEVEEDKDAFDLVKAVFPGGTITGAPKIRTMEIIEELEPVRRGIYTGS
FT                   IGWIGYSGDTELNIVIRTLLAKDGKAHVQAGAGIVIDSNPENEYKESLKKAIALWRAKE
FT                   RSEETVR"
FT   gene            75664..76251
FT                   /gene="pabA1"
FT                   /locus_tag="BACI_c00810"
FT   CDS_pept        75664..76251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA1"
FT                   /locus_tag="BACI_c00810"
FT                   /product="para-aminobenzoate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02881"
FT                   /db_xref="GOA:D8GWL8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL8"
FT                   /protein_id="ADK02881.1"
FT                   /translation="MILMIDNYDSFTFNLVQFLGELGQELVVKRNDEVTISDIENMKPD
FT                   FLMISPGPCSPNEAGISMDVIRYFAGKIPIFGVCLGHQSIAQVFGGEVVRAERLMHGKT
FT                   SPMHHDGKTIFSDIPNPFTATRYHSLIVKKETLPDCLEVTSWTEEGEIMALRHTTLPIE
FT                   GVQFHPESIMTSHGKELLQNFIRKYSPSVTSC"
FT   gene            76245..77117
FT                   /gene="pabC"
FT                   /locus_tag="BACI_c00820"
FT   CDS_pept        76245..77117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BACI_c00820"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02882"
FT                   /db_xref="GOA:D8GWL9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWL9"
FT                   /protein_id="ADK02882.1"
FT                   /translation="MLIYVNGQYVKASEARISPYDHGYLYGLGVFETFRIYNGHPFLLD
FT                   DHYDRLIDALDTLQIKWTMTKDEVLLILKNLLIKNKLENAYVRFNVSAGIDEIGLQTEM
FT                   YEEPSVIVFIKPLAAPGEVAEKEGVVLKQVRNTPEGAARLKSHHYLNNILGKREIGNVV
FT                   NKEGIFLTETGYVAEGIVSNLFFVKGDILYTPSLETGILNGITRAFIIKVAEELGIKVK
FT                   EGFFTKDELLSADEVFVTNSIQEIVPLNRIEERDFPGKVGMVTKGFINLYEMQREKLWS
FT                   RNELRRGDV"
FT   gene            77092..77952
FT                   /gene="sul"
FT                   /locus_tag="BACI_c00830"
FT   CDS_pept        77092..77952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /locus_tag="BACI_c00830"
FT                   /product="DHPS, dihydropteroate pyrophosphorylase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02883"
FT                   /db_xref="GOA:D8GWM0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM0"
FT                   /protein_id="ADK02883.1"
FT                   /translation="MNCEEEMCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDG
FT                   GSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVK
FT                   LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYR
FT                   NLMADMIADLYDSVKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPV
FT                   LLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMI
FT                   GKGVK"
FT   gene            77953..78315
FT                   /gene="folB"
FT                   /locus_tag="BACI_c00840"
FT   CDS_pept        77953..78315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BACI_c00840"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02884"
FT                   /db_xref="GOA:D8GWM1"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM1"
FT                   /protein_id="ADK02884.1"
FT                   /translation="MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESD
FT                   DLEHSVNYGELFELCRKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKPDPPI
FT                   PGHYRAVAVEITRERP"
FT   gene            78312..78827
FT                   /gene="folK"
FT                   /locus_tag="BACI_c00850"
FT   CDS_pept        78312..78827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BACI_c00850"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="7,8-dihydro-6-hydroxymethylpterin"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02885"
FT                   /db_xref="GOA:D8GWM2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM2"
FT                   /protein_id="ADK02885.1"
FT                   /translation="MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIKVEDVSSVYETE
FT                   PVGYTDQSCFLNLVIKISTNLSPQELLKITQKVENDLGRKREIRWGPRTIDLDILLYNQ
FT                   ENIEAENLIVPHPRMFERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGE
FT                   DAFVLFEN"
FT   gene            78779..78982
FT                   /locus_tag="BACI_c00860"
FT   CDS_pept        78779..78982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c00860"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02886"
FT                   /db_xref="GOA:D8GWM3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM3"
FT                   /protein_id="ADK02886.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSP
FT                   SQDFVVEVAKALKVSIDELMPK"
FT   gene            79006..80004
FT                   /gene="yacF"
FT                   /locus_tag="BACI_c00870"
FT   CDS_pept        79006..80004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="BACI_c00870"
FT                   /product="possible TIM-barrel protein, NifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02887"
FT                   /db_xref="GOA:D8GWM4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM4"
FT                   /protein_id="ADK02887.1"
FT                   /translation="MLKIANIEMKNPVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILLNNKRTLDMLYIDEREKPLSLQIFGGEKETLVDAAKYVDQYTTADIIDINMGCPV
FT                   PKIVKCDAGAKWLLDPNKIYEMVAAVVDAVEKPVTVKMRIGWDEDHIFAIENAKAVERA
FT                   GGQAVAVHGRTRVQMYEGKADWDIIKQVKQAVNIPVIGNGDVATPQDAKRMLDEIGVDG
FT                   VMIGRAALGDPWMIYRTVKYLETGELMPEPTVREKIDVCMLHLDRLIDLKNENVAVREM
FT                   RKHAAWYLKGIRGNATVRNGINACNTREDLANVLGVFVEEVETKQQTIHVG"
FT   gene            80164..81663
FT                   /gene="lysS1"
FT                   /locus_tag="BACI_c00880"
FT   CDS_pept        80164..81663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS1"
FT                   /locus_tag="BACI_c00880"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02888"
FT                   /db_xref="GOA:D8GWM5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM5"
FT                   /protein_id="ADK02888.1"
FT                   /translation="MDNMNHEELNDQLLVRREKLHNLREQGIDPFGKRFERTNATNDLL
FT                   SLYGEFSKEELEEKEISVSIAGRIMTKRGKGKAGFAHIQDLHGQVQIYVRKDAVGDEEY
FT                   ELFKTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFITHHN
FT                   ALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY
FT                   KYIMKLTENMVAHIAKQVLGTTTIQYGDYEINLEPEWTRLHMVDAIKEHSGADFWNPMS
FT                   VEEARELAKEHNVEIKDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDE
FT                   DPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQD"
FT   gene            82043..83581
FT                   /locus_tag="BACI_c00890"
FT   rRNA            82043..83581
FT                   /locus_tag="BACI_c00890"
FT                   /product="16S ribosomal RNA"
FT   gene            83735..86655
FT                   /locus_tag="BACI_c00900"
FT   rRNA            83735..86655
FT                   /locus_tag="BACI_c00900"
FT                   /product="23S ribosomal RNA"
FT   gene            86759..86873
FT                   /locus_tag="BACI_c00910"
FT   rRNA            86759..86873
FT                   /locus_tag="BACI_c00910"
FT                   /product="5S ribosomal RNA"
FT   gene            86878..86953
FT                   /locus_tag="BACI_c00920"
FT   tRNA            86878..86953
FT                   /locus_tag="BACI_c00920"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            86958..87033
FT                   /locus_tag="BACI_c00930"
FT   tRNA            86958..87033
FT                   /locus_tag="BACI_c00930"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            87047..87122
FT                   /locus_tag="BACI_c00940"
FT   tRNA            87047..87122
FT                   /locus_tag="BACI_c00940"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            87138..87218
FT                   /locus_tag="BACI_c00950"
FT   tRNA            87138..87218
FT                   /locus_tag="BACI_c00950"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   gene            87248..87322
FT                   /locus_tag="BACI_c00960"
FT   tRNA            87248..87322
FT                   /locus_tag="BACI_c00960"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            87339..87427
FT                   /locus_tag="BACI_c00970"
FT   tRNA            87339..87427
FT                   /locus_tag="BACI_c00970"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   gene            87431..87504
FT                   /locus_tag="BACI_c00980"
FT   tRNA            87431..87504
FT                   /locus_tag="BACI_c00980"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            87513..87586
FT                   /locus_tag="BACI_c00990"
FT   tRNA            87513..87586
FT                   /locus_tag="BACI_c00990"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCA"
FT   gene            87596..87671
FT                   /locus_tag="BACI_c01000"
FT   tRNA            87596..87671
FT                   /locus_tag="BACI_c01000"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            87757..89295
FT                   /locus_tag="BACI_c01010"
FT   rRNA            87757..89295
FT                   /locus_tag="BACI_c01010"
FT                   /product="16S ribosomal RNA"
FT   gene            89449..92369
FT                   /locus_tag="BACI_c01020"
FT   rRNA            89449..92369
FT                   /locus_tag="BACI_c01020"
FT                   /product="23S ribosomal RNA"
FT   gene            92421..92535
FT                   /locus_tag="BACI_c01030"
FT   rRNA            92421..92535
FT                   /locus_tag="BACI_c01030"
FT                   /product="5S ribosomal RNA"
FT   gene            92741..93202
FT                   /gene="ctsR"
FT                   /locus_tag="BACI_c01040"
FT   CDS_pept        92741..93202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BACI_c01040"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02889"
FT                   /db_xref="GOA:D8GWM6"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM6"
FT                   /protein_id="ADK02889.1"
FT                   /translation="MRNISDIIEQYLKQVIDLSNNNVIEIKRNEIADRFECVPSQINYV
FT                   INTRFTLERGFVVESKRGGGGYIRIIKVKLHDDIDIIDQMLHMIDHSVAQGNAESMIIR
FT                   LIEEGIITNREAKLMLSVLDRSVLSMDVPSRDELRARILCAMLRTLKYK"
FT   gene            93362..93910
FT                   /locus_tag="BACI_c01050"
FT   CDS_pept        93362..93910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01050"
FT                   /product="UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02890"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM7"
FT                   /protein_id="ADK02890.1"
FT                   /translation="MTCQNCNIRPATLHYTKVINEKKAEVHLCEQCAEQSGYTSFFQSS
FT                   QSNFSFHDLFAGLLHGESTMFEEGKSGFSNTNILRCPDCKMTYEQLTKVGRFGCASCYD
FT                   TFKEHLKPLLKRLHGGHTDHCGKIPKRIEGNIHLKKELDELKLILKQYVQKEEFEKAAE
FT                   VRDKIRNLENQLSEHREGE"
FT   gene            93915..94979
FT                   /gene="karG"
FT                   /locus_tag="BACI_c01060"
FT   CDS_pept        93915..94979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="karG"
FT                   /locus_tag="BACI_c01060"
FT                   /product="putative ATP:guanido phosphotransferase"
FT                   /EC_number="2.7.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02891"
FT                   /db_xref="GOA:D8GWM8"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM8"
FT                   /protein_id="ADK02891.1"
FT                   /translation="MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKKYQFSTMQ
FT                   NEEETKQIQELFKKEFINKTVEPFGEFELLKMNELTPLQRRVLVEKHLISPNLAGTEYG
FT                   ACLLSESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGY
FT                   ITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQ
FT                   VSNQMTLGKSEEDIIADLKSVIQQIIQQEKMARELIVQNSSIELEDKVYRSYGILANSR
FT                   LIQSAEAANCLSDLRLGIDLGYIQGISRNILTELMVLTQPGILQQYAGGPLGPEERDYR
FT                   RATLIRERLRIEKN"
FT   gene            95002..97437
FT                   /gene="clpC"
FT                   /locus_tag="BACI_c01070"
FT   CDS_pept        95002..97437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BACI_c01070"
FT                   /product="negative regulator of genetic competence
FT                   clpC/mecB"
FT                   /note="ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02892"
FT                   /db_xref="GOA:D8GWM9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWM9"
FT                   /protein_id="ADK02892.1"
FT                   /translation="MMFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGI
FT                   AAKALIALGLSPEKVQKEVEALIGRGTEASQTVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANTPT
FT                   LDSLARDLTVVARENRLDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPSLDESTQILKGLRDRYEAHHRVSITDDAIDAAVKLSDRYITDRFLPDKAIDLIDEA
FT                   ASKVRLRSYTTPPNLKELEVKLEEIRKEKDAAVQSQEFEKAASLRDMEQRLREKLEDTK
FT                   RQWKEQQGKENSEVTVEDIANVVSTWTRIPVSKLAQTETDKLLNLESILHDRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIVIMTSNVGAEALKRNKHLGFNVQDESRDYSDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHMLEKKHIQEIVTLMVNQLVNRLKEQEIELHLTEGAISAIA
FT                   DKGFDREYGARPLRRAIQKHVEDRLSEELLKGAIEKGQKVIFDVEGESFVIHSAEKVK"
FT   gene            97534..98910
FT                   /gene="radA"
FT                   /locus_tag="BACI_c01080"
FT   CDS_pept        97534..98910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BACI_c01080"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02893"
FT                   /db_xref="GOA:D8GWN0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN0"
FT                   /protein_id="ADK02893.1"
FT                   /translation="MAKKKTKFTCQECGYQSPKYMGKCPGCGQWNTLVEEMEPVVSSRR
FT                   LNYANAIQTEVIKPRRLTEVETKSEARIETKFQEFNRVLGGGIVDGSLVLIGGDPGIGK
FT                   STLLLQISSQLADSSYDVLYISGEESAKQIKLRADRLHVNGSNLFVVSETDLQRIATHI
FT                   EEVNPAFVVIDSIQTIHLPEVTSAPGSVAQVRECTAELMKLAKTKGIPIFIVGHVTKEG
FT                   AIAGPRMLEHMVDAVLYFEGDRHHTYRILRAVKNRFGSTNEMGIFEMKELGLAEVLNPS
FT                   EIFLEERPVGVAGSTVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLIMA
FT                   VLEKRTGLLLQNQDAYLKVAGGLKLDEPAIDLAVALSIASSFRDKSTAPTDAVIGEVGL
FT                   TGEIRRVSRIEQRVQEAAKLGFQRAIIPRKNLGGWTIPDGIEVVGVSNLGEALRLTLGG
FT                   "
FT   gene            98914..99987
FT                   /gene="yacK"
FT                   /locus_tag="BACI_c01090"
FT   CDS_pept        98914..99987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacK"
FT                   /locus_tag="BACI_c01090"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02894"
FT                   /db_xref="GOA:D8GWN1"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN1"
FT                   /protein_id="ADK02894.1"
FT                   /translation="MEENKQRVKSMINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN
FT                   EQIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPESSIDSIET
FT                   GMRHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKY
FT                   KAVWNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQ
FT                   LTELLADLEAEAALLIKDYYQEKTQDHHQILKKLQELANTQLLEDSDLVKLLGYPGQTS
FT                   LEESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKKI
FT                   REGLKRIQEHLYMSRHN"
FT   gene            100148..101257
FT                   /gene="yacL"
FT                   /locus_tag="BACI_c01100"
FT   CDS_pept        100148..101257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BACI_c01100"
FT                   /product="conserved hypothetical protein"
FT                   /note="PIN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02895"
FT                   /db_xref="GOA:D8GWN2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN2"
FT                   /protein_id="ADK02895.1"
FT                   /translation="MLKRIVQLFFLVIGGALGIYLIPKVINVLDIGAVPLLEGSYVRAI
FT                   IGAIILFLTTFWLVDYIVQLIKHIEEALVKAPVADVLFGTLGLISGLIVAYLILIPIRE
FT                   FTIPVISTVLQVFFTLLLGYLGFQVGFKKRNELLGLFTLPQRGKKKNNNSENEEPENEV
FT                   EESLAHWKILDTSVIIDGRIADICQTKFLEGTIVIPQFVLEELQHIADSSDALKRNRGR
FT                   RGLDILNRIQKEMPIPVEIYEGDFDDIQEVDSKLVKLAKITGGTVVTNDFNLNKVSELQ
FT                   GVTVLNINDLANAIKPVVLPGEELSVYVVKDGKEQNQGVAYLDDGTMIVVEDGREYVGS
FT                   QLDVLVTSVLQTSAGRMIFAKRKLLEKAL"
FT   gene            101274..101954
FT                   /gene="ispD"
FT                   /locus_tag="BACI_c01110"
FT   CDS_pept        101274..101954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BACI_c01110"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02896"
FT                   /db_xref="GOA:D8GWN3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN3"
FT                   /protein_id="ADK02896.1"
FT                   /translation="MYTLIIPAAGQGKRMGAGKNKLFLLINEVPIIVHTLRAFEKDKAC
FT                   KNIIMAINEEERPYFEELMQKYPVEKPVQFIQGGAERQDSVYNAIQHTTDVEYVLVHDG
FT                   ARPFVTNKVIQDVLTAAEKYGASICAVPVKDTVKKVEQGVVVETVERSQLKAVQTPQGF
FT                   SVSLLLEAHRSAKQSCFLGTDDASLVERIGKQVGVVEGSYYNIKVTTPEDLLIAESFLH
FT                   VQKK"
FT   gene            102069..102545
FT                   /gene="ispF"
FT                   /locus_tag="BACI_c01120"
FT   CDS_pept        102069..102545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BACI_c01120"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02897"
FT                   /db_xref="GOA:D8GWN4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN4"
FT                   /protein_id="ADK02897.1"
FT                   /translation="MFRIGQGFDVHEFAEGRPLIIGGITIPHEKGLIGHSDADVLLHTI
FT                   ADACLGAIAAGDIGKHFPDTDPAFKDADSAVLLQKVWEFVREQGYELGNLDCTIIAQKP
FT                   KMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIASQAVVLLQKK"
FT   gene            102635..104092
FT                   /gene="gltX"
FT                   /locus_tag="BACI_c01130"
FT   CDS_pept        102635..104092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BACI_c01130"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02898"
FT                   /db_xref="GOA:D8GWN5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN5"
FT                   /protein_id="ADK02898.1"
FT                   /translation="MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIED
FT                   TDVKRNVAGGEESQLKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGL
FT                   AYKCYMTEEELEAEREGQIARGETPRYAGNHRDLTEAQVKAFEAEGRIPSIRFRVPADR
FT                   DYTFKDIVKDEVAFHSNDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNT
FT                   PKQMMIYEAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFI
FT                   ALLGWSPVGEEEIFSQEEFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVEL
FT                   SLPHLVKAGRIGETLSEQEQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQ
FT                   EVLKGEQVPEVLRAFAGQVEALEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQ
FT                   THGPELPNAIALLGKEKVLNRLQKVIG"
FT   misc_binding    104140..104387
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="BACI_c01140; T-box leader, RF00230"
FT   gene            104525..105190
FT                   /gene="cysE"
FT                   /locus_tag="BACI_c01150"
FT   CDS_pept        104525..105190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BACI_c01150"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02899"
FT                   /db_xref="GOA:D8GWN6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN6"
FT                   /protein_id="ADK02899.1"
FT                   /translation="MFKRLREDIEVVFEQDPAARSYFEVILTYSGLHAVWAHRIAHAFY
FT                   KKNFFFIARWISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGI
FT                   PGRVVIQNGVKIGQELNHSDLPDPIFDKLKVMEVELDKLKKQLEVKVERKDKNDYSHL"
FT   gene            105171..106568
FT                   /gene="cysS"
FT                   /locus_tag="BACI_c01160"
FT   CDS_pept        105171..106568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BACI_c01160"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02900"
FT                   /db_xref="GOA:D8GWN7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN7"
FT                   /protein_id="ADK02900.1"
FT                   /translation="MTIHIYNTLTRQKEEFTPLEENKVKMYVCGPTVYNYIHIGNARPP
FT                   MVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIADRFVEAYFEDVTAL
FT                   GCKHATVHPRVTENMDIIIEFIQELVNKGYAYESEGDVYFRTKEFEGYGKLSHQPIADL
FT                   RHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIECSAMARKYLGDTID
FT                   IHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKMSKSLGNFILVHDII
FT                   KQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNLKHRMESSTDLTDHN
FT                   EKWLADLEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEEHTSTVVIEAYVKQL
FT                   ETLFDILGLELAQEELLDEEIEELIQKRIEARKNRDFALSDQIRDDLKDRNIILEDTAQ
FT                   GTRWKRG"
FT   gene            106571..106978
FT                   /gene="yazC"
FT                   /locus_tag="BACI_c01170"
FT   CDS_pept        106571..106978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazC"
FT                   /locus_tag="BACI_c01170"
FT                   /product="ribonuclease III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02901"
FT                   /db_xref="GOA:D8GWN8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN8"
FT                   /protein_id="ADK02901.1"
FT                   /translation="MIDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTS
FT                   FVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIG
FT                   YHHLLNNRERLDEIVYKAIAVLEEKEGGTSS"
FT   gene            106975..107718
FT                   /gene="spoU1"
FT                   /locus_tag="BACI_c01180"
FT   CDS_pept        106975..107718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU1"
FT                   /locus_tag="BACI_c01180"
FT                   /product="tRNA/rRNA methyltransferase (SpoU); probable TrmH
FT                   family"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02902"
FT                   /db_xref="GOA:D8GWN9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWN9"
FT                   /protein_id="ADK02902.1"
FT                   /translation="MSSEYIIGRNPVIEALRSGRDINKIWIAEGAAKGQVQIVLALAKE
FT                   NKIILQHAPKKKLDQLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDPFFLILDEIE
FT                   DPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDE
FT                   LKERGLWIAGTDAKGKTDYRNLDGKMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKV
FT                   TSLNASVAASLLMYEVYRKRNEIGK"
FT   gene            107722..108234
FT                   /gene="yacP"
FT                   /locus_tag="BACI_c01190"
FT   CDS_pept        107722..108234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacP"
FT                   /locus_tag="BACI_c01190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02903"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP0"
FT                   /protein_id="ADK02903.1"
FT                   /translation="MNDILIVDGYNIIGAWGDLKKLRDVDLQSSRDALIDKMADYQGYT
FT                   GTKVMIVFDAYTVHGIEKKMKQSRVEVIFTRKNQTADEKIEQLAIELRNINTQIYVATS
FT                   DYTEQWVIFAQGALRKSARELELEVQAMEQQVRRRTQDTKEKQPAMRKIFSKDITEKLE
FT                   KLRRGER"
FT   gene            108302..108958
FT                   /gene="spo0H"
FT                   /locus_tag="BACI_c01200"
FT   CDS_pept        108302..108958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0H"
FT                   /locus_tag="BACI_c01200"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="SigH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02904"
FT                   /db_xref="GOA:D8GWP1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP1"
FT                   /protein_id="ADK02904.1"
FT                   /translation="MEAGFVSVGDVTFRDLEDEAIVELVRKGNTDALEYLIHKYKNFVR
FT                   AKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELL
FT                   SDLERKVLSLYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYMEMRESTTSN"
FT   gene            109269..109448
FT                   /gene="secE"
FT                   /locus_tag="BACI_c01210"
FT   CDS_pept        109269..109448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BACI_c01210"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02905"
FT                   /db_xref="GOA:D8GWP2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP2"
FT                   /protein_id="ADK02905.1"
FT                   /translation="MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAV
FT                   VDMGISSLIRLILG"
FT   gene            109580..110113
FT                   /gene="nusG"
FT                   /locus_tag="BACI_c01220"
FT   CDS_pept        109580..110113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BACI_c01220"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02906"
FT                   /db_xref="GOA:D8GWP3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP3"
FT                   /protein_id="ADK02906.1"
FT                   /translation="MEKSWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEVE
FT                   VEMKNGKEKLMKRKVFPGYVLVELIMTDDSWYVVRNTPGVTGFVGSSGSGSKPSPLLEE
FT                   EVVTIMKHMGMDNEVVDFDFELHETVRVNEGPFADYTGAIEEIDVEKKKVSVLVDMFGR
FT                   ETPVELDFHQIEKL"
FT   gene            110281..110706
FT                   /gene="rplK"
FT                   /locus_tag="BACI_c01230"
FT   CDS_pept        110281..110706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BACI_c01230"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02907"
FT                   /db_xref="GOA:D8GWP4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP4"
FT                   /protein_id="ADK02907.1"
FT                   /translation="MAKKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   gene            110884..111576
FT                   /gene="rplA"
FT                   /locus_tag="BACI_c01240"
FT   CDS_pept        110884..111576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BACI_c01240"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02908"
FT                   /db_xref="GOA:D8GWP5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP5"
FT                   /protein_id="ADK02908.1"
FT                   /translation="MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDADYIGKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDAKLVENFRTIADTLQKVKPAAAKGTYMKNVTVASTMGPGV
FT                   RVDVSTLA"
FT   misc_feature    111626..111769
FT                   /note="BACI_c01250; ribosomal protein L10 leader, RF00557"
FT   gene            111809..112309
FT                   /gene="rplJ"
FT                   /locus_tag="BACI_c01260"
FT   CDS_pept        111809..112309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BACI_c01260"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02909"
FT                   /db_xref="GOA:D8GWP6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP6"
FT                   /protein_id="ADK02909.1"
FT                   /translation="MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQL
FT                   REAGVEFKVYKNSLTRRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHE
FT                   ALEIKAGVIEGKLVTLDEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEE
FT                   QGA"
FT   gene            112377..112736
FT                   /gene="rplL"
FT                   /locus_tag="BACI_c01270"
FT   CDS_pept        112377..112736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BACI_c01270"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02910"
FT                   /db_xref="GOA:D8GWP7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP7"
FT                   /protein_id="ADK02910.1"
FT                   /translation="MTKEQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAGE
FT                   AAAEKTEFDVELTSAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEAAAKEEAEE
FT                   IKAKLEEVGAAVEVK"
FT   gene            112813..113412
FT                   /gene="ybxB"
FT                   /locus_tag="BACI_c01280"
FT   CDS_pept        112813..113412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxB"
FT                   /locus_tag="BACI_c01280"
FT                   /product="conserved hypothetical protein"
FT                   /note="possible methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02911"
FT                   /db_xref="GOA:D8GWP8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP8"
FT                   /protein_id="ADK02911.1"
FT                   /translation="MADHYFSNDPSSKSDRKRWEFTLRGSQFTFLSDRGVFSKNEVDFG
FT                   SRLLIEAFQVPDIKGDILDVGCGYGPIGLSLAKEFQDRKVHMVDVNERALELAKENAAN
FT                   NKIGNVHIFQSSVYENVDGMYAAILSNPPIRAGKDVVHEILEKAVEHLVPGGELWIVIQ
FT                   KKQGAPSALKKLEEVFSEVEVVEKKKGYYIIKSKKR"
FT   gene            113705..117238
FT                   /gene="rpoB"
FT                   /locus_tag="BACI_c01290"
FT   CDS_pept        113705..117238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BACI_c01290"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02912"
FT                   /db_xref="GOA:D8GWP9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D8GWP9"
FT                   /protein_id="ADK02912.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVDECKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEITELLGDNEYLSNTLE
FT                   KDNTDSTEKALLEIYERLRPGEPPTVENAKSLLVSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAAEGTILDRRTLDRILPYLEKNIGFKTAKPMGGVVEG
FT                   DVELQSIKIYAPESEGERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVGDTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNAITPQALINIRPVIASIK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFAKVNEFGFIETPYRRVDPETGLVTGHVDYLTADEEDNYVVAQA
FT                   NMKLSEEGEFLDEDIVARFRGENIVTNKERIDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPIVGTGMEYVSAKDSGAAVICKHPGIVERVEAREVWVRRY
FT                   VEVDGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSVGNEVVKGEILADGPSMELGELA
FT                   LGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRAYIVQKRKISEGDKMAGRHGN
FT                   KGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARYLGIHIATP
FT                   VFDGAREEDVWGTIEEAGMANDAKTILYDGRTGEPFDNRVSVGVMYMIKLAHMVDDKLH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMMSSDDTEIEMRDTEDDDDHQSAD
FT                   KLNVEVETTKE"
FT   gene            117276..120887
FT                   /gene="rpoC"
FT                   /locus_tag="BACI_c01300"
FT   CDS_pept        117276..120887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BACI_c01300"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02913"
FT                   /db_xref="GOA:D8GXG7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXG7"
FT                   /protein_id="ADK02913.1"
FT                   /translation="MIDVNNFEYMKIGLASPDKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTESGDTPLDKKQLLSEKEYRAYRDRYG
FT                   STFQAAMGAEAIKKLLQDIDLDKEVDFLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNE
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFK
FT                   DANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFP
FT                   YINEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRFKITE
FT                   TSRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITE
FT                   EERYDRVISIWSNAKDVIQGKLMKSLNKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLLIGAIKEGNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITED
FT                   IAHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAVISEIDGVIAAINDVKDRQE
FT                   VVVQGEVEARTYAIPYGARLKVIPGQKISHGKELTEGSIDPKELLKVTDITAVQEYLLR
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLL
FT                   QGKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVII
FT                   GKLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVYVEQ"
FT   gene            121001..121249
FT                   /locus_tag="BACI_c01310"
FT   CDS_pept        121001..121249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01310"
FT                   /product="ribosomal L7A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02914"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXG8"
FT                   /protein_id="ADK02914.1"
FT                   /translation="MSYQKVSNAENVVVGHKRTLEAIKNGIVKEVVIAEDADMRLTHVI
FT                   IRTALQHNIPITKVESVRKLGKVAGIQVGASAIGIIS"
FT   gene            121364..121786
FT                   /gene="rpsl"
FT                   /locus_tag="BACI_c01320"
FT   CDS_pept        121364..121786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsl"
FT                   /locus_tag="BACI_c01320"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02915"
FT                   /db_xref="GOA:D8GXG9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXG9"
FT                   /protein_id="ADK02915.1"
FT                   /translation="MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK"
FT   gene            121816..122286
FT                   /gene="rpsG"
FT                   /locus_tag="BACI_c01330"
FT   CDS_pept        121816..122286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BACI_c01330"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02916"
FT                   /db_xref="GOA:D8GXH0"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH0"
FT                   /protein_id="ADK02916.1"
FT                   /translation="MPRKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYN
FT                   AFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW"
FT   gene            122494..124572
FT                   /gene="fusA"
FT                   /locus_tag="BACI_c01340"
FT   CDS_pept        122494..124572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BACI_c01340"
FT                   /product="elongation factor EF-2"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02917"
FT                   /db_xref="GOA:D8GXH1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH1"
FT                   /protein_id="ADK02917.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQ
FT                   LPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELD
FT                   EEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSP
FT                   LDVPAIKGIVPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILES
FT                   MEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEE
FT                   GKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPVVDIKAALVDGSYHDVDSS
FT                   EMAFKIAASMALKAAVSKCNPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNKGE"
FT   gene            124690..125877
FT                   /gene="tuf"
FT                   /locus_tag="BACI_c01350"
FT   CDS_pept        124690..125877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BACI_c01350"
FT                   /product="elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02918"
FT                   /db_xref="GOA:D8GXH2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH2"
FT                   /protein_id="ADK02918.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEAR
FT                   GYDQIDAAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGF
FT                   PGDDIPVIKGSALKALQGEADWEAKIIELMAEVDAYIPTPERETDKPFLMPVEDVFSIT
FT                   GRGTVATGRVERGIVKVGDVVEIIGLAEENASTTVTGVEMFRKLLDQAQAGDNIGALLR
FT                   GVAREDIQRGQVLAKSGSVKAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVT
FT                   GIIQLPEGTEMVMPGDNIEMTIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVE"
FT   gene            126276..126584
FT                   /gene="rpsJ"
FT                   /locus_tag="BACI_c01360"
FT   CDS_pept        126276..126584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BACI_c01360"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02919"
FT                   /db_xref="GOA:D8GXH3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH3"
FT                   /protein_id="ADK02919.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTE
FT                   KTVYTILRAVHKYKDSREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            126619..127251
FT                   /gene="rplC"
FT                   /locus_tag="BACI_c01370"
FT   CDS_pept        126619..127251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BACI_c01370"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02920"
FT                   /db_xref="GOA:D8GXH4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH4"
FT                   /protein_id="ADK02920.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGELIPVTVIAANPNVVLQKKTTETDG
FT                   YNAIQLGFEDKREKLTNKPEQGHTAKASTTPKRFIREIRDADVDGLEVGQEVKVDVFAT
FT                   GEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKKLAGR
FT                   MGGDQVTIQNLEIVQVDTERNLLLVKGNVPGAKKSLVVVQGAVKVSK"
FT   gene            127277..127900
FT                   /gene="rplD"
FT                   /locus_tag="BACI_c01380"
FT   CDS_pept        127277..127900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BACI_c01380"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02921"
FT                   /db_xref="GOA:D8GXH5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH5"
FT                   /protein_id="ADK02921.1"
FT                   /translation="MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALATKVVENNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESV
FT                   ELSARNIPGVTVITADGVNVLDVLHHDKLIMTKAAVEKVEEVLA"
FT   gene            127900..128190
FT                   /gene="rplW"
FT                   /locus_tag="BACI_c01390"
FT   CDS_pept        127900..128190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BACI_c01390"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02922"
FT                   /db_xref="GOA:D8GXH6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH6"
FT                   /protein_id="ADK02922.1"
FT                   /translation="MRDPRDIIKRPVITERSMEMMAEKKYTFDVDVKSNKTEVKDALEA
FT                   IFGVKVEKVNIMNYKPKAKRVGRHAGFTSRRRKAIVKLTADSKEIEIFQGV"
FT   gene            128219..129049
FT                   /gene="rplB"
FT                   /locus_tag="BACI_c01400"
FT   CDS_pept        128219..129049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BACI_c01400"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02923"
FT                   /db_xref="GOA:D8GXH7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH7"
FT                   /protein_id="ADK02923.1"
FT                   /translation="MGIKKYNPTTNGRRNMTTNDFAEITTDRPEKSLLAPLSKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKNLEVGMEIMSGAEADIKIGNALPLINIPVGTVVHNIELKPGRGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLTSGEVRLVLSACRATVGQVGNESHELIKIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPMSPWGKPTLGFKTRKKNKASDKFIVRRRKK"
FT   gene            129110..129388
FT                   /gene="rpsS"
FT                   /locus_tag="BACI_c01410"
FT   CDS_pept        129110..129388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BACI_c01410"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02924"
FT                   /db_xref="GOA:D8GXH8"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH8"
FT                   /protein_id="ADK02924.1"
FT                   /translation="MARSLKKGPFVDDHLMSKIAKLNETEQKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTYKGHDADDKKTRR"
FT   gene            129406..129747
FT                   /gene="rplV"
FT                   /locus_tag="BACI_c01420"
FT   CDS_pept        129406..129747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BACI_c01420"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02925"
FT                   /db_xref="GOA:D8GXH9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXH9"
FT                   /protein_id="ADK02925.1"
FT                   /translation="MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASP
FT                   VVEKVLKSAIANAEHNYEMDINSLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   VVVSEKKEG"
FT   gene            129751..130410
FT                   /gene="rpsC"
FT                   /locus_tag="BACI_c01430"
FT   CDS_pept        129751..130410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BACI_c01430"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02926"
FT                   /db_xref="GOA:D8GXI0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI0"
FT                   /protein_id="ADK02926.1"
FT                   /translation="MGQKVNPIGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYINVR
FT                   LKDSAVAKVEIERAANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILE
FT                   VKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIAR
FT                   AESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK"
FT   gene            130412..130846
FT                   /gene="rplP"
FT                   /locus_tag="BACI_c01440"
FT   CDS_pept        130412..130846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BACI_c01440"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02927"
FT                   /db_xref="GOA:D8GXI1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI1"
FT                   /protein_id="ADK02927.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLAAHKLPVKCKFVKREENGGESNEN"
FT   gene            130836..131036
FT                   /gene="rpmC"
FT                   /locus_tag="BACI_c01450"
FT   CDS_pept        130836..131036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BACI_c01450"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02928"
FT                   /db_xref="GOA:D8GXI2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI2"
FT                   /protein_id="ADK02928.1"
FT                   /translation="MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIRE
FT                   VRKAIARMKTVVREREIGINR"
FT   gene            131057..131320
FT                   /gene="rpsQ"
FT                   /locus_tag="BACI_c01460"
FT   CDS_pept        131057..131320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BACI_c01460"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02929"
FT                   /db_xref="GOA:D8GXI3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI3"
FT                   /protein_id="ADK02929.1"
FT                   /translation="MSERNQRKVYTGRVVSDKMDKTITVLVETYKTHSLYGKRVKYSKK
FT                   YKAHDEQNQAKLGDIVKIMETRPLSATKRFRLVEIVEEAVII"
FT   gene            131364..131732
FT                   /gene="rplN"
FT                   /locus_tag="BACI_c01470"
FT   CDS_pept        131364..131732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BACI_c01470"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02930"
FT                   /db_xref="GOA:D8GXI4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI4"
FT                   /protein_id="ADK02930.1"
FT                   /translation="MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQ
FT                   ATPGGVVKKGDVVKAVVVRTKSGARRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            131771..132082
FT                   /gene="rplX"
FT                   /locus_tag="BACI_c01480"
FT   CDS_pept        131771..132082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BACI_c01480"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02931"
FT                   /db_xref="GOA:D8GXI5"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI5"
FT                   /protein_id="ADK02931.1"
FT                   /translation="MHVKKGDKVQVITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHS
FT                   KPSQLNPQGGIITKEAPIHVSNVMILDPKTGEPTRVGFKVEDGKKVRIAKKSGELLDK"
FT   gene            132109..132648
FT                   /gene="rplE"
FT                   /locus_tag="BACI_c01490"
FT   CDS_pept        132109..132648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BACI_c01490"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02932"
FT                   /db_xref="GOA:D8GXI6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI6"
FT                   /protein_id="ADK02932.1"
FT                   /translation="MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVS
FT                   NSKALDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTAKTD
FT                   EEARELLTQFGMPFQK"
FT   gene            132682..132867
FT                   /gene="rpsN"
FT                   /locus_tag="BACI_c01500"
FT   CDS_pept        132682..132867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BACI_c01500"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02933"
FT                   /db_xref="GOA:D8GXI7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI7"
FT                   /protein_id="ADK02933.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            132897..133295
FT                   /gene="rpsH"
FT                   /locus_tag="BACI_c01510"
FT   CDS_pept        132897..133295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BACI_c01510"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02934"
FT                   /db_xref="GOA:D8GXI8"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI8"
FT                   /protein_id="ADK02934.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   LVSTSKGVMTDKDARQLQTGGEVVAYVW"
FT   gene            133328..133867
FT                   /gene="rplF"
FT                   /locus_tag="BACI_c01520"
FT   CDS_pept        133328..133867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BACI_c01520"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02935"
FT                   /db_xref="GOA:D8GXI9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXI9"
FT                   /protein_id="ADK02935.1"
FT                   /translation="MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIK
FT                   IEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKL
FT                   VLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGI
FT                   RYEGEVVRRKEGKTAK"
FT   gene            133899..134261
FT                   /gene="rplR"
FT                   /locus_tag="BACI_c01530"
FT   CDS_pept        133899..134261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BACI_c01530"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02936"
FT                   /db_xref="GOA:D8GXJ0"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ0"
FT                   /protein_id="ADK02936.1"
FT                   /translation="MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVI
FT                   DDVNGVTLVSASTLDKDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHG
FT                   RVKALAEAAREAGLQF"
FT   gene            134283..134783
FT                   /gene="rpsE"
FT                   /locus_tag="BACI_c01540"
FT   CDS_pept        134283..134783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BACI_c01540"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02937"
FT                   /db_xref="GOA:D8GXJ1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ1"
FT                   /protein_id="ADK02937.1"
FT                   /translation="MHRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTG
FT                   VIAGGPVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            134797..134979
FT                   /gene="rpmD"
FT                   /locus_tag="BACI_c01550"
FT   CDS_pept        134797..134979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BACI_c01550"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02938"
FT                   /db_xref="GOA:D8GXJ2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ2"
FT                   /protein_id="ADK02938.1"
FT                   /translation="MAKKLEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAIL
FT                   GMINKVSHLVTVKEA"
FT   gene            135013..135453
FT                   /gene="rplO"
FT                   /locus_tag="BACI_c01560"
FT   CDS_pept        135013..135453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BACI_c01560"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02939"
FT                   /db_xref="GOA:D8GXJ3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ3"
FT                   /protein_id="ADK02939.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEFAIVNLSTLNRFEDGTEVTPELLLETGVISK
FT                   LNDGVKILASGAVEKKLTVKAHKFSSSAKEAIEAAGGSVEVI"
FT   gene            135453..136754
FT                   /gene="secY1"
FT                   /locus_tag="BACI_c01570"
FT   CDS_pept        135453..136754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY1"
FT                   /locus_tag="BACI_c01570"
FT                   /product="preprotein translocase SecY1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02940"
FT                   /db_xref="GOA:D8GXJ4"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ4"
FT                   /protein_id="ADK02940.1"
FT                   /translation="MFRTISNFMRVAEIRRKILFTLAMLIVFRIGTFIPVPFTNGDVLK
FT                   AQDQLNALGILNTFGGGALKNFSIFAMGIMPYITASIIVQLLQMDVVPKFSEWAKQGEM
FT                   GRRKLTQFTRYFTIVLAFIQGFGMSIGFNGMVGGQLILNPGWSTYLYIATVLTAGTAFL
FT                   MWLGEQITAKGVGNGISILIFGGIAAAIPSVISQVYQQQFQNIGDQLFMSIVKVALILL
FT                   AVLAVIVGVIFIQQAVRKIPIQYAKRVTGGNGGYAGAQNTHLPLKVNSAGVIPVIFAVS
FT                   FLITPPTIAQFFPKHDVSQWIIANFNYSHPVGMIIYVALIVAFTYFYAFVQVNPEQMSE
FT                   NLNKQGGYVPGIRPGKNTEQYLTKILYRLTFVGSIFLAAIAILPVIFTKLGNLPPSAQI
FT                   GGTSMLIVVGVALETMKQLESQLVKRHYKGFIKQ"
FT   gene            136811..137461
FT                   /gene="adk"
FT                   /locus_tag="BACI_c01580"
FT   CDS_pept        136811..137461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BACI_c01580"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02941"
FT                   /db_xref="GOA:D8GXJ5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ5"
FT                   /protein_id="ADK02941.1"
FT                   /translation="MNLILMGLPGAGKGTQAEQIVAKYNIPHISTGDMFRAAMKAETEM
FT                   GLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPRTVAQASALEEIMKDLG
FT                   KKIDYVLNINVDSGLLLKRLTGRRICKECGATYHLEFNAPAKADVCDKCGGELYQRSDD
FT                   NEETVANRLDVNIKQTKPLLDFYEELGYLQSINGEQDINKVFADIDVLIGGLA"
FT   gene            137461..138207
FT                   /gene="map1"
FT                   /locus_tag="BACI_c01590"
FT   CDS_pept        137461..138207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map1"
FT                   /locus_tag="BACI_c01590"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02942"
FT                   /db_xref="GOA:D8GXJ6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ6"
FT                   /protein_id="ADK02942.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKQHITPGITTKELDQIAE
FT                   KTIQKYGATPSFKGYNGFPGSICASVNEELVHGIPGKRKLKEGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGNISESVQKLLDVTEKSLYLGLEQVKPGERLSNISHAVQTHAEENGFSIVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNRGPRLKPGMVICVEPMVNQGRRYVKTLSDDWTVVT
FT                   VDGKWCAHFEHTIALTEAGYEILTTL"
FT   gene            138276..138494
FT                   /gene="infA"
FT                   /locus_tag="BACI_c01600"
FT   CDS_pept        138276..138494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BACI_c01600"
FT                   /product="translation initiation factor IF-1"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02943"
FT                   /db_xref="GOA:D8GXJ7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ7"
FT                   /protein_id="ADK02943.1"
FT                   /translation="MAKDDVIEVEGTVLETLPNAMFKVELENGHVVLAHVSGKIRMNFI
FT                   RILPGDKVTVELSPYDLNRGRITYRFK"
FT   gene            138530..138643
FT                   /gene="rpmJ"
FT                   /locus_tag="BACI_c01610"
FT   CDS_pept        138530..138643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BACI_c01610"
FT                   /product="50S ribosomal protein L36"
FT                   /note="ribosomal protein II, ribosomal protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02944"
FT                   /db_xref="GOA:D8GXJ8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ8"
FT                   /protein_id="ADK02944.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            138665..139030
FT                   /gene="rpsM"
FT                   /locus_tag="BACI_c01620"
FT   CDS_pept        138665..139030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BACI_c01620"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02945"
FT                   /db_xref="GOA:D8GXJ9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXJ9"
FT                   /protein_id="ADK02945.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAEKILAEAGISEETRV
FT                   RDLTEDELGRIRDIIDRIKVEGDLRREVSLNIKRLMEIGSYRGLRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            139055..139444
FT                   /gene="rpsK"
FT                   /locus_tag="BACI_c01630"
FT   CDS_pept        139055..139444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BACI_c01630"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02946"
FT                   /db_xref="GOA:D8GXK0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK0"
FT                   /protein_id="ADK02946.1"
FT                   /translation="MARKTNTRKKRVKKNIEAGVAHIRSTFNNTIVTLTDTHGNALSWS
FT                   SAGALGFRGSRKSTPFAAQMAAETAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAG
FT                   LEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            139625..140569
FT                   /gene="rpoA"
FT                   /locus_tag="BACI_c01640"
FT   CDS_pept        139625..140569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BACI_c01640"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02947"
FT                   /db_xref="GOA:D8GXK1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK1"
FT                   /protein_id="ADK02947.1"
FT                   /translation="MIEIEKPKIETVELNEDAKYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTAIQIDGVLHEFSTVEGVVEDVTTIILNLKKLALKIYSEEEKTLEIDVQGE
FT                   GIVTAADITHDSDVEILNPDLHIATLAKDAHFRVRLTAKRGRGYTPADANKSEDQPIGV
FT                   IPIDSIYTPVSRVTYQVEKTRVGQVANYDKLTLDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKHKLEELGLGLRKDD"
FT   gene            140605..140967
FT                   /gene="rplQ"
FT                   /locus_tag="BACI_c01650"
FT   CDS_pept        140605..140967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BACI_c01650"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02948"
FT                   /db_xref="GOA:D8GXK2"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK2"
FT                   /protein_id="ADK02948.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLATDLIINERIQTTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANAETGQDALQKLFADVAPRYAERQGGYTRIAKI
FT                   GPRRGDAAPMVIIELV"
FT   gene            141071..141913
FT                   /locus_tag="BACI_c01660"
FT   CDS_pept        141071..141913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01660"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02949"
FT                   /db_xref="GOA:D8GXK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK3"
FT                   /protein_id="ADK02949.1"
FT                   /translation="MKKEKLRTENISFQYPGAATYALKDVSFSLFEGEWVSVIGQNGSG
FT                   KSTLAKLLNGLFLPEAGTITVNDTMILSEETVWDVRKQIGMVFQNPDNQFVGTTVQDDV
FT                   VFGLENIGMPREQMVERLNQALRLVRMEDFLNDEPHSLSGGQKQRVAIAGVLALQPSIL
FT                   ILDEATSMLDPQGRREVVETVRQLVNEKGITVLSITHDLEEVAQSDRVIILNKGEILEE
FT                   GTPEQIFKSSHMLQEIGLDVPFSVKIAELLKRNEILLQNTHLTMESLVNELWRLHSKK"
FT   gene            141889..142770
FT                   /locus_tag="BACI_c01670"
FT   CDS_pept        141889..142770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01670"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02950"
FT                   /db_xref="GOA:D8GXK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK4"
FT                   /protein_id="ADK02950.1"
FT                   /translation="MEITFQKVEHRYQYKTPFERRALYDVDVSFPSGGYYAIIGHTGSG
FT                   KSTMIQHLNGLLQPTNGTVQIGEHFISAGKKEKKLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPTNFGVSEEEAKQKAREAIELVGLEPDLLARSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPKGQYELMEMFYKLHKEKGLTVILVTHNMEDAAKYAEQIVVMHKG
FT                   TVFLQGSAEEVFSHADELEKIGVDLPMSLKYKRAIEEKFGISIPKATLSLEDLTHEVVQ
FT                   VLRKGGHESCSS"
FT   gene            142758..143552
FT                   /locus_tag="BACI_c01680"
FT   CDS_pept        142758..143552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01680"
FT                   /product="ABC transporter, permease; possible cobalt
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02951"
FT                   /db_xref="GOA:D8GXK5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK5"
FT                   /protein_id="ADK02951.1"
FT                   /translation="MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYG
FT                   FLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHIFTNKEGEVLFQLGWFSIHEK
FT                   GLEQGIYISIRFFVIILMTTLLTLTTTPIEITDGLETLLKPLKRIKVPVHEIALMMSIS
FT                   LRFIPTLMDETSKIMKAQSSRGIDFAGGPIKDRMKAIISLLVPLFISAFKRAEDLAIAM
FT                   EARGYQSGEGRTKFRQLRWKTSDTVTIISLLCLACILAWVRS"
FT   gene            143552..144310
FT                   /gene="truA1"
FT                   /locus_tag="BACI_c01690"
FT   CDS_pept        143552..144310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA1"
FT                   /locus_tag="BACI_c01690"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02952"
FT                   /db_xref="GOA:D8GXK6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK6"
FT                   /protein_id="ADK02952.1"
FT                   /translation="MENREMDRIKCTVAYDGMHFCGYQIQPQHRTVQQEIEKALQKLHK
FT                   GELVRVQASGRTDSTVHAKGQVIHFDTPLSLEEWQWSNALNTMLPDDIVITQVEKKTEE
FT                   FHARYGVERKEYRYRVLVSKTADVFRRNYVYQYPYPLEVNSIRKAIPYFIGTHDFTSFC
FT                   SAKTDKKDKVRTIYEIELIEQDDELIFRFVGNGFLYNMVRIIVGTLLNVGQGKLDPDSI
FT                   PEILAKQNRQFAGKMAPGHGLYLWQVNYNN"
FT   misc_feature    144365..144425
FT                   /note="BACI_c01700; ribosomal protein L13 leader, RF00555"
FT   gene            144463..144900
FT                   /gene="rplM"
FT                   /locus_tag="BACI_c01710"
FT   CDS_pept        144463..144900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BACI_c01710"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02953"
FT                   /db_xref="GOA:D8GXK7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK7"
FT                   /protein_id="ADK02953.1"
FT                   /translation="MRTTFMAKANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLEL
FT                   AIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKPEVYELRG"
FT   gene            144922..145314
FT                   /gene="rpsI"
FT                   /locus_tag="BACI_c01720"
FT   CDS_pept        144922..145314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BACI_c01720"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02954"
FT                   /db_xref="GOA:D8GXK8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK8"
FT                   /protein_id="ADK02954.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALR
FT                   EVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            145477..145905
FT                   /locus_tag="BACI_c01730"
FT   CDS_pept        145477..145905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01730"
FT                   /product="KINB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02955"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXK9"
FT                   /protein_id="ADK02955.1"
FT                   /translation="MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAFQMQELH
FT                   RQYEDYCIELGIESYLLGARYSKFGYYGESFFDVKYRALEEEQQLTETLFQFLTSMTMR
FT                   EIKLQDEELLFESCQQFIGLWWQEGYEKGERRYRLKLH"
FT   gene            145972..146685
FT                   /gene="cwlD"
FT                   /locus_tag="BACI_c01740"
FT   CDS_pept        145972..146685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BACI_c01740"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02956"
FT                   /db_xref="GOA:D8GXL0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL0"
FT                   /protein_id="ADK02956.1"
FT                   /translation="MKRIRIISFALAAVILFFLVKQEFQITKSWRAWNLPLSGKVIVLD
FT                   AGHGGPDGGAVGGKDIVEKDITLEITKKVQDYLQEQGALVILTREGDYDLAQKDTKSYS
FT                   RRKAEDLKKRVEIINKPDVDFFASIHLNALTSSGSKGAQTFYYRSSIENERAAKFIQAE
FT                   LRTSLENTNRSAKTISHVYLLKYAKTPGALIEAGFLSNVNERYMLNSEKYQQKVAAAVY
FT                   RGILRYFTEKGNPPE"
FT   gene            146830..147897
FT                   /gene="mrp"
FT                   /locus_tag="BACI_c01750"
FT   CDS_pept        146830..147897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="BACI_c01750"
FT                   /product="ATP-binding protein; Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02957"
FT                   /db_xref="GOA:D8GXL1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL1"
FT                   /protein_id="ADK02957.1"
FT                   /translation="MVMKEQVVEALEGIVDPFLHKTLKETGAIKEVTVKPEKKHVSVKI
FT                   AIVKTGTAEQMQLQSGIVKLVKELGAATVGLRFAEFTEEELAQFAPEQEEEQTESLLSP
FT                   NSKTTFLAVASGKGGVGKSTVSVNLAIALARLGKKVGIIDADIYGFSVPDMMGIEKRPV
FT                   VRGDKIIPVERLGVKVISMGFFVEDNAPVIWRGPMLGKMLNHFFTEVEWGDLDYLVLDL
FT                   PPGTGDVALDLHSMLPACKEIIVTTPHPTAAFVAARAGAMALRTEHSILGVVENMAYFE
FT                   SKTTGEKEYVFGRGGGDKLATELQTEVLGRIPLQQPDWNKEDFAPSVYEDTHTTGLIYR
FT                   TIAETVIDKTAVAQK"
FT   gene            complement(147954..148571)
FT                   /gene="gerD"
FT                   /locus_tag="BACI_c01760"
FT   CDS_pept        complement(147954..148571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BACI_c01760"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02958"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL2"
FT                   /protein_id="ADK02958.1"
FT                   /translation="MKRMLLVLTSSFLFLVLVACAQEKEAKSELDYDQTKKMIVDILKT
FT                   DQGKKAIQDVLTDEKMKQALILDETVVKKTIEDAMVSDKGQQFWEKLFKDPEFSSKFAK
FT                   SMGKEQTALMKTLLKDPEYQAGVIEIMKNPEVEKMMLQTMKSKEYRQYLQQVLTETAES
FT                   PLFQAKMIDIISKGVQKAEKSGSDKKEAGGEGGSQEGKKEQQ"
FT   gene            148711..149322
FT                   /gene="kbaA"
FT                   /locus_tag="BACI_c01770"
FT   CDS_pept        148711..149322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BACI_c01770"
FT                   /product="kinB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02959"
FT                   /db_xref="GOA:D8GXL3"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL3"
FT                   /protein_id="ADK02959.1"
FT                   /translation="MNSRKWVRLFFTTLFLGGISTVIIGFVLEWDKYAKFFQNFDGKEI
FT                   LAVSFWLMGVGFIFSVISQMGFFAYLTIHRFGLGMFRSSSLWNIVQLFFIAFVLFDFVY
FT                   LRSVLIANGEVSLGNNILVAGVLFMFGAIVAYIKSKETNKKAFVPALFFMVVVTILEWV
FT                   PALRINDTDWLYLMVIPLLLCNAYQLLILHRLIGKTSKSA"
FT   gene            complement(149427..150191)
FT                   /gene="cda1"
FT                   /locus_tag="BACI_c01780"
FT   CDS_pept        complement(149427..150191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cda1"
FT                   /locus_tag="BACI_c01780"
FT                   /product="probable xylanase/chitin deacetylase"
FT                   /EC_number="3.5.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02960"
FT                   /db_xref="GOA:D8GXL4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL4"
FT                   /protein_id="ADK02960.1"
FT                   /translation="MFFFFITSKRNFKHISLIVILSLFTAWLLFLKTYSHESAFSTATG
FT                   PKVIYKGDTSKKQVAFTFDISWGDKKAIPILDTLKERDIKNATFFLSAAWAERHPDVVE
FT                   RIIKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQIKLLRPPSGDFNKA
FT                   TLKIAESLGYTVVHWSNNSNDWKNPGVNNIVSTVSNNLKGGDIVLLHASDSALQTNKAL
FT                   PLLLQKLKSDGYEQISVSQLISNTSTKSKDVQ"
FT   gene            150362..150580
FT                   /locus_tag="BACI_c01790"
FT   CDS_pept        150362..150580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02961"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL5"
FT                   /protein_id="ADK02961.1"
FT                   /translation="MLGFMLTKEEKKEMEYILKRELEELLFDFEDERIHDVVKKAMEER
FT                   YKIIFCLFRRVANAEDCIRYVRKRTFY"
FT   gene            150811..152350
FT                   /locus_tag="BACI_c01800"
FT   rRNA            150811..152350
FT                   /locus_tag="BACI_c01800"
FT                   /product="16S ribosomal RNA"
FT   gene            152503..155422
FT                   /locus_tag="BACI_c01810"
FT   rRNA            152503..155422
FT                   /locus_tag="BACI_c01810"
FT                   /product="23S ribosomal RNA"
FT   gene            155511..155625
FT                   /locus_tag="BACI_c01820"
FT   rRNA            155511..155625
FT                   /locus_tag="BACI_c01820"
FT                   /product="5S ribosomal RNA"
FT   gene            155634..155708
FT                   /locus_tag="BACI_c01830"
FT   tRNA            155634..155708
FT                   /locus_tag="BACI_c01830"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            155713..155785
FT                   /locus_tag="BACI_c01840"
FT   tRNA            155713..155785
FT                   /locus_tag="BACI_c01840"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACC"
FT   gene            155810..155884
FT                   /locus_tag="BACI_c01850"
FT   tRNA            155810..155884
FT                   /locus_tag="BACI_c01850"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            155890..155965
FT                   /locus_tag="BACI_c01860"
FT   tRNA            155890..155965
FT                   /locus_tag="BACI_c01860"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            155983..156066
FT                   /locus_tag="BACI_c01870"
FT   tRNA            155983..156066
FT                   /locus_tag="BACI_c01870"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            156132..156206
FT                   /locus_tag="BACI_c01880"
FT   tRNA            156132..156206
FT                   /locus_tag="BACI_c01880"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            156212..156287
FT                   /locus_tag="BACI_c01890"
FT   tRNA            156212..156287
FT                   /locus_tag="BACI_c01890"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            156293..156364
FT                   /locus_tag="BACI_c01900"
FT   tRNA            156293..156364
FT                   /locus_tag="BACI_c01900"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            156375..156447
FT                   /locus_tag="BACI_c01910"
FT   tRNA            156375..156447
FT                   /locus_tag="BACI_c01910"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            156563..157708
FT                   /gene="garK"
FT                   /locus_tag="BACI_c01920"
FT   CDS_pept        156563..157708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garK"
FT                   /locus_tag="BACI_c01920"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02962"
FT                   /db_xref="GOA:D8GXL6"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL6"
FT                   /protein_id="ADK02962.1"
FT                   /translation="MKVVIASDSYKESLKAIEVCEAIERGFEAIFPKAEYVKIPIGDGG
FT                   EGTVDSLVDAARGRIISLHVTGPLRERVQAFYGMSKDKKTAFIEMAAASGLQHVPVKKR
FT                   NPLVTTTKGTGELILHALDEGAEHIILGLGGSATNDGGAGMLSALGVRFINGKGEVIDP
FT                   SGGTLHSIVSIDFSQMDSRLKHIKIEAACDVDNPLVGIRGASFVFGRQKGADEEMMKEL
FT                   DENLKYYAHILKQYLYCDVSKIPGAGAAGGMGAAVIAVLKGNLRRGIEIVLDYTNFDKH
FT                   IEGADLIITGEGRIDEQTAYGKAPVGVAERAKHFHIPVIAIGGSVSPNYTAVHEKGIDA
FT                   VFSITTSPMTLEEAYKVAEENIEMTAKNIAAVWKIASEKHF"
FT   gene            157918..158811
FT                   /gene="rocF"
FT                   /locus_tag="BACI_c01930"
FT   CDS_pept        157918..158811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BACI_c01930"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02963"
FT                   /db_xref="GOA:D8GXL7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL7"
FT                   /protein_id="ADK02963.1"
FT                   /translation="MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVK
FT                   DMGDICIEREKEVDVNTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKV
FT                   KKENVVIIGARALDEGEKDFIRNEGIKVFTMHEIDRMGMTAVMEETIAYLSHTDGVHLS
FT                   LDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTA
FT                   TTAVALMGSLFGEKLK"
FT   gene            159060..159881
FT                   /gene="ybbP"
FT                   /locus_tag="BACI_c01940"
FT   CDS_pept        159060..159881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="BACI_c01940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02964"
FT                   /db_xref="GOA:D8GXL8"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL8"
FT                   /protein_id="ADK02964.1"
FT                   /translation="MPFEDTTILKYLSTALDIAVVWFIIYKLILIIRGTKAVQLLKGIT
FT                   VIIVVRMISIFLELRTLYWLTEQVLTWGFLAVIIIFQPELRRALEQLGRGSLFSRTGTH
FT                   EDDEPEMVATAIAKATEYMGKRRIGALITLSKETGMGDYVETGIPLNANVSSELLINIF
FT                   IPNTPLHDGAVIMQGSTIKAAACYLPLSESPFISKELGTRHRAAMGVSEVTDSITVVVS
FT                   EETGQISLTKNGKLHRDLKTEQLKDMLLAEFSANEKTTSSSLWNWRRKRHG"
FT   gene            159874..161355
FT                   /gene="ybbR"
FT                   /locus_tag="BACI_c01950"
FT   CDS_pept        159874..161355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /locus_tag="BACI_c01950"
FT                   /product="conserved hypothetical membrane associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02965"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXL9"
FT                   /protein_id="ADK02965.1"
FT                   /translation="MDKLMENHWFLKGISLLLACMLFMSATLTEKNTTSGILPFANDAK
FT                   ETLTNYAINVKYDEEKYIVSGIPAEGVKVKLEGPKAAVATAKAKKQFDIPVDLRDSEKG
FT                   TYEVSLKTNGLPDDVKGTVQPSTIKVTLHEKARKYVHVDLKLSNEDQMPAGATLEKSSL
FT                   KPDTVEVVGTKEEIESISSAKAYVDLKGVNKTVTKTPEVTLYNKEGKRLNVRTSPSKIS
FT                   VTLNVATQATANNTEKTVPIAYTKKGSLPEGLAVTNITVEPREVTIAGPKDILDNIQSI
FT                   EGVEVDLSQLTESTTFDTSVLLPKGVTSAKPNQVKVSVGVQKTKQTKTRTIDGISIQKN
FT                   GLSKDVTAQLLSPQDGKISVDISGETSIVDKITANQITAVINLQNVSPGTKDVAIQVSG
FT                   PSNISIEPKQKSAKVTIVKKENPDKEVQGNGEQPNSNNNQDNQTEKPKNPEPEPNPDPD
FT                   PEKEKEPEQNKDKETSQEPTVDNQKEPEKGANHNG"
FT   gene            161348..162694
FT                   /gene="glmM"
FT                   /locus_tag="BACI_c01960"
FT   CDS_pept        161348..162694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BACI_c01960"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02966"
FT                   /db_xref="GOA:D8GXM0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM0"
FT                   /protein_id="ADK02966.1"
FT                   /translation="MGKYFGTDGVRGVANKELTPELAFKIGRFGGYVLTKDTDRPKVII
FT                   GRDTRISGHMLEGALVAGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPV
FT                   QDNGIKFFGSDGFKLTDEQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYI
FT                   KQTVEEDFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINDGVGSTHPE
FT                   VLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVV
FT                   STVMSNLGFYKALEANGITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
FT                   GMLSALQLVNIMKMTKKPLSELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEE
FT                   EMNGDGRILVRPSGTEPLIRVMAEAPTQEVCDAYVHRIVEVVKAEVGAE"
FT   gene            162833..162988
FT                   /gene="glmZ1"
FT                   /locus_tag="BACI_c01970"
FT   ncRNA           162833..162988
FT                   /gene="glmZ1"
FT                   /locus_tag="BACI_c01970"
FT                   /product="glucosamine-6-phosphate activated ribozyme"
FT                   /note="RF00234"
FT                   /ncRNA_class="other"
FT   gene            162982..163167
FT                   /locus_tag="BACI_c01980"
FT   CDS_pept        162982..163167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c01980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02967"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM1"
FT                   /protein_id="ADK02967.1"
FT                   /translation="MREKERIQTSCISIYGLKPNREEGESRYKLTGLAICNPFFSINKN
FT                   GIGLCRYMFAEQCKHL"
FT   gene            163180..164982
FT                   /gene="glmS"
FT                   /locus_tag="BACI_c01990"
FT   CDS_pept        163180..164982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BACI_c01990"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02968"
FT                   /db_xref="GOA:D8GXM2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM2"
FT                   /protein_id="ADK02968.1"
FT                   /translation="MCGIVGFIGEQDAKEILLKGLEKLEYRGYDSAGIAVQAENGVVVY
FT                   KEKGRIAKLREIVDENVAASVGIGHTRWATHGVPSKVNAHPHQSTSKRFTLVHNGVIEN
FT                   YELVKKEYLQDVTFVSETDTEVIVQLMEQQVSTGLSVEEAFRNTLSLLHGSYAIGLLDA
FT                   ENPNMIYVAKNKSPLLVGVGDNFNVVASDAMAMLQVTDQFIELMDKEIVIVTKENITIK
FT                   NLQGETIERAPFTAELDASDIEKGTYPHFMLKEIDEQPLVIRNIIQKYQDENGEIELDQ
FT                   DIRNAILDSDRIYIIACGTSYHAGLVGKQFIEKFAKMPVEVHVASEFSYNMPLLTERPF
FT                   FIYISQSGETADSRAVLVQTNEMGHKALTITNVPGSTLSREADYTLPLYAGPEIAVAST
FT                   KAYTAQLAVLSILAADIAKAKGEVLDFDLTHELGLVANAMVQLCDQKEEMDALAKQFLA
FT                   TTRNCFFIGRSVDFYVGLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLGIRGNVKEVVARGANPCIISMKGLEMEGDSFVLPAVHEALAPLVAVIPLQLIS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            complement(165232..166680)
FT                   /gene="bla1"
FT                   /locus_tag="BACI_c02000"
FT   CDS_pept        complement(165232..166680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bla1"
FT                   /locus_tag="BACI_c02000"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02969"
FT                   /db_xref="GOA:D8GXM3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM3"
FT                   /protein_id="ADK02969.1"
FT                   /translation="MKKAIVFVLTIFILFSGFTTQSYALSDSKSVAIQALLDDACRTSG
FT                   VPGMSLSILADGEVFYFSSGYADLEKGLSASENTLYELASVSKAFTGMGILLLEEQGLL
FT                   SMTDPIQKYLPWFTLKYQGKPVDMQNLTLNNFLHHTSGLTNIRHLQNIPQGNTPDMLQK
FT                   TVETLVDAELAFPPGEQYNYGTVNYDVLGLVIEIVSRQSYEDFMKEQVFLPLGLHQTYV
FT                   YKEDAQATGQLAQGYRSSFFITTPFNAPYYTGNKPAGYIISNTKDMARWMGIQMGIVQD
FT                   IPEIFHRAIEKSHRGDMSVSAVNDMYYAAGWSVNAEQTFIEHTGGNPNFSTKVAILPNE
FT                   RTAICLLSNGANTNINLVLQVKNILNGNLTQSYEISGTQLLDIILSSTTIILCLLAVLL
FT                   FFLGLRKGKTNEQQPMTKKRTIVTIIFLIATIAQCIMFFAFDWSTILIWQTYSVLTALI
FT                   SSTLLTASITWFVYTHRLDASVRK"
FT   gene            167323..168132
FT                   /locus_tag="BACI_c02010"
FT   CDS_pept        167323..168132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02010"
FT                   /product="alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02970"
FT                   /db_xref="GOA:D8GXM4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM4"
FT                   /protein_id="ADK02970.1"
FT                   /translation="MSIVKNGTLQVIGASIYYEVRGSGPILLLIHGGGGDADKFHNVAD
FT                   HLAKWYTVVTYDRRGHSRSNLVNKNEDYHVHTHSEDAHRLLANLTKEPAYVFGSSSGAV
FT                   IGLDLCIRHPEQVQLLIPHEPVLLQLLSENELKQAINFMEDLKGNHQSEVMKLLSNIDD
FT                   SNSEPSKDMLTERLLGNSMYFTEYEIPGILSYTLNIDALKSLLNPAWIQVRPAGGSISR
FT                   ETFPYHCAFNLAEHLGTEFAEFPGHHVGYNTVHHKEFAERLHDVIEN"
FT   gene            168540..169271
FT                   /gene="gntR1"
FT                   /locus_tag="BACI_c02020"
FT   CDS_pept        168540..169271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR1"
FT                   /locus_tag="BACI_c02020"
FT                   /product="gluconate operon transcriptional repressor;
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02971"
FT                   /db_xref="GOA:D8GXM5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM5"
FT                   /protein_id="ADK02971.1"
FT                   /translation="MTKSMEFLYPEKWLSKASTGDRVASELRMRIIAGAIESGTILSEN
FT                   KIAADFSVSRSPVREALKLLASENIIRLERMGAVVIGLTEKEIEEIYDVRLLIETFIFE
FT                   RLGKMDTNDLVRELNKIMEMMKIAIKYHDSDEFSYQDLLFHETIIRTIEHSYILMIWNN
FT                   LKPVMESLILLSMRTRFKEKYEDFERIIKNHELYIKAIESKDRALMIEALHQNFDDVQG
FT                   KVEDLWMSQQMLSKGVEQGHE"
FT   gene            169264..170799
FT                   /gene="gntK"
FT                   /locus_tag="BACI_c02030"
FT   CDS_pept        169264..170799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="BACI_c02030"
FT                   /product="gluconate kinase"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02972"
FT                   /db_xref="GOA:D8GXM6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006002"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM6"
FT                   /protein_id="ADK02972.1"
FT                   /translation="MSSYMLGIDIGTTSTKAVLFTEKGEVIQTENIGYPLRTPDISTAE
FT                   QDPEEIFQAVLQAISNITKQHSDKKPSFISFSSAMHSVIAMDENDQPLTPCITWADNRS
FT                   EAWAHKIKDELNGHAVYRRTGTPIHPMSPLSKITWIVNAHPEIAIRTKKYIGIKEYIFK
FT                   KFFDQYVVDHSIASCMGMMNLKTLDWDEEALKIAGITSAQLSKLVPTTKIFSNCNPNLA
FT                   QKIGIDSQTPFVIGASDGVLSNLGVNAIRKGEIAVTIGTSGAIRTIIDKPQTDKKGRIF
FT                   CYALTEKHWVIGGPVNNGGMVLRWIRDELASSEVETAKRLGIDPYDVLTKIAERVRPGA
FT                   DGLLFHPYLAGERAPLWNPDVRGSFFGLTMSHKKEHMIRAALEGVIYNLYTVFLALTEC
FT                   MDGPVTRIQATGGFARSDVWRQMMSDIFASEVVVPKSYESSCLGACILGLYATGKIDSF
FT                   EIVSEMVGSTYKHTPKEEATKEYRQLLPIFINLSRALEDDYTRIANYQRNLIK"
FT   gene            170916..172262
FT                   /gene="gntP1"
FT                   /locus_tag="BACI_c02040"
FT   CDS_pept        170916..172262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP1"
FT                   /locus_tag="BACI_c02040"
FT                   /product="gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02973"
FT                   /db_xref="GOA:D8GXM7"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM7"
FT                   /protein_id="ADK02973.1"
FT                   /translation="MPLVIVAIGILALLLLIMRFKLNTFISLIIVSVGVALALGMPPEK
FT                   IFKTIEAGLGGTLGHLALVFGLGAMLGKLLSDSGGAQRIAMTLVKKFGEKNIQWAVVTA
FT                   SFIIGIALFFEVGLVLLIPIVFAISRELKVSILYLGISMAAALSVTHGFLPPHPGPTAI
FT                   AGELHANIGEVLLYGFMIAVPTVVLAGPVFTKLAKKLVPEAFTKTGNIQSLGEQKVFKL
FT                   EETPGFGISVFTALLPVLLMAVATIITLLQKTMGFKDNSLLATIEFIGNADTAMLISLL
FT                   VAIYTMGLARNIPIKSVMESCTTAISNIGMMLLIIGGGGAFKQVLIDGGVGNYVAELFK
FT                   GTSLSPILLAWIIAAILRISLGSATVAALTTVGLVIPMLGQSDVNLALVVLATGAGSLI
FT                   ASHVNDAGFWMFKEYFGLSMKETFATWTLLETIVSVAGLGFTLLLSLFV"
FT   gene            172527..173936
FT                   /gene="gntZ"
FT                   /locus_tag="BACI_c02050"
FT   CDS_pept        172527..173936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntZ"
FT                   /locus_tag="BACI_c02050"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02974"
FT                   /db_xref="GOA:D8GXM8"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM8"
FT                   /protein_id="ADK02974.1"
FT                   /translation="MEKLQIGVVGVGVMGKSLALNFESKGYSVALYDISKEKVDETIEE
FT                   NRGKNLVGTHIVEEFVNSLESPRKILLMVNAGEITDKAIDSLVPHLDKGDILIDGGNTY
FT                   FVDTIRRNKRLAEEGINFIGAGVSGGEEGALKGPSIMPGGQKDAYEKVKDMLENISAKV
FT                   NNEPCCSYIGPNGAGHYVKMVHNGIEYGDMQLICEAYFFLKQTLDLTAEEFHEIFAEWN
FT                   KGELNSYLIEITADIFKKKDEETGKPLVDVILDTAGQKGTGKWTSQSALDLGISLPIIT
FT                   ESVFARCISALKEERVNASKVLSGPKDKTAIGVEKAELIEAVRQALYMSKICSYAQGFT
FT                   QLKAASEEYDWNLDFGSISMLWRGGCIIRAAFLQNIKEAYETNTDLPNLLLDPYFKEIV
FT                   ESYQGGLRQIISMAVQQGIPIPAFSAAISYYDSYRTAKLPANLLQAQRDYFGAHTYKRV
FT                   DKEGTFHTKWI"
FT   gene            174279..176243
FT                   /locus_tag="BACI_c02060"
FT   CDS_pept        174279..176243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02060"
FT                   /product="prolyl oligopeptidase family"
FT                   /EC_number="3.4.21.26"
FT                   /note="peptidase S9"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02975"
FT                   /db_xref="GOA:D8GXM9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXM9"
FT                   /protein_id="ADK02975.1"
FT                   /translation="MKVSEKIYLSIEEIISLPTVLSTNISDDGKNVAFVKRTANWEDNT
FT                   YRNHVWIYEKDKGKSYPLTTGDIDSIHPLWSPDSKSIAYLSSGGDGDMKNQIFVKSLDD
FT                   YSEVKITDEKEGVSNFRWDPTGKGFYYITQSKECEEIKKRKELYGDFQHVGKEHQNNCL
FT                   CYIEIEKVIQNDKEEREINGVYQLIGGKDFYIHGFDISDNGKKVVCMATPSLNDHMNGD
FT                   LYILDVEARELQQMNVDKLLGGSACFSPEGNKICYSASIREKEYYRNHIQESTLEIYDM
FT                   NTGEVIQPLTNFDSTVMPLQWTAKGILIRWQDKTNYFIGLLAEDGTVETLREKVDGFIM
FT                   DASITRDGNHITYNKAITNETFEIYLDDKKITNENSLFEGKLKSNREIISWRSSDGLEI
FT                   EGVLSTPVEFDANKKYPLLVVIHGGPAWASFPIFSNCFNEKYPIEQFVEKGFIVLEPNY
FT                   RGSSGYGNEFLKANYRKQGLADYDDVISGVDELVEKGMVDKDRVGVMGWSNGGYISAFC
FT                   STFSSRFKAISVGGGITNWSTHYVNTDIPYFIRMYLGNTPWNDPDIYKRTSPMTYIKSA
FT                   CTPTLIQHGEKDARIPITNAYELHQGLKDMEVDTELIIFKGMAYSSDQPGVHVAIMKQN
FT                   LMWFSHYILGESMEDFSTI"
FT   gene            176362..176928
FT                   /locus_tag="BACI_c02070"
FT   CDS_pept        176362..176928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02976"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN0"
FT                   /protein_id="ADK02976.1"
FT                   /translation="MTENKNELSVEQREELLKVLQARFEKNMNRHEGLEWAKVEAKLAT
FT                   NNEKLWTLNEMEVTGGEPDVVGYDEEKDEYTFYDCSKESPKGRRSLCYDLEALESRKKH
FT                   KPENNVIDVANAMGIELLTEEQYRELQKLGDFDMKSSSWVQTPSDIRELGGALFCDYRF
FT                   GHVFVYHNGADSYYAARGFRGSLRV"
FT   gene            complement(177000..177506)
FT                   /locus_tag="BACI_c02080"
FT   CDS_pept        complement(177000..177506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02977"
FT                   /db_xref="GOA:D8GXN1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN1"
FT                   /protein_id="ADK02977.1"
FT                   /translation="MVINFLRTDKRAAFILLFLRLYIGYTWLAAGIGKVFGQSFDASGF
FT                   LKGAIAQASGDHPAVQSWWADFLQHFVLPNADLFSFLVQWGEILVGLGLILGGLTKTAA
FT                   FFGIIMNLAFLLSGTVSVNPNLLILTMFILVAGQNAGRIGLDGYVFPKLFRKNSHGTYK
FT                   LSKTA"
FT   gene            complement(177665..178966)
FT                   /locus_tag="BACI_c02090"
FT   CDS_pept        complement(177665..178966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02978"
FT                   /db_xref="InterPro:IPR031888"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN2"
FT                   /protein_id="ADK02978.1"
FT                   /translation="MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKT
FT                   DTTKENKPEEKKSEDKKTEDKKTENTATSPSDYSKLISYMEKETGGKTKVLFENKEPQV
FT                   YKAEDVSVSMNSYTLVELNGFHTDFNIPFNRQTEGGVILVNYSVKNSSAKDIYYMPALD
FT                   ISFTGAQKVYSNYKDLIPKEDQLPTKLAPTNDYLVKAGESISGYIAYPFGKDDLEKISS
FT                   LSTVSVTVPTAQANKGKFDAPIGSPGSFSLSLNKQGAEKVATDKAFYQDKATANNMGDK
FT                   KMLKEKSSINNSQELGAVNVTLDGYQFTQFTPNSVEAPRFANFKNGIVLLTVKFKLDNK
FT                   DTQDVSLSPISSTLRVNDGTQYTINEGMLLNYDYNASVKTGTSGELLQVFILDQEQYEK
FT                   IWKDKSFEIELGPMRNKEAKDISQGKKAKFTLPK"
FT   gene            179407..180183
FT                   /gene="fabG1"
FT                   /locus_tag="BACI_c02100"
FT   CDS_pept        179407..180183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG1"
FT                   /locus_tag="BACI_c02100"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02979"
FT                   /db_xref="GOA:D8GXN3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN3"
FT                   /protein_id="ADK02979.1"
FT                   /translation="MMNQLKHKVAVVTGVSRLDGIGAAICKELAEAGYNIFFTYWTEYD
FT                   KEMPWGVDQSEQIQLQEELLKNGVKVSSMELDLTQNDAPKELINKVTEQLGYPHILINN
FT                   AVYSTNNDFSNLTAEELDKHYMVNIRATTLLSSQFARGFDKKSGGRIVNMTSGQFQGPM
FT                   VGELAYATTKGAIDALTSSLSAEVAHLGITVNAINPGPTDTGWMTEEIKQGLKPMFPFG
FT                   RIGEPKDAARLIKFLVSEEAEWITGQVIHSEGGFKR"
FT   gene            complement(180221..180889)
FT                   /locus_tag="BACI_c02110"
FT   CDS_pept        complement(180221..180889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02110"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02980"
FT                   /db_xref="GOA:D8GXN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN4"
FT                   /protein_id="ADK02980.1"
FT                   /translation="MENKSFLDEWGKVIWEATIQTFQMTSISLFISILIALPLGVTLVL
FT                   TRPGGQHENKIIYSILNTIINIIRSLPFIILLFFILPFTKFLMGTSIGVQGVIVPLVVF
FT                   TAPYIARLMETALLEVDRGVIEAYQAMGVSTIQIIWHVMVKEARPSLVLGLTIATIGLI
FT                   GATAMAGLVGAGGLGDLAYRFGHLRYEPEVMYATVFILIILVQGLQSLGNGIARRLKKD
FT                   "
FT   gene            complement(180864..181904)
FT                   /locus_tag="BACI_c02120"
FT   CDS_pept        complement(180864..181904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02120"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02981"
FT                   /db_xref="GOA:D8GXN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN5"
FT                   /protein_id="ADK02981.1"
FT                   /translation="MIELKNVSKVFTTKKGNVEALKSTSLQVKKGEVFGIIGYSGAGKS
FT                   TLIRCVNLLEKPTTGNIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIA
FT                   LPLRLAGVPKLEIEKRVEKYLRIVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLL
FT                   SDEATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVVES
FT                   GTVKDIFTNPQHVTTKKFVNSAFAAKIPAEVQKELQRTGEIVTLSFIGNSSGEPALAVA
FT                   TKRFQVYPNILSGNITQLKHEAYGKLVIHMQGEQNEINHALSFLQEQGIIVEGGRTDYG
FT                   KQVLFG"
FT   gene            complement(181917..182729)
FT                   /locus_tag="BACI_c02130"
FT   CDS_pept        complement(181917..182729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02130"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02982"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN6"
FT                   /protein_id="ADK02982.1"
FT                   /translation="MKKVLLSIVSGAVLLLGACSAGSDKEVKALDEKKITVGVTGGPHE
FT                   QIFEKVKEVAAKDGLEIDVKVFNDYVAPNVSLDEKGLDVNSYQTKSYLDVFKAERNMKL
FT                   TEVFSTVTFPMGVYSKSLKDVKDLKDGDTIAVPNDPTNELRALKLFEKAGVLKVDPKAT
FT                   EKATAKDVIENPKNLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGK
FT                   DSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKFDGSVLPSW"
FT   misc_binding    182815..182929
FT                   /bound_moiety="SAM"
FT                   /note="BACI_c02140; SAM riboswitch, RF00162"
FT   gene            complement(183009..183917)
FT                   /locus_tag="BACI_c02150"
FT   CDS_pept        complement(183009..183917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02150"
FT                   /product="alcohol dehydrogenase, zinc containing protein"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02983"
FT                   /db_xref="GOA:D8GXN7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN7"
FT                   /protein_id="ADK02983.1"
FT                   /translation="MKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVSTGDCR
FT                   IRGFNSPLLFWIPMRLILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFALTELN
FT                   LGGYAEYTCVHESGLITLKPTNVTYEEAAVIPFGGTSALHFLRKGRIKKGQQVLIYGAS
FT                   GSVGIAAIQLAKYFGATVTAVCSNSNFELVQSLGADKVIDYTKEDFTKRRERYDIIFDA
FT                   VGKHKKSLCKQVLAPNGKYVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEI
FT                   AEAHMYVEIGHKKGNVSITLK"
FT   gene            184063..184827
FT                   /locus_tag="BACI_c02160"
FT   CDS_pept        184063..184827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02984"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN8"
FT                   /protein_id="ADK02984.1"
FT                   /translation="MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAK
FT                   DVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDIVKAKMQLEPKTKNSRSEMNISGTDVV
FT                   VYTVDGKVAGEVKNPNTGEVITVPEEQLNAGGMKATQDIIDKLEVPEVVLDKMKLEKSG
FT                   DKYKLKFTLKGQETESMLTSMDETQKKMLQAQNAKIEEVDAEYIITKDFKYESAKIDMI
FT                   MSSNGKDKAHIITNAKYTSYEKFDPIQLPAAK"
FT   gene            184960..186375
FT                   /locus_tag="BACI_c02170"
FT   CDS_pept        184960..186375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02170"
FT                   /product="oxidoreductase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02985"
FT                   /db_xref="GOA:D8GXN9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXN9"
FT                   /protein_id="ADK02985.1"
FT                   /translation="MVIVAYTVLLATSVHTYKKQLDHPIMSDVGKLLPTKIKRVESATD
FT                   EHSLIQLVQDANVSGEKISIAGMQHSQGGQTYYPHGTMLDMKGYNKILEFDPEKKRITV
FT                   QSGVTWNDIQKKVNPYGLAVQVMQSQNIFTVGGSLSVNVHGRDIRHEALIDTVESFRLL
FT                   MADGTVRNVSREENADLFPYVIGGYGLFGVILDVTLKLTNDELYETHTKMLDYKEYTSY
FT                   FKEKVKKDANVRMHLARISVAPNSFLREMYVTDYTLAQNQNMREEYSELKEETIIAAPK
FT                   FLLGLSRYSDWGKNTFWDIQRSYFERTDGKYETRNNVMRSDSAFMEYENPNRTEVLQEY
FT                   FVPIDSFTEYIDDLRNVLNEEEFNLLNITIRYVEKNENAVLSYAKDDMFALVLLINQGR
FT                   SENEIKKTEDVIQKMIDVTLKHNGSYYLPYYSYPTKEQLKRAYPRIEEFLGKKKEADPK
FT                   ERFVNLFYREYTK"
FT   gene            186372..186905
FT                   /locus_tag="BACI_c02180"
FT   CDS_pept        186372..186905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02180"
FT                   /product="probable membrane transport protein; possible
FT                   multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02986"
FT                   /db_xref="GOA:D8GXP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP0"
FT                   /protein_id="ADK02986.1"
FT                   /translation="MTYRRFIASQSIIMMAGSMVFPFYILLLRNVGSSFSQFGWAYGLF
FT                   ALTSALVYPLVGKLSDRVGDQKLLIIYAWTMAILMLCFPIATEVWHVYILQILMGVLGA
FT                   VQRNTEKTSLARKVVQENAGYEIGKYHVWTSIGGAVAIIATGYLVDFFTIGTIFYIASI
FT                   LYVVSGVVLSSKKI"
FT   gene            186984..188705
FT                   /locus_tag="BACI_c02190"
FT   CDS_pept        186984..188705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02987"
FT                   /db_xref="GOA:D8GXP1"
FT                   /db_xref="InterPro:IPR025043"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP1"
FT                   /protein_id="ADK02987.1"
FT                   /translation="MKFLILAILTLFLIPWTRRSGSKLRAVDKKGDEKVVKGKKSSILV
FT                   IPVLFWIGIAIYEYFWLIDDRADSILTHYSVAVAILIGLVLFSQDQIGKLEGTLKGLLM
FT                   FVLLASYGYFGYLHDIVISQTKYDSVVKIEKDISEPFTENDQPFTVPPKTAENKMKKVF
FT                   GDIPKVAYFELGELTPQMVNGEALYVAPIEVSGFFKARKAETIPGYVTMSGTNPDAEAK
FT                   LHLGYKMKYVPSMFFGNNLERVVRQAEPNLIFKGKPKFEVDDKGKPYYTMTYGEFISGR
FT                   SGFEVEGVVVVDAQTGEVKRYDKGKAPKFIDGVLNHETASTLNTYFGKYIHGFWNTKFS
FT                   QTDMKIPTEWGTKEGVTPIFGKDGTLYYFTDFTSPKEGVDSALGYSLVDARTGKLYYYN
FT                   GKEVKGIMDGSAASEVVDNSFKREKWHGTMPVIYNVYGKPSWIVPVIDDGGLVRAHTVI
FT                   YASNAKIFATGSTQKEALENYKNALSGSGDSFRPTSSGKEAQKEGVVQRVYKEKTGENT
FT                   IVYVLLENEQKVFMIPAKKFPYAMFTEVGDPIQITYLDTGEAMSSVSKFTNSNLNK"
FT   gene            188833..190083
FT                   /gene="tcaB"
FT                   /locus_tag="BACI_c02200"
FT   CDS_pept        188833..190083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcaB"
FT                   /locus_tag="BACI_c02200"
FT                   /product="drug resistance transporter Bcr/CflA subfamily;
FT                   possible bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02988"
FT                   /db_xref="GOA:D8GXP2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP2"
FT                   /protein_id="ADK02988.1"
FT                   /translation="MNEVNQEIYKPVKTNRLWMILVLGTLTAIGPLSIDMYLPSLPKLT
FT                   DDLQTGASLAQLTLTACLLGLSVGQLFVGSISDIYGRRKPLIIALIIYVASSLLCAVAP
FT                   SIWTLVLLRFLQGASGSAGIVISRAMVRDMYSGSEMTKFFSLLMLVNGAAPILAPIIGG
FT                   QLLQFTTWRGVFIVLGAISVFMLISATFVLRETLPPEERETGGLSGTLATYGKLLKDRL
FT                   FMGYALSQGLVTAAMFAYISGSPFVLQNIYGASPQQFSLFFAINGIGIIIASQVTGRLA
FT                   GKVNEKTLFVSGIVIAAVGGLSLLLTILLGIGLIGVLCSLFLVVSSVGVVSTTGFSLAM
FT                   RNQKQAAGTASALLGLLQFISGALVAPLVGIGGSNTALPMGIVIALCEIGAVLCYLFMA
FT                   RRSEKQFELQARQNLEV"
FT   gene            190334..190837
FT                   /locus_tag="BACI_c02210"
FT   CDS_pept        190334..190837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02210"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02989"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP3"
FT                   /protein_id="ADK02989.1"
FT                   /translation="MKKVLGIAVMGSMILLAGCNGSKDTKEPKEKVEQSTEQTEEMKVY
FT                   REVHEKYDMKINKEINKALQLWEVAKEKGGKEITNATYKEDVQKVTTNMLEDIDHIRKE
FT                   IRVPKSKEQEHELYVGFLNEAEQAIKKLQKLAKEEDSSLIRDIEINFSTASTYYKRFQA
FT                   ETKK"
FT   gene            complement(190854..191069)
FT                   /locus_tag="BACI_c02220"
FT   CDS_pept        complement(190854..191069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02990"
FT                   /db_xref="GOA:D8GXP4"
FT                   /db_xref="InterPro:IPR025028"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP4"
FT                   /protein_id="ADK02990.1"
FT                   /translation="MDPLLLATIGLPLTIVILVIIGFYKLFIKKKSITSFYTPFDNITG
FT                   QTISEFHEEQKVLVSEDEDGDGKKKK"
FT   misc_binding    191241..191346
FT                   /bound_moiety="SAM"
FT                   /note="BACI_c02230; SAM riboswitch, RF00162"
FT   gene            191483..192400
FT                   /gene="oppB1"
FT                   /locus_tag="BACI_c02240"
FT   CDS_pept        191483..192400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB1"
FT                   /locus_tag="BACI_c02240"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02991"
FT                   /db_xref="GOA:D8GXP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP5"
FT                   /protein_id="ADK02991.1"
FT                   /translation="MYVIKKLSIMVFTLWVITTVTFLIMHIIPGDPFSSDAKIFPEEVI
FT                   QNMRAKYHLDEPLWNQYVAYLDGVVHFDFGESVQSTGQGVSEIITTGLGPSAIIGLQAL
FT                   IISLLVGIAAGTFAALYHGKVIDYSASLLAILGISIPSFILAPLFIQVFAIQFELLPVA
FT                   SWGTFEHTVLPSFALALGPIAVITRFVRSNMIEVLQSDYIKLARAKGIPIKKIIIRHAL
FT                   RNAIVPVLTFVGPLMAGLLTGTFVIEKIFSIPGLGKYFVDSIFNRDYPVIMGTTIFYSA
FT                   LLILCIFITDIIHRIVDPRIRSIT"
FT   gene            192417..193421
FT                   /gene="oppC1"
FT                   /locus_tag="BACI_c02250"
FT   CDS_pept        192417..193421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC1"
FT                   /locus_tag="BACI_c02250"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02992"
FT                   /db_xref="GOA:D8GXP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP6"
FT                   /protein_id="ADK02992.1"
FT                   /translation="MGAYEINNQLLTNEEKKELTINKDQQKISRKKEVFRKFVSNPIAV
FT                   LGSVTLLLIIVFSLIGESLTPFTASEQVKEATNLPPSSEHWFGTDDLGRDIWARTWAGG
FT                   KISLTVGLVAAALDIGLGVLIGGFSGYVRGRNRLGTLIDEWIIRGIEVLYGIPYLLIVI
FT                   LLLIVMKPGLFTIIIALALTGWIGMARLIRAQVLSLKQREFVIAAERLGTSHMKIIYGH
FT                   LIPNLTGIIIVNLSFTIPAAIFSESFLSFIGLGVQSPAASWGTMTNDALGTLLSGEWWQ
FT                   LFFPAIMIALIMFAFNAIGDGLQDAIDPKIIKRNRKEKKHGASLIFRKRNISR"
FT   gene            193378..194391
FT                   /gene="oppD1"
FT                   /locus_tag="BACI_c02260"
FT   CDS_pept        193378..194391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD1"
FT                   /locus_tag="BACI_c02260"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02993"
FT                   /db_xref="GOA:D8GXP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP7"
FT                   /protein_id="ADK02993.1"
FT                   /translation="MAQVLSLENVTLAVEKENSKQAIVKHVSFFINEGEIVALVGGESG
FT                   SGKSVTAQSIIGLNQESIQFDDGNISFESKDLTNLQESEWNQIRGKDISFIFQDPLSSL
FT                   NPTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEAEKRFEQYPHQLSGGMRQR
FT                   ICLAIAFACHPKLVIADEPTTALDVTIQKQIMGLLKERKEKQNTSILLITHDLALVREV
FT                   ADRVVVMYGGRIVEKGTIQEVIGSPKHPYTKSLLQAIPNMDDAEKVLRAIEGTTPSIET
FT                   LNSFGCPFVNRCPVAIQECIHRFPERTTYSAEHSSHCWQHVLEHDRAKSKEKVNAS"
FT   gene            194388..195161
FT                   /gene="oppF1"
FT                   /locus_tag="BACI_c02270"
FT   CDS_pept        194388..195161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF1"
FT                   /locus_tag="BACI_c02270"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02994"
FT                   /db_xref="GOA:D8GXP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP8"
FT                   /protein_id="ADK02994.1"
FT                   /translation="MTTDLITVKQVTKTYGSKNKEIAALKDISLAIPKGTTLGIIGESG
FT                   SGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKAAHKRDFLQKVQFIFQDSTAALNPRWK
FT                   VRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYIDRYPHEFSGGQRQRIAIARAL
FT                   LCEPEVLILDEPISALDVSLQIQIVHLLQKIQREQGYTYLFIAHDLPMVHYLCEKVAVL
FT                   YKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG"
FT   gene            195175..196785
FT                   /gene="oppA1"
FT                   /locus_tag="BACI_c02280"
FT   CDS_pept        195175..196785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA1"
FT                   /locus_tag="BACI_c02280"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02995"
FT                   /db_xref="GOA:D8GXP9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXP9"
FT                   /protein_id="ADK02995.1"
FT                   /translation="MKKFLLFVIMTVLAITSVACGKKETQKASAGKGEGDRLVTNISSD
FT                   PYTLDAAISTDSTSGYVIGHLFSSLYTQDSDGKYQNELAEKEEVNADGTEYTIHLKKDI
FT                   KWSDGSPITANDFEFAWKRLLNPKTGSMNATEMYFIKGAEAYNTGKGEEGQVGIQVVDP
FT                   QTLKITLEHPVSSIKQKLASSLFIPLSKKSIDDNNKLKTNPKELITNGPFTLKEWKHNQ
FT                   AITVQKNKEYYDKKVTLKEIEFRIIPDSKTAYQLYKSKELDLLSGLPQEMIEKEKGNKE
FT                   YKRVAGFSSYIYSFNVEKEPFTNAKVRKAFSLAVDRKFIVEKLYKNNAQEAYAFVPEGA
FT                   KTQGGRDFRKEKGDYVKFDPAEAKKLLEEGMKEQGWSTLPAVTLKFTTDTQHKKVAEAM
FT                   QEMFKKNLGVDIKLENKEWKSYIDTYKQSDFQLAYMGWGGSLLDPITKLDLYAGDGPNN
FT                   YAKWHNKEFDALVKEAEVEQNEDKRFDLLHKAEDIMFTDSPLIPIIFPSDSYLQKESVS
FT                   GLQYYVGSKPDLRYVKIKK"
FT   gene            complement(196802..197269)
FT                   /locus_tag="BACI_c02290"
FT   CDS_pept        complement(196802..197269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02290"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02996"
FT                   /db_xref="InterPro:IPR025623"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ0"
FT                   /protein_id="ADK02996.1"
FT                   /translation="MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNEAPAD
FT                   LKLNFNEFSLDADYQDTKKDYEADYKNVAADKKMEAKIEDHKTDVNLTGDEAITKLSPL
FT                   LQELKFDKDTPDQEVIDQVLNVFKLDKDYQKFELEVVFSDGTKKEYKREIK"
FT   gene            197442..198341
FT                   /locus_tag="BACI_c02300"
FT   CDS_pept        197442..198341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02300"
FT                   /product="transcriptional regulator, AraC family; possible
FT                   arabinose operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02997"
FT                   /db_xref="GOA:D8GXQ1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ1"
FT                   /protein_id="ADK02997.1"
FT                   /translation="MHEEYKEMIKKAIEYIENHLHEKLTTERVASHSAVSMYHFHRIFQ
FT                   RYIGMSVTDYIRKRRLTYAAQVLVSTERAVIDIAMQYGFSSQEAFTRAFKRMFQLPPKK
FT                   YRKYFQSFYIEREGVSMQKGIPKGWILSGSHPAEYEMGLDYEVVHQGKVSAYIKAKENV
FT                   THGGFSTLMQMFRADKYVGKRLHFTAFVKSENVRDWAGLWMRVDGKETEPLAMDNMQNR
FT                   PIKHTNNWQSYSVVLDIKEGALGIAFGVLLSGEGCVWLDSIRFDEVDEKIPTTDLAENF
FT                   YETLLEEPVNLQFEEVEK"
FT   gene            198360..198551
FT                   /locus_tag="BACI_c02310"
FT   CDS_pept        198360..198551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02310"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02998"
FT                   /db_xref="GOA:D8GXQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ2"
FT                   /protein_id="ADK02998.1"
FT                   /translation="MLKYVKLISISLVISSCIMGINYLVSYIWSGHTPSLTWKTYLMFL
FT                   FIFMMSFSSMQKEGEEDY"
FT   gene            198548..198895
FT                   /locus_tag="BACI_c02320"
FT   CDS_pept        198548..198895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK02999"
FT                   /db_xref="GOA:D8GXQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ3"
FT                   /protein_id="ADK02999.1"
FT                   /translation="MTIVFFAFLSLTQMFLTVFGNAGMIFNIISLSLQLVSSGVIVPHE
FT                   MLSKTYQTIGELFPATYAANDYYTIIFGGVSLERNIISLLVIVLVTQLVAVMTLAIKGI
FT                   VKGRSSVVKEA"
FT   gene            complement(198940..200580)
FT                   /gene="oppA2"
FT                   /locus_tag="BACI_c02330"
FT   CDS_pept        complement(198940..200580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA2"
FT                   /locus_tag="BACI_c02330"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03000"
FT                   /db_xref="GOA:D8GXQ4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ4"
FT                   /protein_id="ADK03000.1"
FT                   /translation="MKKKVVPVVASVLGASLLLTACGGNKDNASGAKANDKAPDKQAIN
FT                   LSFASEIPTMDVAKATDGESMNVMRNVFEGLYAMGEDNKPIPGVAESVDVSADKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVNPDTAAEYAFLFFDIKNAKQINQKQLPVGQLGI
FT                   KAVDDKTLEVQLDRPVPYFLSLTTFSTFLPINEEYLKSQGDKYGLETNHLIYNGAFTLD
FT                   NWKHEQSFQLKKNPNYWDAKTVKLEEINFNVVKDKSTEVNLYDSGQIDRVALTAEFVDK
FT                   YKGDPNFKERAEVGIQFLRLNQKNETLKNQHARLAINGAMNKKAYVETILNNGAVPAEG
FT                   MIPAKFAKSPDGNDFRKENGNLVKDDVKTAKENWKKAKQELGTDKVTIELLTSDNALAK
FT                   KTGEYLKGELEKNLDGLTVNLKPQPRKQQLKLLLSGDYEIGIDGWGPDFADPITFLDLF
FT                   TTDSAYNFDKYSNKEYDELIHKVKTDLAGDEKARFEAMKQAEKILLQDGAVAPLYQQGR
FT                   SYLQRSFIKGLVTTDFGGEFNYKWTEVTK"
FT   gene            complement(200968..202608)
FT                   /gene="oppA3"
FT                   /locus_tag="BACI_c02340"
FT   CDS_pept        complement(200968..202608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA3"
FT                   /locus_tag="BACI_c02340"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03001"
FT                   /db_xref="GOA:D8GXQ5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ5"
FT                   /protein_id="ADK03001.1"
FT                   /translation="MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLN
FT                   LSSPTEIRTMDTARATDTDSGQVMRNVFEGLYNLGEGNKPVPGVAKSHDVSGDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVDPATASEYAFLFFDIKNATKINNKELPADQLGV
FT                   KAVDDHTFEVELERPVPYFISLTAFPTFLPINEEFFKAQGDKYALEDNTILYNGAFTLS
FT                   DWKHEQSFKFKKNPTYWDKDTVKLEEINFNVVKEKSTEVNLFESKQLDRIKLTSDFVDK
FT                   YKKDANFKERPNVGVQFLRMNQQNKVLQNVSARQAIDQTIDRKSFVNTLLNDGSTPTFG
FT                   LVPKNFAKGPDGKDFRTINGDLTKVDTKSAQELWKKAKQELGSEKITLELLTSDADLDK
FT                   KTGEFLKGQLEKNLDGLTVNVKPQPRKQQVSLLLKGDYEIGIDGWSPDFADPITFLELF
FT                   TTNNPYNLDHYSNKEFDKTIEKVKTTLAGDEKARWEALLASEKILFKDSVIAPLYQKGE
FT                   SYLERSYVKGIVQVDFAGQLNFKWAQIEK"
FT   misc_binding    202741..202847
FT                   /bound_moiety="SAM"
FT                   /note="BACI_c02350; SAM riboswitch, RF00162"
FT   gene            complement(202999..203847)
FT                   /locus_tag="BACI_c02360"
FT   CDS_pept        complement(202999..203847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02360"
FT                   /product="possible 2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03002"
FT                   /db_xref="GOA:D8GXQ6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ6"
FT                   /protein_id="ADK03002.1"
FT                   /translation="MSLTSLKDYTTLHNGVKMPWFGLGVFKVEDGSQVIDSVKAAIKNG
FT                   YRSIDTAAIYQNEEGVGQAIRESGVPREELFITSKVWNSDQGYETTLQAFETTLEKLGL
FT                   EKLGLEYLDLYLVHWPVKGKYTESWKALEKLYKDGRVRAIGVSNFHIHHLQDVFEIAEV
FT                   KPMVNQVEYHPRLAQEELHAFCKEHNIQLEAWSPLMQGQLLDNPTLQDIAKKYNKSTAQ
FT                   IILRWDLQNEVVTIPKSIKEHRIIENANIFDFELSADDMKAIQALNEDRRVGPDPDNFN
FT                   F"
FT   gene            complement(203849..204652)
FT                   /gene="proC1"
FT                   /locus_tag="BACI_c02370"
FT   CDS_pept        complement(203849..204652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC1"
FT                   /locus_tag="BACI_c02370"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03003"
FT                   /db_xref="GOA:D8GXQ7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ7"
FT                   /protein_id="ADK03003.1"
FT                   /translation="MLTKHRILFIGAGRMAEAIFSGLLKTSKEYIEEIIVSNRSNVEKL
FT                   DQLRARYNVSTTTDWKQHVTSVDTIVLAMPPSAHEELLAELSPLLSNQLVVTVAAGIGP
FT                   SYLEERLPEGTPVAWIMPNTAAEIGKSISLYTMGQFVNETHQETLQLLLRGIGTSQLCT
FT                   EEEVHQLTAVTGSAPAFLYYFAESLIEATKSYGVDEATAKHLVIQMISGSASMLEQTQD
FT                   PANLREQVTTPGGSTAEGLKALYEYNFSEAIQKAVEATNQKARGK"
FT   gene            complement(204865..205716)
FT                   /gene="glcU"
FT                   /locus_tag="BACI_c02380"
FT   CDS_pept        complement(204865..205716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcU"
FT                   /locus_tag="BACI_c02380"
FT                   /product="probable glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03004"
FT                   /db_xref="GOA:D8GXQ8"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ8"
FT                   /protein_id="ADK03004.1"
FT                   /translation="MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIM
FT                   YVFTQPALTMTILIVGFISGLFWALGQVNQLKTVEKLGVSTTVTISTGMQLVATSIFGV
FT                   IAFREWTTTTTIILGTIAILLIVVGVVFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLV
FT                   YVIIIRWYNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNALSGLLWGTGNLFLL
FT                   LSLPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQLIFIALGSVLIIGGAVLLGMT
FT                   KA"
FT   gene            complement(206017..206691)
FT                   /gene="modB"
FT                   /locus_tag="BACI_c02390"
FT   CDS_pept        complement(206017..206691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BACI_c02390"
FT                   /product="molybdenum ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03005"
FT                   /db_xref="GOA:D8GXQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXQ9"
FT                   /protein_id="ADK03005.1"
FT                   /translation="MSFDAILSPIFLSLRVAACATIIVTILGTIIGRALARSSWRYKVI
FT                   LETIFLLPMVLPPTVIGFFLIIIFGNNSPIGTWIESIFQQSIMFTSTAAIIASTVVAFP
FT                   LMYQSAKTGFSIANVQIEESARDLGASEYQVFLHVTLPLAFPALLSGMILSFVRALGEF
FT                   GATLMFAGNIPGKTQTIPTAIYMAIDASNMQLAWTLVVITISMSLLFLLCIQLINKRIT
FT                   NS"
FT   gene            complement(206697..207503)
FT                   /gene="modA"
FT                   /locus_tag="BACI_c02400"
FT   CDS_pept        complement(206697..207503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BACI_c02400"
FT                   /product="molybdenum ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03006"
FT                   /db_xref="GOA:D8GXR0"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR0"
FT                   /protein_id="ADK03006.1"
FT                   /translation="MNQFTLRSIKALILSFLLIFSVACTSGDKKEKLTAKEGTAVELTI
FT                   SAAASLQDALKEIETKYKEKEPSIKLSFNFGASGALQQQIEQGAPADLFFSAAEDKFQT
FT                   LVKKGFINEKEGKNLLGNELVLVVPKDSSLTKIQDLKDEKIKKIALGTPESVPAGKYAK
FT                   ASLTHENLWNDVQNKVVFTKDVRQVLTYVETGNVDAGIVYKTDALISNKVKIGETAVAT
FT                   SHEPIHYPLGVIKESKHKKEATSFYEYLQSKDAQSIFKKYGFTVLS"
FT   gene            207664..208584
FT                   /locus_tag="BACI_c02410"
FT   CDS_pept        207664..208584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02410"
FT                   /product="probable molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03007"
FT                   /db_xref="GOA:D8GXR1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR1"
FT                   /protein_id="ADK03007.1"
FT                   /translation="MDHHSYTTEEVAKRLKVSKLTVYDLIKKGELPSYRVGRQMRIDAA
FT                   DLEQYIKKMKTGKIQVTPVKNGSNSISNTCIISGQELTLDMLAKRIENRLPSSTILRAY
FT                   QGSLTSLVKMYQGEGSIVSLHLFDGETGTYNIPYVKRILVGQPCIMINLLARNVGFYVQ
FT                   KGNPKNIKTWADLSQSSIRFINREKGSGIRVLVDEQLRIQNLNKERISGYEWEESNHLG
FT                   VATQVANGKADVGVGSEKFSQIVNVDFIPIMKEQYDLVILKNKENEELIEVVKDILQSE
FT                   EFHNELKAIGGYDMTKTGQIIYEIK"
FT   gene            complement(209157..210023)
FT                   /gene="gltR"
FT                   /locus_tag="BACI_c02420"
FT   CDS_pept        complement(209157..210023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltR"
FT                   /locus_tag="BACI_c02420"
FT                   /product="HTH_1-type transcriptional regulator, Lys R
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03008"
FT                   /db_xref="GOA:D8GXR2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR2"
FT                   /protein_id="ADK03008.1"
FT                   /translation="MELRDLQIFQSVADQGSVSSAAKELNYVQSNVTTRIKQLENELKT
FT                   PLFYRHKRGMTLTAEGRKMLVYVNKILQDVDELKQVFLDSETPSGILKIGTVETVSTLP
FT                   TILSSYYKSYPNVDLSLQAGLTEELIREVLDHQLDGAFISGPIKHPLIEQYDVSTEKLM
FT                   LVTQNKAFHIEEFTTTPLLVFNQGCGYRSKLERWLKDEGLLPKRIMEFNILETILNSVA
FT                   LGLGITLVPQSAVHHLSKAGKVHCHAIPEKYGSISTVFIRRKDSYMTNSMRSFLKTIEE
FT                   HHHINML"
FT   gene            210166..210543
FT                   /locus_tag="BACI_c02430"
FT   CDS_pept        210166..210543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02430"
FT                   /product="integral membrane protein"
FT                   /note="similar to N-terminal part of DMT superfamily
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03009"
FT                   /db_xref="GOA:D8GXR3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR3"
FT                   /protein_id="ADK03009.1"
FT                   /translation="MIIGALACLIASMSWGAMFPVADHALEYIDPFYFSLIRYGAVAIM
FT                   LIILLLMKEGKQAFRLEGRGKLLVFFGTMAFTVYNVLIFLGQMLMGKSGVMVASIMEAL
FT                   MPMISICILWGYKHMPINLRM"
FT   gene            complement(210646..212082)
FT                   /locus_tag="BACI_c02440"
FT   CDS_pept        complement(210646..212082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02440"
FT                   /product="transposase for insertion sequence element
FT                   IS231E"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03010"
FT                   /db_xref="GOA:D8GXR4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR4"
FT                   /protein_id="ADK03010.1"
FT                   /translation="MNLSIQSELQLFAEELHQHLTPSFLEKLARELAFVKRKRKFSGHD
FT                   LAAICVWISQRVASDSLVRLCSQLHAITGTLMSPEGLNKRFNKKAVCLLKHIFSALLKN
FT                   KIYKTSVIPSSSIAYFQRIRILDATIFQMPKHLANVYPGSGGCAQTAGIKIQLEYDLHS
FT                   GQFLNFQVEPGKNNDKTFGTECLATLRPGDLCIRDLGYYSLDDLDQMDQRGVYYISRLK
FT                   LNNMVYIKNEFPEYFRNGTVKKQSQYIKVDLEHIMNTLEPGQVYEITDAYIGKDKKLFT
FT                   RVIIYRLTEKQLRERKKKQVYTESKKGITYSEKSKRLAGMNIYVTNTPLEWVPMEQIHD
FT                   FYSLRWQIEIIFKTWKSLFQIHNWHNIKRERLECHIYGKLIAIFLCSSTMFKMRQLILK
FT                   KKKRELSEYKAIGMIQDHLYILYQAIQQNTRRITKILIRLFHLLQKNGQKSHRYEKKTI
FT                   FDIMGVAYEYNGLRKQKKIA"
FT   gene            complement(212204..212386)
FT                   /locus_tag="BACI_c02450"
FT   CDS_pept        complement(212204..212386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03011"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR5"
FT                   /protein_id="ADK03011.1"
FT                   /translation="MEQIILNNKNGSTEIYYKLFSMLSLLTFHKITSIEKKKKNLKLSL
FT                   ENELKNLTKNNPYKL"
FT   gene            212574..213194
FT                   /locus_tag="BACI_c02460"
FT   CDS_pept        212574..213194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02460"
FT                   /product="integral membrane protein"
FT                   /note="similar to C-terminal part of DMT superfamily
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03012"
FT                   /db_xref="GOA:D8GXR6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR6"
FT                   /protein_id="ADK03012.1"
FT                   /translation="MGMGYKHVKPKKYMITSMLIAFIGAVFVITKGDMSFFLTLKDNMF
FT                   SLACIFVGVVGWVIYTMGGQTCSDWSTLRYSTLTCVFGTTVTGIITIIITAFGYVSVPS
FT                   MGAISIVKYDLLFMMTLPGIVALLAWNYGVKILSSINGVLFINFVPITTLVIMMMQGYQ
FT                   ITMFDIVGTLLVIAALIRNNVCQRKEENINKRILEEEQLRQAV"
FT   gene            213216..213356
FT                   /locus_tag="BACI_c02470"
FT   CDS_pept        213216..213356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03013"
FT                   /db_xref="InterPro:IPR025417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR7"
FT                   /protein_id="ADK03013.1"
FT                   /translation="MLESLLFFFAVGVACELAAINRNGRKKIKQQAEMIELLKELKERN
FT                   I"
FT   gene            213728..214333
FT                   /locus_tag="BACI_c02480"
FT   CDS_pept        213728..214333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02480"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03014"
FT                   /db_xref="GOA:D8GXR8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR8"
FT                   /protein_id="ADK03014.1"
FT                   /translation="MYKPITFLLKYIFKTAGKVEVQGREKLPEGGPYVVACTHTSFMDV
FT                   LMLATGMYPTEIHYMAKKELFEGKFKNWFFKNVNAFPVDRANPGPSTLKIPSRLLKEGK
FT                   VVGIFPSGTRSTEDVSLKAGAVTIAMRSNVPLIPAAYIGPSSVKELIKGKRAQLIFGDP
FT                   IQIDAEEQIDRKTAMKMMTDQLNEKFEELKEALQSNQK"
FT   gene            214808..215785
FT                   /locus_tag="BACI_c02490"
FT   CDS_pept        214808..215785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02490"
FT                   /product="periplasmic-binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03015"
FT                   /db_xref="GOA:D8GXR9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXR9"
FT                   /protein_id="ADK03015.1"
FT                   /translation="MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRKVVIEIVEKLNY
FT                   SQNANAVHLSKGKTNIVGVILPYINHPSFDAMVGGMMEGALTHNYRVLLCQTNYNKKEE
FT                   MKSLHMLKTKQLDGLIICSRANDWEMIEPYASYGTIIACEDNDISNISSVYTNHSAAFQ
FT                   LGMNHLIEKGYKKIGYCTGRKLGPSSQKRFNVYKQQLQSIDEEVNEEWIFTECFTLEDG
FT                   VRVAHKLKGMQNLPEALIVAGDEVAIGVMTEVGKLGIQVPEDLAIIGLDNQPISQVLQL
FT                   TTIDQNLKEIGKTAFEMFYRHISDKSSKQEKVEVPYELVERSTV"
FT   gene            215934..216263
FT                   /locus_tag="BACI_c02500"
FT   CDS_pept        215934..216263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03016"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS0"
FT                   /protein_id="ADK03016.1"
FT                   /translation="MNELLLSVKKYLENDENIVAFVIGVFEKDNFTLCYQHGIFVATTR
FT                   RLLFYGKFPYYPSTFKEYSYLHIDSIDFCPYFEFTCNHETVRAKCIQRGNVERFVRTVR
FT                   TNMNN"
FT   gene            216382..217218
FT                   /locus_tag="BACI_c02510"
FT   CDS_pept        216382..217218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02510"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03017"
FT                   /db_xref="GOA:D8GXS1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS1"
FT                   /protein_id="ADK03017.1"
FT                   /translation="MVNQRIKEITLITIGSLLFAIGINYFAIPNRLSEGGIIGLTVVTY
FT                   YLFDWSPGIVNFAINAILLAIGYKFFDKKTMVYTILGIVETSLFLYVTEHIEYHVNSDT
FT                   LLAALFAGLFVGIGLGCMFKAGGTSGGSAILAQLANQYLGWSVGKGVLIIDIVVIAGSV
FT                   FIIGQEKAMYTLVAVFIGAKVIDFIVEGMDTKTAVTIISNQPDLIREAITKNMTRGVTV
FT                   LEGRGGYTGKNKEVLYVVINKQELVKLKQVISRVDEDAFVVIHDVRDVLGGGFKAS"
FT   gene            217317..217712
FT                   /locus_tag="BACI_c02520"
FT   CDS_pept        217317..217712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03018"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS2"
FT                   /protein_id="ADK03018.1"
FT                   /translation="MDVYISCRGGMFIMKKKMITTIIAMLVIVVMLLPTKLGPVIDKYN
FT                   PFYKTKEYYTVVNTIGQHVGDEWYEYEFIAFDERGKEQKIKKTVKHMLKRDEMLKVYAK
FT                   GRYGESIEEIEAANIPINAKSKLLSMR"
FT   gene            218458..219240
FT                   /locus_tag="BACI_c02530"
FT   CDS_pept        218458..219240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02530"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03019"
FT                   /db_xref="GOA:D8GXS3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS3"
FT                   /protein_id="ADK03019.1"
FT                   /translation="MKWIDSHIHVDQYKDEEKSRLLKDVENSKEIQGLIAVSMNYQSSK
FT                   EILSLAKRYSFVHPAVGFHPEQPIHKEECEKIYKLIEDHVEDIVAIGEVGLPYYLRKED
FT                   EHIAINSYISVLQRFVELASKYDLPIVLHAVYEGADVVCDLLEKHKVSRAHFHWFKGSE
FT                   TTMERMMRNGYYISITPDVLHKEKIRKIVSYYPLEYMMVETDGPWEFQEGVMTHPGMIR
FT                   EVLKEISVIKNVAVDKVAETIYENTIQFYPAIFRKLRP"
FT   gene            219370..220875
FT                   /locus_tag="BACI_c02540"
FT   CDS_pept        219370..220875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02540"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03020"
FT                   /db_xref="InterPro:IPR031841"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS4"
FT                   /protein_id="ADK03020.1"
FT                   /translation="MGKAYKKIAITIMVGALSLVAFGCETEKKTINSNATQENKEVQID
FT                   PVVEKQMKENEKNGNLVGNISNQGKMAESKGWIYYSVNGDKNTGGIYRTKDQFQTSERV
FT                   VEGVNASYINIKNKALYFIHTDEEKNAGLSSLMKYDISNKKLDTLKADTNYVYIKDQTL
FT                   FYPKKYSEHGGFDIVGIVKMDLKTGQEEEAVFKNSGWSRTIDDSILHWNKNRGTQVTKD
FT                   NKTWSKENYATMSSATYNDEKLYAVVDFSLPFETNEAEHGIYEIDVQQNNEKLLVKDAL
FT                   QMNVKGDTFYYVKKDGVYKKKMNGGNEKVIYNKAVEPTKSYLYLVAEDMYLYTDNGTIM
FT                   NLDTKKSNEVKDKKLADDVMLQKVWNAQKELTNVQMAALTGNPKRVGDFLYGELVNPIY
FT                   NKKDNLETTLSTYFSKSFMAEYMKSKYIKELNGKMHYVIGDPGSKAATKFTKIISAELK
FT                   DGKIKAQVETYNDYDNVTETVEVEFIYEHNQWVINNMPRFGLS"
FT   gene            complement(220911..222560)
FT                   /locus_tag="BACI_c02550"
FT   CDS_pept        complement(220911..222560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03021"
FT                   /db_xref="GOA:D8GXS5"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS5"
FT                   /protein_id="ADK03021.1"
FT                   /translation="MKKWLLLLFSLLLLIPVPISAQQNENPKVLILYSSSDDQITSDTQ
FT                   ILNTQVGHFTNNITIKSIKQLAEITDKSSYTHVIYIGEKQEELPTETKEFLENFSGPLL
FT                   VLGQNIEQLSKRFSFIILKNEDINSDTIEYPTRKLKNTLEDERSIKNLDTNGTILANAL
FT                   KGNTTYPLIVQQNNSYYVATPNLFDWMSHYIGEVLFSYFGQKPTNNKVEAYLRLEDVHP
FT                   AADINQLKEIAELLKEKKMPYMITVIPVYTDPETGKTLHLKDKPELVDLLRSMQDDGAA
FT                   IIMHGYTHQFYDSETGEGFEFWDVKTDQPIRQPKHEKPKTKDDFPNIEAYNTYVKKGEE
FT                   FEEKYTTDHIEKGIQELVDAKLYPVAFEAPHYTMSQKGYEILSRYFSTYVGQLQLSDTT
FT                   WKSMHSPAYRSTPSFLNGMKLMPETVGFIEEDKPHAIAKMKANAVSVAKLSDGVIGAFY
FT                   HPYLGVKPLKEVLKDLESIPNIEWIDLKKETNEVKMKDIHITTNKDGIHVEKPTSASDV
FT                   MDYIKQYGFFLILGFLVIVFLLLLRRAKKLES"
FT   gene            222811..223344
FT                   /locus_tag="BACI_c02560"
FT   CDS_pept        222811..223344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02560"
FT                   /product="invasion protein IagB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03022"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS6"
FT                   /protein_id="ADK03022.1"
FT                   /translation="MKKFFVGFLVVLGVYLYFQGKSEGMGKLVNETSYVDSEEAKQMKQ
FT                   IIIEEAKKVNLPEWIPLTIAEHESRLNPRSVGDNGTSFGLFQLHRGGGLAPDNLTDDEL
FT                   KDPRTNAQIAMPHLMKGYKRGVQKGLTDFALLKYIANTSGWPGNLGPEWTDNNMKYNVG
FT                   LEDVYYRNKGVIKE"
FT   gene            complement(223360..224142)
FT                   /locus_tag="BACI_c02570"
FT   CDS_pept        complement(223360..224142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02570"
FT                   /product="possible galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03023"
FT                   /db_xref="GOA:D8GXS7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR012361"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS7"
FT                   /protein_id="ADK03023.1"
FT                   /translation="MDTQQLYFLNDIGKQKPESIRNRSAACPFCDRENLTDILATEGPI
FT                   IWLKNKFPTLKDTFQTVLIETDNCEDHIATYTEEHMRSLIRFSIKHWLDLQKNEEFTSV
FT                   ILYKNHGPFSGGSLHHAHMQIIGMKYVNYLDNVEQDNFQGVIVQKNKNIELNISDRPII
FT                   GFTEFNIIIEDIGCIDELANYIQQTVRYILTDFHKGCSSYNLFFYHVSGKIICKVVPRF
FT                   VVSPLYVGYKIPQVSTKLEDVKIQLAEYFTKRHDDPQK"
FT   gene            224826..224960
FT                   /locus_tag="BACI_c02580"
FT   CDS_pept        224826..224960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03024"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS8"
FT                   /protein_id="ADK03024.1"
FT                   /translation="MKRSLAARAKFLDFIYFCRAIFHDVVVNGIRLSFFNNCIVAIER"
FT   gene            225085..226965
FT                   /locus_tag="BACI_c02590"
FT   CDS_pept        225085..226965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02590"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03025"
FT                   /db_xref="GOA:D8GXS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXS9"
FT                   /protein_id="ADK03025.1"
FT                   /translation="MTICSVNNITKSFGGNIIFENISLEIKNGERVGLVGRNGSGKTTI
FT                   FQLLTGMESLDAGAIHMKKGTRIGHVAQIPKFDESMTVYEVLSSAFKIEKELEREMRTL
FT                   EKHMAEEQESSVLQKLMERYGIIQEKFAFLGGYEIEANIMKVANGLQVTELFPRSFLEL
FT                   SGGEQTKVSLAYMLLQKPDLLLLDEPTNHLDLFAVEWLEQFLKEYNGTVMVISHDRYFL
FT                   DEVVTKIFDLEDGEIHVYHTNYSRFVEEKEERLLQEFQAYQEQQKKIKKMKEAIKRLRE
FT                   WANQANPPNEGLHKRARSMERALERMQKLKKPILERKQMGLQFEGQDRSGKDVVVIKEV
FT                   SKGFADHPLFNEVNLHVRFQERAAIVGRNGTGKTTLLKLLLEEIEPDAGEIRIGSSVKI
FT                   GYLSQHAYGNMKSNVLEAFREYVAVTEGEARHILAKFLFYGPAVFKKVTQLSGGEKMRL
FT                   RLAQLMYQDINFLILDEPTNHLDIESREVLEEALEQYNGTILAVSHDRYFLNKLFEKTY
FT                   WIDERKLFEFAGNYAWARQKWEERLETQVIKQQRQRRKSIETVPVKKKEVRNIEEIETE
FT                   LMHVEEDIYTLECKMEHVVDVEMLEQLYEEKTKKELLRAELYNELENIVE"
FT   gene            complement(227209..227406)
FT                   /locus_tag="BACI_c02600"
FT   CDS_pept        complement(227209..227406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03026"
FT                   /db_xref="GOA:D8GXT0"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT0"
FT                   /protein_id="ADK03026.1"
FT                   /translation="MDNLFQYVLHYVLLTIMIVGALLLFPFFPKFVLFLAFFIMLGVAI
FT                   IISTREDTTQKENRVQRVKL"
FT   gene            227865..229592
FT                   /gene="oppA4"
FT                   /locus_tag="BACI_c02610"
FT   CDS_pept        227865..229592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA4"
FT                   /locus_tag="BACI_c02610"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03027"
FT                   /db_xref="GOA:D8GXT1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT1"
FT                   /protein_id="ADK03027.1"
FT                   /translation="MKKKTKKWAGVFSVLLSSSLVLSACGGQEDTASTEPVKQQDLKNI
FT                   KIEKIAATDKTKVPDKAKNRKDTLVVGINKPGGVFLPYFQQNGWDGNVTSVIFASLIST
FT                   DKQGKPIPELAEKWDVSSDQLTYTFHLRKDLKFSDGSPLTADDVAFTLTLLHDKAYEGE
FT                   VDISQYAVKGGKEYKEGKATSIEGIQVVDPQTIKITTEKVNSQAIFVFGSTVLSKAYYG
FT                   KDYKQNTSLDYLKDLYGKPLAAGPYKFEKYIPGQEVRFIANENYYAGKPKIQNFIYKIT
FT                   SGDTKLQLFQTGEVDHTGLGTGDEVLEQAKALEFANIQIETAPSFSYVYMNHNKPYLKD
FT                   KKVRQALIYGLDRKKYVDTAYKGYGTVANVPIHPTSWAYTEEGVNKYEYDKEKAKKLLD
FT                   EAGWKVGSDGIREKYGQKLKLSYFGPSSAKDSDLLIPIAKENYKEIGVEFNPEFMDFNT
FT                   MLSKVNKGDYDLASVSTPITSDPSETAGEYLSSANEKSLGYKNAKVDELIQKGIETVDI
FT                   EKRKPIYKELYKELSDDPPVILLNYRRTITGYNGNIKGIDPEKYNSISANLPVLSFEK"
FT   gene            229696..230652
FT                   /gene="oppB2"
FT                   /locus_tag="BACI_c02620"
FT   CDS_pept        229696..230652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB2"
FT                   /locus_tag="BACI_c02620"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03028"
FT                   /db_xref="GOA:D8GXT2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT2"
FT                   /protein_id="ADK03028.1"
FT                   /translation="MKTYIVRRLLQMIPTLFGTSIIIFFLFALLPGDYIDSNPKITPER
FT                   AAELRELYGLNKPIVERYFHWLGNALQGDFGFSLQYQEPVISLLNKFIWNSFSVAVIAL
FT                   FFIWLIALIIGVFSATKQHSLFDKLVTIGVFAAMSFPSFFIGLFLIKVFAVDFKLLPIG
FT                   GMIDVGSNSTGFAYVIEVAKHMVLPVFILTLLGVGSLTRYFRTSMLEVVRQDYIRTARA
FT                   KGLKEKTVIYKHALKNAILPAITLLAFELPGLFSGAIIIEQIFNWPGIGNIQLEALNFR
FT                   DYTVLMAFTMFLSCLTIVSNFFADIVYAVVDPRIRLK"
FT   gene            230667..231590
FT                   /gene="oppC2"
FT                   /locus_tag="BACI_c02630"
FT   CDS_pept        230667..231590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC2"
FT                   /locus_tag="BACI_c02630"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03029"
FT                   /db_xref="GOA:D8GXT3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT3"
FT                   /protein_id="ADK03029.1"
FT                   /translation="METVTAITEKKEKKRRRNESSPWRQALKKIKKNKMALVGLYALIF
FT                   MFLFCFIGPFFSPYASGKIQVALINKPPSFSHWLGTDQLGRDILTRLMQAGRISLTIGL
FT                   ASMVLSVILGAVLGAIAGFYRGIVDNIIMRLADILMSMPGLPLLIIMGAILSEWKVPSD
FT                   YRLYVIMIILSLVGWPGLARLVRGQILSLREQAFMQAADVLGIKDYRKIIYHLIPNVLP
FT                   ILIVVSTLGVAGSILGESALSYLGLGVVPPTPSWGNMISAANSLIDFQKRPWLWIPPGF
FT                   AIFITVVSINLLGDALRDALDPKMRR"
FT   gene            231601..232581
FT                   /gene="oppD2"
FT                   /locus_tag="BACI_c02640"
FT   CDS_pept        231601..232581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD2"
FT                   /locus_tag="BACI_c02640"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03030"
FT                   /db_xref="GOA:D8GXT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT4"
FT                   /protein_id="ADK03030.1"
FT                   /translation="MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESG
FT                   CGKSVTALSIMGLIAESGSVVGGDILYGGKSLLGMKEKELRSLRGNDIAMIFQEPMTSL
FT                   NPVFTVGEQIVETLREHELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQR
FT                   IMIAVALSCNPKLLIADEPTTALDVTIQAQILDLLRQIKKEFKTSILLITHDLGVVAEM
FT                   ADYVVVMYGGKVIEEAPVLEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVG
FT                   LDEFCYFSGRCEHCMEICKEEAPNLNVHDENHKVACWLYEERAEQ"
FT   gene            232578..233543
FT                   /gene="oppF2"
FT                   /locus_tag="BACI_c02650"
FT   CDS_pept        232578..233543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF2"
FT                   /locus_tag="BACI_c02650"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03031"
FT                   /db_xref="GOA:D8GXT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT5"
FT                   /protein_id="ADK03031.1"
FT                   /translation="MSEPLLEVKNLKTYFPIKGGIFSRTVGHVKAVDGVSFTINKGEVF
FT                   GLVGESGSGKTTIGKTILRLVQKTEGEVKFKGHDVHSLSKEELRKHRPNMQLVFQDPFS
FT                   SLNPRMRIGEALGEPMLAHGLATKENVREKVTEVLELCGLAPYHIDRYPHEFSGGQRQR
FT                   IVIARAMVLNPEFIVADEPVAALDVSIQAQIINLFSELQEKKGLSYLFISHDLSVVEHL
FT                   CTKIGIMYLGTIVETAPRDELFTNPLHPYTKALLSAVPIPDPTVKRERIILEGDIPSPA
FT                   NPPSGCRFHTRCPFATDICKQTVPEFRNVGEEHFVACHHV"
FT   gene            complement(233582..234454)
FT                   /locus_tag="BACI_c02660"
FT   CDS_pept        complement(233582..234454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02660"
FT                   /product="hydrolase, HAD superfamily"
FT                   /note="haloacid dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03032"
FT                   /db_xref="GOA:D8GXT6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT6"
FT                   /protein_id="ADK03032.1"
FT                   /translation="MKLIALDMDGTLLSSSLEISKENLQAIQTAKEAGHIVMICSGRAK
FT                   EDALKLLEEYKLSLPVGASNGAIVYVDGKVINSRCLQNDKVYKLAKSLESEGFPYKLYT
FT                   NKGVYSPYTWQDQVMQAFEENKHALDVTLEELERITEKQKKSNLITDFQKIEDVVNNPE
FT                   LEISKFFILTFNAGHRAQLLSMLQEDTDIMVTASAPTNLEIMDKNGHKGNGLKQMAAHF
FT                   NIPIEDTVAIGDNFNDVPMLEAAGLSVAMGNAEEDVKKLCDVVTLTNNEHGVAHAIEQF
FT                   VLKQTSSSK"
FT   gene            234905..235012
FT                   /locus_tag="BACI_c02670"
FT   CDS_pept        234905..235012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03033"
FT                   /db_xref="GOA:D8GXT7"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT7"
FT                   /protein_id="ADK03033.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            235053..235160
FT                   /locus_tag="BACI_c02680"
FT   CDS_pept        235053..235160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03034"
FT                   /db_xref="GOA:D8GXT7"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT7"
FT                   /protein_id="ADK03034.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            235203..235310
FT                   /locus_tag="BACI_c02690"
FT   CDS_pept        235203..235310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03035"
FT                   /db_xref="GOA:D8GXT7"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:D8GXT7"
FT                   /protein_id="ADK03035.1"
FT                   /translation="MKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            235774..236892
FT                   /gene="hppD"
FT                   /locus_tag="BACI_c02700"
FT   CDS_pept        235774..236892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BACI_c02700"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03036"
FT                   /db_xref="GOA:D8GYK8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYK8"
FT                   /protein_id="ADK03036.1"
FT                   /translation="MKQKSMDTLAAQMEDFFPVRDVDHLEFYVGNAKQSSYYLARAFGF
FT                   KIVAYSGLETGNREKVSYVLVQKNMRFVVSGALSSDNRIAEFVKTHGDGVKDVALLVDD
FT                   VDKAYSEAVKRGAVAIAPPVELTDENGTLKKAVIGTYGDTIHTLVERKNYKGTFMPGFQ
FT                   KAEFDIPFEESGLIAVDHVVGNVEKMEEWVSYYENVMGFKQMIHFDDDDISTEYSALMS
FT                   KVMTNGSRIKFPINEPADGKRKSQIQEYLEFYNGAGVQHLALLTNDIVKTVEALRANGV
FT                   EFLDTPDTYYDELTARVGKIDEEIDKLKELKILVDRDDEGYLLQIFTKPIVDRPTLFIE
FT                   IIQRKGSRGFGEGNFKALFESIEREQERRGNL"
FT   gene            236956..237915
FT                   /locus_tag="BACI_c02710"
FT   CDS_pept        236956..237915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02710"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03037"
FT                   /db_xref="GOA:D8GYK9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYK9"
FT                   /protein_id="ADK03037.1"
FT                   /translation="MMKFVTFRLPSKEMRAGWLEGDKVIDMNLASDGKLPSSMFAFLEK
FT                   ADEYVEVLRNIKNPEKGIYSLEEVQLAAAIPNPSSIRDFYAFEQHVKTARGRRGLDVVP
FT                   EWYDIPVFYFTNHRAVIGPNDVVIGPKKSEKLDYELEIACVIGKEGRNISREQAEEYIF
FT                   GYCIMNDWSARDLQATEMKVGLGPAKGKDFATSLGAHLVTKEELDIYRNGDRYELEMTA
FT                   HVNGKLLSKGNFQDIYYTFAEMIERASEDVTLYPGDVIGSGTVGTGCILELGTEEWLQD
FT                   GDVVELTITGLGTLRNTVKKEKEAGDEHVLSSHGGATS"
FT   gene            237968..239053
FT                   /locus_tag="BACI_c02720"
FT   CDS_pept        237968..239053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02720"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03038"
FT                   /db_xref="GOA:D8GYL0"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL0"
FT                   /protein_id="ADK03038.1"
FT                   /translation="MGTKGFSGTQSILYHHYMPTEVGHAALSHSCQLQYEEDVALSHRH
FT                   FRTKENKKSGDAVSGRNFILGNEDLLIGVVTPTEKMDYFYRNGDGDEMLFVHYGTGKIE
FT                   TMFGTIHYRKGDYVTIPIGTIYRVIPDEGETKFLVVEANSQITTPRRYRNEYGQLLEHS
FT                   PFCERDIRGPEKLETYDEKGEFVVMTKSRGYMHKHVLGHHPLDVVGWDGYLYPWVFNVE
FT                   DFEPITGRIHQPPPVHQTFEGHNFVICSFVPRLYDYHPESIPAPYYHSNVNSDEVLYYV
FT                   EGNFMSRKGVEEGSITLHPSGIPHGPHPGKTEASIGKKETLELAVMIDTFRPLRIVKQA
FT                   HETEDEKYMYSWIEEGSYTVK"
FT   gene            239285..240700
FT                   /locus_tag="BACI_c02730"
FT   CDS_pept        239285..240700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02730"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03039"
FT                   /db_xref="GOA:D8GYL1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL1"
FT                   /protein_id="ADK03039.1"
FT                   /translation="MKQIFQKKPIAKLMQESKQKTLARTLGALDLTMLGIGAIVGTGIF
FT                   VLTGVVAAKHSGPAIILSFAIAALACAFAAFCYAEFASSVPVSGSVYTYTYATMGEVFA
FT                   FLIGWDLMLEYLLATSAVANGWSAYFQSLLKGFGIHIPTILSSAPGTGKGGIIDLPAVL
FT                   IILVMTVLLSRGVRESARVNNIMVFIKIAVVLIFIFAGFNYVKPENWTPFMPFGLDGVM
FT                   AGAATVFFAFIGFDAVSTAAEEVKRPQRDLPIGIIASLLICTALYIVVSLILTGIVPYG
FT                   QLNISDPVAFALQFIGQDSLAGVISVGAITGITTVMLVMMYGQVRVSYAMSRDGLLPKR
FT                   LAKVHPKFKTPFLNTWTTGIIAALISGLIDLNVLAHLVNMGTLSAFALVAVAVIVMRRT
FT                   HPDLPRAFKAPLVPFLPALTVIFCLYLMLQLSGTAWISFGVWMVIGIAVYFLYSRKHSA
FT                   LNNSKDEDDVANL"
FT   gene            240809..242080
FT                   /locus_tag="BACI_c02740"
FT   CDS_pept        240809..242080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02740"
FT                   /product="permease; probable multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03040"
FT                   /db_xref="GOA:D8GYL2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL2"
FT                   /protein_id="ADK03040.1"
FT                   /translation="MKNTWRELREMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDKVD
FT                   SLLQVGVIMALSPIAASFGSIIGGRIADIYGRKPIMIFSMTSNALLMLGFLFIEGFIPY
FT                   AILSVFLGLSNSLFHPAASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPIMGASVVML
FT                   SKNLVFIIASSTMLFYALLVFVLIQETMPKSANKEEDNEKESGVVWKIVLRDKALMIYL
FT                   LAGIIISMGFSQTEGMLPLHFDNEMKDIFGTNNPYPYLMALNGLLVVLFQFQISKWATD
FT                   KPVGKTMLYGACLFGIGLFFIGWLPKWFGGLDTNATIILIMLLFVYAIYTLGEMIMSPV
FT                   QMTFVANLAPEHLRGTYMGAASLQWITGNAFGPLLGGFLLDRLLGHFLFTILAIGCVVA
FT                   GVVYISLDRLVEQRQKGTLTKQSS"
FT   gene            242464..243549
FT                   /gene="ddl1"
FT                   /locus_tag="BACI_c02750"
FT   CDS_pept        242464..243549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl1"
FT                   /locus_tag="BACI_c02750"
FT                   /product="D-alanylalanine synthetase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03041"
FT                   /db_xref="GOA:D8GYL3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL3"
FT                   /protein_id="ADK03041.1"
FT                   /translation="MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITE
FT                   QGQWIRGERIEGEVANVEVLKMSGAENAISPLSLSTEIIPSANAEENAIDVIFPLLHGP
FT                   NGEDGTVQGLLELMNIPYVGNGVLASAAGMDKVVMKNIFAEAGLKQAKYASFIRSGWEK
FT                   DRETAYEKVEEVLGYPCFVKPANLGSSVGINKCKNREELENAFEEAFQFDRKIIVEENI
FT                   IGREVEVGVLGNDEPKCSVVGEIVPKKDFYDYKSKYIDGDTALIIPAERTEEESNVIKR
FT                   DAIVAFQSLDGAGLTRADFFLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELI
FT                   EELIRLAMERHEEKQKIKYTI"
FT   gene            243610..244986
FT                   /gene="murF"
FT                   /locus_tag="BACI_c02760"
FT   CDS_pept        243610..244986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BACI_c02760"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /note="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03042"
FT                   /db_xref="GOA:D8GYL4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL4"
FT                   /protein_id="ADK03042.1"
FT                   /translation="MINRTLKQVEQMINGTGLAEQYEGITIQGVSIDTRKIEKGNLYVP
FT                   IQGERFDGHAFVDKAVENGAVATLWVKDVANPPENLPVIFVEDTLSALQMLAKNYRDQL
FT                   DVKVIGVTGSNGKTSTKDIVTSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVL
FT                   EMGMSSRGEIEFLSKLARPNAAIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFV
FT                   YNGDEPLLTNRVPEMNLIAETVTFGDARANDYYPTTVTLQATGTHFKMNREENISFYLP
FT                   VLGKHNVYNTLASMAIAKYFGVTWEEMKEGLVTLQMTGMRMEIVKTDSGLTIINDAYNA
FT                   SPTAMEAAFHLMNGLDGFSKKIVVLGDMLELGDQEVQFHYEVGKLIDPAKISYVFTYGK
FT                   LGAQIAEGAKINFPNERVKAYDNKEELVKELQAVVDTKDVVLVKASRGMKLEEVITMLK
FT                   "
FT   gene            245292..246878
FT                   /gene="deaD1"
FT                   /locus_tag="BACI_c02770"
FT   CDS_pept        245292..246878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD1"
FT                   /locus_tag="BACI_c02770"
FT                   /product="DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03043"
FT                   /db_xref="GOA:D8GYL5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL5"
FT                   /protein_id="ADK03043.1"
FT                   /translation="MTTFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQ
FT                   AQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPI
FT                   YGGQDINRQIRALKKHPHIIVGTPGRILDHINRKTLRLQNVETVVLDEADEMLNMGFIE
FT                   DIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTEPQHIKVKAKEVTMPNIQQFYLEV
FT                   QEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLTQAKRMS
FT                   VLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIA
FT                   MLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQRLIAEKLQSTIENENLAYYK
FT                   RIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPVVSRGGGSKKRGGNGGGYRD
FT                   GNRNRSRDGRGGDGRNRDRNRDGRNRDGNRDRNREGSRDGNRGRRGEGQGRPGSSNGRG
FT                   ERKHHSRKPQA"
FT   gene            246976..247938
FT                   /gene="uvsE"
FT                   /locus_tag="BACI_c02780"
FT   CDS_pept        246976..247938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvsE"
FT                   /locus_tag="BACI_c02780"
FT                   /product="putative UV damage endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03044"
FT                   /db_xref="GOA:D8GYL6"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL6"
FT                   /protein_id="ADK03044.1"
FT                   /translation="MLVRLGYVAMSVHLKNASPSQTMTYAQFQKIDDREAAIRKLERIA
FT                   NSNLENCLRLLKHNKGHDISFFRLSSKLIPLANHEELLEWNYIRPLKENLKVLGDYAIR
FT                   MNMRIDFHPDHFVVLNSPEENIFKQSVKTLQMHRKLLKGMGIEHKQRCVMHVGGGYKDK
FT                   ELALERFIENWSNIPRGIQEMIMLENDDTTFTLEDTLYLGEKLDIPVVFDLHHHMMNHD
FT                   REDWHEDWARVVHTWESSLLPVKMHISSPREGKDPRAHADFIDVDTFLSFLKKIKGSVP
FT                   QIDCMIEAKMKDESLFQLMRDLSEQTDVEIIDGASFYIK"
FT   gene            complement(247931..248401)
FT                   /locus_tag="BACI_c02790"
FT   CDS_pept        complement(247931..248401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02790"
FT                   /product="rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03045"
FT                   /db_xref="GOA:D8GYL7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL7"
FT                   /protein_id="ADK03045.1"
FT                   /translation="MAAYHEYIANGEWWRLITSLFVHVDLQHFLSNSICLFVLGSSIEK
FT                   QLGRFSFIIIFFLSGILGNIFSYLIMPHEYIHAGASGGIFGLLGAQLFLLYSRYRSSNP
FT                   KDIAIFSIMICILLLFTFFNPSANPISHLTGLIIGGICTPLLIKKLDGAELI"
FT   gene            248596..248955
FT                   /gene="acpS"
FT                   /locus_tag="BACI_c02800"
FT   CDS_pept        248596..248955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BACI_c02800"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03046"
FT                   /db_xref="GOA:D8GYL8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL8"
FT                   /protein_id="ADK03046.1"
FT                   /translation="MIVGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSR
FT                   LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHS
FT                   KEFAVAQVVLESSSS"
FT   gene            249049..250062
FT                   /gene="ydcC"
FT                   /locus_tag="BACI_c02810"
FT   CDS_pept        249049..250062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /locus_tag="BACI_c02810"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03047"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYL9"
FT                   /protein_id="ADK03047.1"
FT                   /translation="MKRRLFLVFVGLLTVFVLAGCMEKKQDDVVRDLEAKVKGLKSYQA
FT                   EAKLSIKTGNEPQEYKVEIWHKEPSFYRVNLQNAKKDQSQIILRNEEGVFVLTPALNKS
FT                   FRFQSDWPQNSSQAYLYESLVRDILQDKKNLTFEKTDKHYIFKTKTNYQHQNMLPRQEI
FT                   TLKKSDLTPVSVKLMDNDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAK
FT                   EDKPFAILYPRDTPQGMTLKDEKELKTDSGKRAILTYTGSKKSFTLIQEKAKVAEASSA
FT                   ISVSGELVDLGFTIGALTKDSLTWSHNGVEYMLVSKGLEPKELLMVARSVTEKQVK"
FT   gene            250181..251350
FT                   /gene="alr"
FT                   /locus_tag="BACI_c02820"
FT   CDS_pept        250181..251350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BACI_c02820"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03048"
FT                   /db_xref="GOA:D8GYM0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM0"
FT                   /protein_id="ADK03048.1"
FT                   /translation="MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAY
FT                   GHDYVPVAKTALEAGATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVA
FT                   LTVFQKEWVDEAIKLWDGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELE
FT                   GVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNA
FT                   VRIGIAMYGLSPSVEIRPFLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEW
FT                   IATVAIGYADGWLRRLQGFEVLVNGKRVPIVGRVTMDQFMIQLPCEVPLGTKVTLIGRQ
FT                   GDEYISATEVAEYSGTINYEIITTISFRVPRIFIRNGKFVEVINYLNDI"
FT   gene            251660..251947
FT                   /gene="ydcD"
FT                   /locus_tag="BACI_c02830"
FT   CDS_pept        251660..251947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcD"
FT                   /locus_tag="BACI_c02830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03049"
FT                   /db_xref="GOA:D8GYM1"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM1"
FT                   /protein_id="ADK03049.1"
FT                   /translation="MSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLL
FT                   RQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLAEYEAAHTVERLVSGG"
FT   gene            251952..252302
FT                   /locus_tag="BACI_c02840"
FT   CDS_pept        251952..252302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02840"
FT                   /product="pemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03050"
FT                   /db_xref="GOA:D8GYM2"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM2"
FT                   /protein_id="ADK03050.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVD
FT                   EALQISLGLIDF"
FT   gene            252370..254538
FT                   /locus_tag="BACI_c02850"
FT   CDS_pept        252370..254538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02850"
FT                   /product="probable transcription accessory protein, S1
FT                   RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03051"
FT                   /db_xref="GOA:D8GYM3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM3"
FT                   /protein_id="ADK03051.1"
FT                   /translation="MEMVDNRQALMKMLVKELGFTEKQVRHVIQLTEEGNTVPFIARYR
FT                   KEWTGSLDEVQIRTILERWQYIMQLEDRKEEVLRLIDEKGKLTGELRQQILKATKLQEV
FT                   EDLYRPYKEKRRTKATIAKAKGLEPLAEWLLLYTKEDPNQKAMEFINAEKEVQSAEEAL
FT                   QGAQDIIAEIVSDEAAYRSWIRNVTFRKGVMSSVVKDEEKDEKNIYEMYYDYEEPLQKV
FT                   VPHRVLAMNRGEKEDILRVSVVPPVDEIVTFLYKKVIRDNDSKSAQYVKLAIEDGYKRL
FT                   IQSSIEREIRKELTETAEEQAIHIFSENLRNLLLQPPMKGKVVLAVDPAYRTGCKLAIV
FT                   DDTGKVLYIDVIYPHPPVRKYEDAKAKVLSIIDKYQVEMIAIGNGTASRESEEFIVDVL
FT                   QNVKREVFYIIVNEAGASVYSASDLAREEFPDLQVEERSAVSIGRRLQDPLAELVKIDP
FT                   KSVGVGQYQHDVSQKRLNESLTFVVETAVNQVGVNVNTASVALLQYVSGLSKTVAKNIV
FT                   AKREEEGKFTKRTDLKKIPRLGAKTYEQCIGFLRILEGANPLDRTGIHPEQYKNIELLL
FT                   KSLGLSKDDVGQPQLQKSLEEVEISKLSEETGIGEPTLVDIIDALISPERDMRDELPKP
FT                   LLKKGILKLEDLKRGMELEGTVRNVVDFGAFVDVGVKQDGLVHISKLSKQYVKHPLDVV
FT                   SVGQIVKVWVDDIDTKKGRVALSMLPIE"
FT   gene            254908..255366
FT                   /locus_tag="BACI_c02860"
FT   CDS_pept        254908..255366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c02860"
FT                   /product="putative metallopeptidase, SprT family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03052"
FT                   /db_xref="GOA:D8GYM4"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM4"
FT                   /protein_id="ADK03052.1"
FT                   /translation="MDEQEIQRLVEEVSLQYFGMPFLHKAMFNSRLRTTGGRYLLNTHN
FT                   IELNYRYYEMYGKEELVGIVKHELCHYHLHIAGRGYKHRDKDFRELLKAVDAPRFCKRM
FT                   INEEKGKKVYMYECMECSLQYVRRRQINTKRYVCGKCKGKLILIKKTS"
FT   gene            255481..255555
FT                   /locus_tag="BACI_c02870"
FT   tRNA            255481..255555
FT                   /locus_tag="BACI_c02870"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            255560..255649
FT                   /locus_tag="BACI_c02880"
FT   tRNA            255560..255649
FT                   /locus_tag="BACI_c02880"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC"
FT   gene            255658..255732
FT                   /locus_tag="BACI_c02890"
FT   tRNA            255658..255732
FT                   /locus_tag="BACI_c02890"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            255737..255812
FT                   /locus_tag="BACI_c02900"
FT   tRNA            255737..255812
FT                   /locus_tag="BACI_c02900"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            255859..255934
FT                   /locus_tag="BACI_c02910"
FT   tRNA            255859..255934
FT                   /locus_tag="BACI_c02910"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            256022..256096
FT                   /locus_tag="BACI_c02920"
FT   tRNA            256022..256096
FT                   /locus_tag="BACI_c02920"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            256102..256174
FT                   /locus_tag="BACI_c02930"
FT   tRNA            256102..256174
FT                   /locus_tag="BACI_c02930"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            256191..256276
FT                   /locus_tag="BACI_c02940"
FT   tRNA            256191..256276
FT                   /locus_tag="BACI_c02940"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC"
FT   gene            256371..256447
FT                   /locus_tag="BACI_c02950"
FT   tRNA            256371..256447
FT                   /locus_tag="BACI_c02950"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            256452..256528
FT                   /locus_tag="BACI_c02960"
FT   tRNA            256452..256528
FT                   /locus_tag="BACI_c02960"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCA"
FT   gene            256530..256600
FT                   /locus_tag="BACI_c02970"
FT   tRNA            256530..256600
FT                   /locus_tag="BACI_c02970"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            256684..258223
FT                   /locus_tag="BACI_c02980"
FT   rRNA            256684..258223
FT                   /locus_tag="BACI_c02980"
FT                   /product="16S ribosomal RNA"
FT   gene            258377..261296
FT                   /locus_tag="BACI_c02990"
FT   rRNA            258377..261296
FT                   /locus_tag="BACI_c02990"
FT                   /product="23S ribosomal RNA"
FT   gene            261347..261461
FT                   /locus_tag="BACI_c03000"
FT   rRNA            261347..261461
FT                   /locus_tag="BACI_c03000"
FT                   /product="5S ribosomal RNA"
FT   gene            261473..261549
FT                   /locus_tag="BACI_c03010"
FT   tRNA            261473..261549
FT                   /locus_tag="BACI_c03010"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            261553..261628
FT                   /locus_tag="BACI_c03020"
FT   tRNA            261553..261628
FT                   /locus_tag="BACI_c03020"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            261803..262276
FT                   /locus_tag="BACI_c03030"
FT   CDS_pept        261803..262276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03030"
FT                   /product="P-loop hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03053"
FT                   /db_xref="GOA:D8GYM5"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM5"
FT                   /protein_id="ADK03053.1"
FT                   /translation="MSKYEITTKSSEETQKLSEKLGELVRAQDVIILEGDLGAGKTTFT
FT                   KGLAKGLGVKRVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVV
FT                   EWAHLIEAYLPNEKLQISLFHAGDDTRNIVLEPIGDRYIRLCEELLQDESTSN"
FT   gene            262257..262949
FT                   /locus_tag="BACI_c03040"
FT   CDS_pept        262257..262949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03040"
FT                   /product="putative O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03054"
FT                   /db_xref="GOA:D8GYM6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM6"
FT                   /protein_id="ADK03054.1"
FT                   /translation="MKVLAIDTSNYVMGVSLIEEGNVIGEIITNLTKNHSVRLMPAVEQ
FT                   LLKECGVKPKELTKIVVAAGPGSYTGVRIGVTAAKTLAWSLQIPIVGVSSLEVVAANGA
FT                   NFNGLICPLFDGRRGQIYTGLYTYEGEDLTSIKEDRIILIVDWLQMLKDKGKPVLFIGN
FT                   DVKLHKETIIEHLGNQAVFAPFTKNNPRPSELAFLGLQKEEQDVHSFVPSYLRLAEAET
FT                   KWLESQNK"
FT   gene            262963..263406
FT                   /gene="rimI1"
FT                   /locus_tag="BACI_c03050"
FT   CDS_pept        262963..263406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI1"
FT                   /locus_tag="BACI_c03050"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03055"
FT                   /db_xref="GOA:D8GYM7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM7"
FT                   /protein_id="ADK03055.1"
FT                   /translation="MDMIFRKMELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHY
FT                   VVLEKDGRVIGYCGLWIIIDESHITNIAILPEYRGLKLGDALLKEVISEAKTLGVKTMT
FT                   LEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWVNI"
FT   gene            263406..264422
FT                   /gene="gcP"
FT                   /locus_tag="BACI_c03060"
FT   CDS_pept        263406..264422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcP"
FT                   /locus_tag="BACI_c03060"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03056"
FT                   /db_xref="GOA:D8GYM8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM8"
FT                   /protein_id="ADK03056.1"
FT                   /translation="MEKNTIILGIETSCDETAVAVVKNGTEIIANVVASQIESHKRFGG
FT                   VVPEIASRHHVEEITVVLEEALKEANITFDDIDAIAVTEGPGLVGALLIGVNAAKAVAF
FT                   AHDIPLVGVHHIAGHIYANRLVKEVQFPLLSLVVSGGHTELVYMKEHGSFEVIGETRDD
FT                   AAGEAYDKVARTLSMPYPGGPHIDRLAHEGKPTIDLPRAWLEPDSYDFSFSGLKSAVIN
FT                   TVHNAKQRGIEIVPEDLAASFQESVIDVLVTKASRAADAYNVKQVLLAGGVAANKGLRA
FT                   RLEAEFAQKENVELIIPPLSLCTDNAAMIAAAGTIAYEQGKRATLALNANPGLDIEA"
FT   gene            complement(264843..266777)
FT                   /gene="uup"
FT                   /locus_tag="BACI_c03070"
FT   CDS_pept        complement(264843..266777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uup"
FT                   /locus_tag="BACI_c03070"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03057"
FT                   /db_xref="GOA:D8GYM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYM9"
FT                   /protein_id="ADK03057.1"
FT                   /translation="MILLQVNALSKLYGAETILANIKLEVQTKDRIALVGRNGAGKSTL
FT                   LKIIAGELSHDGGEIIKPKDVSMGYLAQNTGLETSLTIWDEMLTVFTHLQQMETKLRRL
FT                   EQEMGKEENFSNEATYERLLADYDQLQLDYKDQGGYQYEADIRSILSGLGFPVETHQTT
FT                   ISTLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIETLTWLEQYLQGYPGAILIVSHD
FT                   RYFLDKLVTQVYEISNKESRRFVGNYSKYLDLKSALYEQEMKRYEKQQDEIAKLEDFVQ
FT                   KNIARASTTKRAQSRRKQLDRMELLTRPLGDSKSASFHFDIEKQSGNDVLQVKDATIGY
FT                   DKDPIIEHVTMRLTRGDSVALVGPNGIGKSTLLKSIVNKLPLLHGDVSFGSNVSVGYYD
FT                   QEQANLTSSKRVLNELWDEYPLQPEKEIRTILGNFLFTGDDVLKSVSSLSGGQKARLAL
FT                   AKLMMQKSNLLILDEPTNHLDLNSKEILENALIDYPGTLLFVSHDRYFINRVTTTVIEL
FT                   STEGAQEYLGDYDYYVEKKNEMIERAEFEQQEQQENQAPVQKTVAPEKLNYLEEKERKK
FT                   LERQRTRKIEELEQNIVQFEEEIATLEDQLCLPEIYADYEKASEITTKKQTLQEQLDAC
FT                   MAEWEELHL"
FT   gene            266965..267594
FT                   /locus_tag="BACI_c03080"
FT   CDS_pept        266965..267594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03080"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03058"
FT                   /db_xref="GOA:D8GYN0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN0"
FT                   /protein_id="ADK03058.1"
FT                   /translation="MEQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDS
FT                   ATIRRDFSYFGALGKKGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFT
FT                   KNNNTKIEMAFDVSEEKVGTEIGGIPVYHLDELEERLSSDIQVAILTVPATVAQSVADR
FT                   LAETNVHGILNFTPARLNVSENIRIHHIDLAVELQTLVYFLKNYPQ"
FT   gene            complement(267624..267815)
FT                   /locus_tag="BACI_c03090"
FT   CDS_pept        complement(267624..267815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03090"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03059"
FT                   /db_xref="GOA:D8GYN1"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN1"
FT                   /protein_id="ADK03059.1"
FT                   /translation="MRNSPLFMAALYFLLGCIFTHLAIRNVTDTIWNMWTILFAVMATI
FT                   DFNLALRLILVKFTKKKQ"
FT   gene            complement(267812..268519)
FT                   /locus_tag="BACI_c03100"
FT   CDS_pept        complement(267812..268519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03100"
FT                   /product="putative CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03060"
FT                   /db_xref="GOA:D8GYN2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN2"
FT                   /protein_id="ADK03060.1"
FT                   /translation="MQLSSIAGLPLLLKTGLYDNRGFTREEKFQLITGHWAIISFFIAL
FT                   CIVLWLLRTDIRDRHLDTKRSTVPATIGWIFIGFFLAFFSQSIAGMIEMYVLGIKPGSE
FT                   NTARLMDIARTTPWFLIVISIIGPILEEIVFRKILFGTLYKKFNFFIAAIISSLVFAAI
FT                   HFDFTHLLVYTAMGLVFAFLYVKTKRIIVPIAAHVAMNTLVAVAQVLVSNEQIQEMIKE
FT                   AEKMQGFIGGFLV"
FT   gene            268963..269247
FT                   /gene="groES"
FT                   /locus_tag="BACI_c03110"
FT   CDS_pept        268963..269247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BACI_c03110"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03061"
FT                   /db_xref="GOA:D8GYN3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN3"
FT                   /protein_id="ADK03061.1"
FT                   /translation="MLKPLGDRVVIELVQAEEKTASGIVLPDTAKEKPQEGKVIAVGTG
FT                   RVLENGERVALEVAAGDLIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            269286..270920
FT                   /gene="groEL"
FT                   /locus_tag="BACI_c03120"
FT   CDS_pept        269286..270920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BACI_c03120"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03062"
FT                   /db_xref="GOA:D8GYN4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN4"
FT                   /protein_id="ADK03062.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGLRKGIEKAVVAAVEELKTISKPIEGKSSIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQI
FT                   KARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTSLMNVYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLE
FT                   GSVVVERLKGEKVGVGFNAATGEWVNMLETGIVDPAKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEPNAPAMPDMGGMGMGGMGGMM"
FT   gene            271206..271649
FT                   /locus_tag="BACI_c03130"
FT   CDS_pept        271206..271649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN5"
FT                   /protein_id="ADK03063.1"
FT                   /translation="MFNVFREFDKIAEELMHAAEKFRNADELYDGNLVDGSLSNEKIEA
FT                   GAMGDTPPKKSMLRKIWDGIYVGSGQVIGEIVEGFDSLDDTVTKENIKYAIGHPIETVS
FT                   TAWNTVSDSFMNDFWHGDAESRTKWGTSIFMGLGLGWIGMDWR"
FT   gene            271672..271938
FT                   /locus_tag="BACI_c03140"
FT   CDS_pept        271672..271938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03064"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN6"
FT                   /protein_id="ADK03064.1"
FT                   /translation="MTTLGIKAEQSISHFSNKLQVRDPFAYAGDFRDVPKTSFNSLEEA
FT                   RNTFMFADPGNLNTPRFQEYLSQVEEITNRKIPENQKELLQES"
FT   gene            271981..272256
FT                   /locus_tag="BACI_c03150"
FT   CDS_pept        271981..272256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03065"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN7"
FT                   /protein_id="ADK03065.1"
FT                   /translation="MRREEFNRLREDLIKEWELKTGQKWPTYEEEILSRRGRVLRRVDR
FT                   PYDAHHLVENAYGGEHEWWNIHPARYPDEHQGGIHAKDTISREIFK"
FT   gene            272280..272735
FT                   /locus_tag="BACI_c03160"
FT   CDS_pept        272280..272735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03066"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN8"
FT                   /protein_id="ADK03066.1"
FT                   /translation="MFNFLKKHIVADEGIKSNQIPILYPLPKEEIAEAEDLLKMQFPKE
FT                   LKRFYEEIGYGFLNTNRNLINRFMDPISVADFRLRQDIYEHNPNLDDTDDEESLVFFEI
FT                   TEISFLTIRFKEENELGQCPIYSENIKIADSLEEFLIKMDENPDYYI"
FT   misc_binding    273137..273238
FT                   /bound_moiety="puine"
FT                   /note="BACI_c03170; purine riboswitch, RF00167"
FT   gene            273403..274941
FT                   /gene="guaA2"
FT                   /locus_tag="BACI_c03180"
FT   CDS_pept        273403..274941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA2"
FT                   /locus_tag="BACI_c03180"
FT                   /product="bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03067"
FT                   /db_xref="GOA:D8GYN9"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYN9"
FT                   /protein_id="ADK03067.1"
FT                   /translation="MKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIK
FT                   AMNPKGIIFSGGPNSVYGEGALHCDEKIFDLGLPIFGICYGMQLMTQQFGGTVERANHR
FT                   EYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEAK
FT                   NLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLC
FT                   ALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKVDAK
FT                   ERFMNKLKGVEDPEQKRKIIGNEFIYVFDDEASKLEGMDFLAQGTLYTDIVESGTATAQ
FT                   TIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRV
FT                   LGEITEEKLEIVRESDAILREEIIKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVG
FT                   IRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSKPPATIEWE"
FT   misc_binding    275119..275155
FT                   /bound_moiety="puine"
FT                   /note="BACI_c03190; purine riboswitch, RF00167"
FT   gene            275325..276650
FT                   /locus_tag="BACI_c03200"
FT   CDS_pept        275325..276650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03200"
FT                   /product="guanine-hypoxanthine permease; xanthine/uracil
FT                   permease family protein"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03068"
FT                   /db_xref="GOA:D8GYP0"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP0"
FT                   /protein_id="ADK03068.1"
FT                   /translation="MKRYFQFDELGTNYKTEFIAGLTTFLSMAYVLFVNPATLSLGNVK
FT                   GLPAGTGMDPGAVFVATALAAAIGSLIMGIFAKYPIALAPGMGINAFFAYTAVLTMGIP
FT                   WQTAIAGTLMSGIIFIILTASGIREKIINAIPSELKFAVAAGIGLFIAFLGFQNAGIIV
FT                   KNDAVLVGLGDLTKGTTLLAIFGVVTTIIFMIKKVNGAVFYGMILTAILGVATGLIDTP
FT                   KAVVGAIPSLEPTFGAALTHFGDIFTVQMGIVIITFFFIDFFDTAGTLVAVANQAGLMK
FT                   NNKLPRAGKALFADAIATVIGAILGTSTTTSYIESSAGVAAGGRSGFTAVVTAGFFLLA
FT                   LFFSPLLSVVTPAVTAPALIIVGILMVSSLGEIDWKKFEIAVPAFFTIISMPLTYSIAT
FT                   GIAIGFIFYPITMVVSGRRKEIHPIMYVMGVLFVLYFIYVRK"
FT   gene            276795..277496
FT                   /locus_tag="BACI_c03210"
FT   CDS_pept        276795..277496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03210"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03069"
FT                   /db_xref="GOA:D8GYP1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP1"
FT                   /protein_id="ADK03069.1"
FT                   /translation="MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEE
FT                   NEVHLVVLDIMMPKVDGIHMCMKVREEKEMPIIMLSAKTQDMDKILGLTTGADDYVTKP
FT                   FNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTPREF
FT                   SILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTV
FT                   WGVGYKIEKDI"
FT   gene            277596..278984
FT                   /locus_tag="BACI_c03220"
FT   CDS_pept        277596..278984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03220"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03070"
FT                   /db_xref="GOA:D8GYP2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP2"
FT                   /protein_id="ADK03070.1"
FT                   /translation="MCVIRSFFAKGAAPFFENANRQATIDYRAGMEQINHEAQRAANSS
FT                   VHENKLEAISNMIEMENQNLERGSRALKILVTDESGKVLYKTKQAQEEQIDLHNTIRNA
FT                   ASFAINYSNGRDVFENTRKEFIAFSPITIEDKNLYMFVSGIPDGVVMYDTQEGPFPFLI
FT                   GVLVFIFSFFYITKRKMKQIEAMAEGVKEIEKGNLAYRIEKKGEDEIASLTENINNMAE
FT                   ELMNNIEKERKLEKQKNELITNVSHDLRTPLTSIMGYLRLLRDSKYENKEQHDEYTRIA
FT                   FAKSEQLKNLIEDLFEYTKLTNEQVVLEKQEVCVNELLEQLIEELVPQAEEHGLTFVKK
FT                   FPEERAYAAIDSEKMVRVFDNLLMNAIKYSKDDGEIKVSLQRQRRDIQIVIANHSEKFT
FT                   REELASLFERFYKKDQSRSRATEGSGLGLAIAKSIVELQGGSIRAEYEDGIIQFIVSLP
FT                   IIER"
FT   gene            279287..280826
FT                   /locus_tag="BACI_c03230"
FT   rRNA            279287..280826
FT                   /locus_tag="BACI_c03230"
FT                   /product="16S ribosomal RNA"
FT   gene            280980..283899
FT                   /locus_tag="BACI_c03240"
FT   rRNA            280980..283899
FT                   /locus_tag="BACI_c03240"
FT                   /product="23S ribosomal RNA"
FT   gene            283950..284064
FT                   /locus_tag="BACI_c03250"
FT   rRNA            283950..284064
FT                   /locus_tag="BACI_c03250"
FT                   /product="5S ribosomal RNA"
FT   gene            284588..284896
FT                   /locus_tag="BACI_c03260"
FT   CDS_pept        284588..284896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03260"
FT                   /product="probable UDP-glucose 4-epimerase, N-terminal
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03071"
FT                   /db_xref="GOA:D8GYP3"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP3"
FT                   /protein_id="ADK03071.1"
FT                   /translation="MGKNNYLIVGGNSFIGINLALGLLKQGQNKKVFSRHINKFPQNII
FT                   SEVEFIKGDLANVDIIIYLAATFNVATSIEDVFRDRNSSFFFNFMEIVKNFLLKKLY"
FT   gene            285197..285487
FT                   /locus_tag="BACI_c03270"
FT   CDS_pept        285197..285487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03270"
FT                   /product="probable UDP-glucose 4-epimerase, C-terminal
FT                   region"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03072"
FT                   /db_xref="GOA:D8GYP4"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP4"
FT                   /protein_id="ADK03072.1"
FT                   /translation="MEVTIQLSQFNHLNSCVYNIGSGKGLPLKRIIVELEKLTERKVDF
FT                   ICYKQKQENVQKIILNIDRVRRECNWEPKVDFKSGIRLNKLWIEEFLYSIK"
FT   gene            286605..288144
FT                   /locus_tag="BACI_c03280"
FT   rRNA            286605..288144
FT                   /locus_tag="BACI_c03280"
FT                   /product="16S ribosomal RNA"
FT   gene            288298..291217
FT                   /locus_tag="BACI_c03290"
FT   rRNA            288298..291217
FT                   /locus_tag="BACI_c03290"
FT                   /product="23S ribosomal RNA"
FT   gene            291269..291383
FT                   /locus_tag="BACI_c03300"
FT   rRNA            291269..291383
FT                   /locus_tag="BACI_c03300"
FT                   /product="5S ribosomal RNA"
FT   misc_binding    291878..291979
FT                   /bound_moiety="puine"
FT                   /note="BACI_c03310; purine riboswitch, RF00167"
FT   gene            292090..292575
FT                   /gene="purE"
FT                   /locus_tag="BACI_c03320"
FT   CDS_pept        292090..292575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BACI_c03320"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03073"
FT                   /db_xref="GOA:D8GYP5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP5"
FT                   /protein_id="ADK03073.1"
FT                   /translation="MKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDY
FT                   MFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIKKDVREGSELV"
FT   gene            292572..293723
FT                   /gene="purK"
FT                   /locus_tag="BACI_c03330"
FT   CDS_pept        292572..293723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BACI_c03330"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03074"
FT                   /db_xref="GOA:D8GYP6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP6"
FT                   /protein_id="ADK03074.1"
FT                   /translation="MTRIILPGKTIGIIGGGQLGRMMALVAKEMGYKIAVLDPTKHSPC
FT                   AQVADIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQLLSKT
FT                   QNRFTEKNAIEKAGLPVATYRLVQNQEQLTEAIAELSYPSVLKTTTGGYDGKGQVVLRS
FT                   EADVDEARKLANVAECILEKWVPFEKEVSVIVIRSVSGETKVFPVAENIHVNNILHESI
FT                   VPARITEELSQKAIAYAKVLADELELVGTLAVEMFATADGEIYINELAPRPHNSGHYTQ
FT                   DACETSQFGQHIRAICNLPLGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGK
FT                   EEAKAQRKMGHVNILNDNIEVALEKAKSLHIWDHQEQLLEGKR"
FT   gene            293720..295027
FT                   /gene="purB"
FT                   /locus_tag="BACI_c03340"
FT   CDS_pept        293720..295027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BACI_c03340"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03075"
FT                   /db_xref="GOA:D8GYP7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP7"
FT                   /protein_id="ADK03075.1"
FT                   /translation="MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDV
FT                   KKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWVHYGLTSTDVVDTAL
FT                   SYILKQANEIILKDLANFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEM
FT                   KRNVERFKQAANTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHA
FT                   HYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTG
FT                   LARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYP
FT                   ENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADE
FT                   RITSKLTQEEINECFNYEHHMQHVDTIFERLGLNEA"
FT   gene            295116..295835
FT                   /gene="purC"
FT                   /locus_tag="BACI_c03350"
FT   CDS_pept        295116..295835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BACI_c03350"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamidesynthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03076"
FT                   /db_xref="GOA:D8GYP8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP8"
FT                   /protein_id="ADK03076.1"
FT                   /translation="MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITG
FT                   KGRLNNEITTLLFRKLQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKR
FT                   LGMEEGTVLAEPIVEFYFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLI
FT                   DHFASCRVRLVDFKLEFGVTDEGAIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNL
FT                   TDAYEEILKRLGGISHV"
FT   gene            295828..296082
FT                   /gene="purS"
FT                   /locus_tag="BACI_c03360"
FT   CDS_pept        295828..296082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BACI_c03360"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03077"
FT                   /db_xref="GOA:D8GYP9"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYP9"
FT                   /protein_id="ADK03077.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMEL
FT                   TIDKSVSDLDSKVKEMCEKLLANVVMEDFRYEVEEVVAQ"
FT   gene            296079..296762
FT                   /gene="purQ"
FT                   /locus_tag="BACI_c03370"
FT   CDS_pept        296079..296762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BACI_c03370"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03078"
FT                   /db_xref="GOA:D8GYQ0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ0"
FT                   /protein_id="ADK03078.1"
FT                   /translation="MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAI
FT                   LLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMR
FT                   NENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPIAHGEGNYYCDEETLKQLEENNQI
FT                   AFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRET
FT                   YVVNA"
FT   gene            296746..298965
FT                   /gene="purL"
FT                   /locus_tag="BACI_c03380"
FT   CDS_pept        296746..298965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BACI_c03380"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03079"
FT                   /db_xref="GOA:D8GYQ1"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ1"
FT                   /protein_id="ADK03079.1"
FT                   /translation="MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDG
FT                   IHGATFASEELSESSEAKRPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGMGIEMYLDDVPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEK
FT                   YGLAAVTMGKVTEDKMLRLFHKGEMVAEVPADALAEEAPIYHKPSKEAAYFAEFQQMKM
FT                   ETPKVENYKETLFALLQQPTIASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGL
FT                   AMTTDCNSRYIYLDPEVGGKIAVAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIE
FT                   KSVDGMSEACRTLQTPVIGGNVSMYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQA
FT                   GDLVYVIGETKAEFGGSELQKMLHGKIFGQSPSIDLDVELKRQKQVLAAIQAGLVQSAH
FT                   DVAEGGLAVAISESAIGANGLGATVKLDGEATAALFAESQSRFVITVKRENKEAFEKAV
FT                   EAIQVGEVTNTNEVTIHNEENEVLLTANVDEMRQAWKGAIPCLLK"
FT   gene            298950..300365
FT                   /gene="purF"
FT                   /locus_tag="BACI_c03390"
FT   CDS_pept        298950..300365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BACI_c03390"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03080"
FT                   /db_xref="GOA:D8GYQ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ2"
FT                   /protein_id="ADK03080.1"
FT                   /translation="MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIV
FT                   VNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSD
FT                   HSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEALNK
FT                   VKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPG
FT                   ELLIINDEGIHVDRFTNEVDHAICSMEYIYFARPDSNIAGINVHAARKNMGKRLAAEAP
FT                   IEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQ
FT                   TRKELIAANHTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTA
FT                   LYDYEQELLESMK"
FT   gene            300472..301512
FT                   /gene="purM"
FT                   /locus_tag="BACI_c03400"
FT   CDS_pept        300472..301512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BACI_c03400"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03081"
FT                   /db_xref="GOA:D8GYQ3"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ3"
FT                   /protein_id="ADK03081.1"
FT                   /translation="MANAYKQAGVDIEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMF
FT                   DLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDK
FT                   KKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLDRIYGRLELPLGEELL
FT                   KPTKIYVKPILELLKNHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWKIQPIFSL
FT                   LQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDIVRLLEEQGETARIIGRTVQGAGVTF
FT                   NGGKAL"
FT   gene            301509..302096
FT                   /gene="purN"
FT                   /locus_tag="BACI_c03410"
FT   CDS_pept        301509..302096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BACI_c03410"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03082"
FT                   /db_xref="GOA:D8GYQ4"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ4"
FT                   /protein_id="ADK03082.1"
FT                   /translation="MSRLAVFASGSGSNFQSLVNAVEEKRLDAEISLLVCDKPEARAVG
FT                   RANYHHIPCFAFSAKAYESKEAFEKEILNKLEEYEIDYVILAGYMRLIGPTLLEAYGGR
FT                   IINIHPSLLPSFPGKDAVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTR
FT                   ESLQKKIQQVEHKLYVNTVNQIVQSTKEPTVN"
FT   gene            302121..303656
FT                   /gene="purH"
FT                   /locus_tag="BACI_c03420"
FT   CDS_pept        302121..303656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BACI_c03420"
FT                   /product="bifunctionalphosphoribosylaminoimidazolecarboxam
FT                   ide formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03083"
FT                   /db_xref="GOA:D8GYQ5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ5"
FT                   /protein_id="ADK03083.1"
FT                   /translation="MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEKNGLQ
FT                   VIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVAQMNELGMEPIDFVIVNLYP
FT                   FKETIAKPDVTFADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDVVLAELKESGEV
FT                   KEETKRKLAAKVFRHTAAYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKA
FT                   TFYKAPFAVTSSVAYAEQLHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVG
FT                   VGTDIHEAYTRAYEADPVSIFGGIIAANREIDKATAEKLHEIFLEIIIAPSFSKEALEV
FT                   LQSKKNLRLLTVNIEKATSASKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSEQEW
FT                   KDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASD
FT                   AFFPMPDTVEEAAKAGITAIIQPGGSIRDEDSIKVADTYGIAMVFTGVRHFKH"
FT   gene            303922..305193
FT                   /gene="purD"
FT                   /locus_tag="BACI_c03430"
FT   CDS_pept        303922..305193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BACI_c03430"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03084"
FT                   /db_xref="GOA:D8GYQ6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ6"
FT                   /protein_id="ADK03084.1"
FT                   /translation="MNVLVIGRGGREHALAWKFAQSEKVEKVYVAPGNEGMRDVATPID
FT                   IDENDFDALVLFAKENHVELTFVGPEIPLMNGIVDRFKEEGLRVFGPNKAAAVIEGSKA
FT                   FTKELMKKYNIPTAAYETFTDYEEAVQYIEKVGAPIVIKADGLAAGKGVTVAMTLEEAL
FT                   QAAKEMLQDVKFGEASKKIVIEEFLDGQEFSLMAFVNGTTVHPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQISESAVQEAIETVLHPTAKAMIQENRSFTGILYAGLILTNDGPKV
FT                   IEFNARFGDPETEVVLPRLENDLVDVCNAVLDESELTLQWSEESVIGVVLASKGYPEAY
FT                   KKGDIIKGLDALQDVIVFHAGTAMKHGDFVTNGGRVLFVTCKANSLQEAKDTVYKEIGK
FT                   IESDGLFYRSDIGYRAIGHEMTRN"
FT   gene            complement(305231..305395)
FT                   /locus_tag="BACI_c03440"
FT   CDS_pept        complement(305231..305395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03085"
FT                   /db_xref="GOA:D8GYQ7"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ7"
FT                   /protein_id="ADK03085.1"
FT                   /translation="MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQK
FT                   GKLKKDKDA"
FT   gene            complement(305412..306257)
FT                   /locus_tag="BACI_c03450"
FT   CDS_pept        complement(305412..306257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03450"
FT                   /product="band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03086"
FT                   /db_xref="GOA:D8GYQ8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ8"
FT                   /protein_id="ADK03086.1"
FT                   /translation="MKEKQVFYVNGFLGIIGILILAAIGVFFLVQEIFIGAALTIILAA
FT                   VLATGIGIVQPNQAKVITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVN
FT                   DVDGNPIEIAAVIVYKVVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETC
FT                   ITLRGNTEEISEELKRELEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAA
FT                   RKEIVEGAVKMAKDSIHMLDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
FT                   "
FT   gene            complement(306467..306844)
FT                   /locus_tag="BACI_c03460"
FT   CDS_pept        complement(306467..306844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03460"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03087"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYQ9"
FT                   /protein_id="ADK03087.1"
FT                   /translation="MKQNIGTINALIRITLGLVLFGCSATKLVRKPWCTWSNILLWIGA
FT                   MKVAEGIVRFCPVVEMWKFGKYMNMGAFKMPSMNFAEKGHTKEEVNQTSNHDKPQSNGS
FT                   YDASDKEIESAIEDIILAKPL"
FT   gene            306910..307107
FT                   /locus_tag="BACI_c03470"
FT   CDS_pept        306910..307107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03088"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR0"
FT                   /protein_id="ADK03088.1"
FT                   /translation="MIFGICNPTFDVEKDVGLCVCVSSFFCYNERMHKRKFKSKSSRLK
FT                   NVEEEIPNLILRFKQIFKMK"
FT   gene            307180..307869
FT                   /locus_tag="BACI_c03480"
FT   CDS_pept        307180..307869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03480"
FT                   /product="PcrB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03089"
FT                   /db_xref="GOA:D8GYR1"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR1"
FT                   /protein_id="ADK03089.1"
FT                   /translation="MYDISGWKHVFKLDPNKELSDEHLEMICESGTDAVIVGGSDGVTI
FT                   DNVLHMLVSIRRYAVPCVLEVSDVEAITPGFDFYYIPSVLNSRKVEWVTGVHHEALKEF
FT                   GDIMDWDEIFMEGYCVLNPEAKVAQLTDAKCDVTEDDVIAYARLADKLLRLPIFYLEYS
FT                   GTYGDVELVKNVKAELKQAKLYYGGGISNAEQAEEMAQHADTVVVGNIIYDDIKAALKT
FT                   VKAVKGE"
FT   gene            307882..310125
FT                   /gene="pcrA1"
FT                   /locus_tag="BACI_c03490"
FT   CDS_pept        307882..310125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA1"
FT                   /locus_tag="BACI_c03490"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03090"
FT                   /db_xref="GOA:D8GYR2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR2"
FT                   /protein_id="ADK03090.1"
FT                   /translation="MSMTDRLLNGLNPQQQKAVQTTNGPLLLMAGAGSGKTRVLTHRIA
FT                   YLLGEKGVAPWNVLAITFTNKAAREMRERIDTLVGPEAEDIWISTFHSMCVRILRRDID
FT                   RIGINRNFTILDSGDQLTVVKKIMKERNIDPKKFEPRSILAGISNAKNELLSADKYAKK
FT                   ITIADPYEKLTSDVYTEYQKRLLKNNSLDFDDLIMTTIQLFERVPEVLEFYQRKFQYIH
FT                   VDEYQDTNKAQYLLVKHLAARFKNLCVVGDSDQSIYRWRGADISNILSFEKDYENAQVI
FT                   LLEQNYRSSQNILNAANAVIERNTNRKPKKLWTDNEVGSKISYYRAATEKDEAYFVAKK
FT                   IRDDIQMGKRKYTDFAVLYRTNAQSRMVEEIFLKSNIPYKIVGGTKFYDRKEIKDILAY
FT                   LRLIGNPDDEISFARIINVPKRGIGATSIDKIINYGVQNGISLTAVFDEIEHVGVSAKV
FT                   TKAVKEFAGLLHNWVNMQEYLSVTELVEEVIEKTGYRDMLKNERTLEAEGRLENLDEFL
FT                   SVTQTFESQSEDKSLVAFLTDLALVADIDRVDEDPTAGEEVILMTMHSAKGLEFPVVFI
FT                   VGLEEGIFPHTRSLMEEDEMQEERRLAYVGITRAEEELYLSNAQMRTLFGRTSMNAASR
FT                   FITEIPTELVESLNETAPKRETSFSAKGRVASSSKTTTTTRSRSAFARPAAKTTGGEQI
FT                   GWAVGDKASHQKWGVGTVVSVKGEGDAKELDIAFPSPIGVKRLLAKFAPVTKQ"
FT   gene            310141..312150
FT                   /gene="ligA"
FT                   /locus_tag="BACI_c03500"
FT   CDS_pept        310141..312150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BACI_c03500"
FT                   /product="DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03091"
FT                   /db_xref="GOA:D8GYR3"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR3"
FT                   /protein_id="ADK03091.1"
FT                   /translation="MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELI
FT                   KLEAENPEFMSEDSPSVRVGGTVLDIFEKVTHKSPMLSLGNAFNEGDLRDFDRRVRQGI
FT                   DDANVRYICELKIDGLAVSLHYEKGRFIQGATRGDGVTGEDITQNLKTIKAIPLRLNEE
FT                   VTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAAGSIRQLDPKIAAKRNLSMFV
FT                   YGLANVEEKTIPSHSESLDFLGELGFKTNPNRRTCETIEEVIAYVEEWQEKRPHLDYEI
FT                   DGIVIKVDDVALQESLGTTAKSPRWAIAYKFPAEEVVTRLTGIELSVGRTGVVTPTAEL
FT                   EPVRVAGTIVRRASLHNEDLIREKDIRIGDYVVVKKAGDIIPEVVNVIFDKRTGEEEEY
FT                   HMPTHCPVCESELVRLEEEVALRCINPTCPAQIREGLIHFVSRNAMNIDGLGERVITQL
FT                   FDADYIRTFADLYSLTKEQLLQLERFGEKSATNLVQAIENSKENSLERLLFGLGIRHVG
FT                   AKAARTFAEHFETMDALVKATEEELKAINEIGEKMAQSVVAYFDNEDVLELLQQFKEYG
FT                   VNMTYKGIKIADLQNVESYFAGKTVVLTGKLEVMGRSEAKKKIEALGGKVTGSVSKSTD
FT                   LVVAGEAAGSKLAQAEKHNVEVWNEERFLQELNK"
FT   gene            312167..313360
FT                   /locus_tag="BACI_c03510"
FT   CDS_pept        312167..313360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03510"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03092"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR4"
FT                   /protein_id="ADK03092.1"
FT                   /translation="MKKIALAVLSLGLLVSGCSAGADKDEKVVEKSGKAKEQVIVPNYS
FT                   ISDEYYKTTIPFEGGNARGLVVQGVSNRLDIDEFETGLMRIAKESFSTKDNVLKGGKSL
FT                   TTQYIQMLVKRKRTDAEQKELEDTLKKDAVKFPNIGLNPALGAGSESLEAKNKKNPIYI
FT                   SNILEHDYYVNKDKKDERSGIVVGLAMNSVHYYEEEHGYPREAAISNEKMLAEGKKMVP
FT                   EILKVMHQEDPETKNLPITFAIYRQAPKSSLVPGNFVSYGNVEKGSETVEDWKQINEKY
FT                   YLFPSEQAKTDNKREDLARVSNFKAKLSDYFQGDYTAVIGTGMYRDDELREIKLDIPVQ
FT                   FNGKAEIIGFTQYVAGLVMEYFPNYMKVQVTIKSVERPEAIIIREAKQDEPYVKILD"
FT   gene            313456..314226
FT                   /locus_tag="BACI_c03520"
FT   CDS_pept        313456..314226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03520"
FT                   /product="possible integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03093"
FT                   /db_xref="GOA:D8GYR5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR5"
FT                   /protein_id="ADK03093.1"
FT                   /translation="MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPA
FT                   SAIATNKLAATMGTFTSAIYFIRSGKVDFKIVGKLIPLTVIGAVAGALVVKFIPPDILR
FT                   PLVLVMLVFIAIYIIAKKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFL
FT                   IFAFLLIGLDFIQAAASGKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMIFGAYFGS
FT                   KFAVQKGVGYVRALFLLVTILLISKNVLEYTHIL"
FT   gene            314380..315927
FT                   /gene="rocA"
FT                   /locus_tag="BACI_c03530"
FT   CDS_pept        314380..315927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocA"
FT                   /locus_tag="BACI_c03530"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03094"
FT                   /db_xref="GOA:D8GYR6"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR6"
FT                   /protein_id="ADK03094.1"
FT                   /translation="MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEK
FT                   ITTEDKIVSVNPANKEELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
FT                   AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIE
FT                   YNRFSYIPLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLE
FT                   EAGLPAGVVNFVPGNGSEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVNPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRA
FT                   VELTKELTVANPAVLGTNMGPVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQ
FT                   PTIVADVAEDARLMKEEIFGPVVAFCKAKDFDHALAIANNTEYGLTGAVISNNRDHIEK
FT                   AREDFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL"
FT   gene            316113..316262
FT                   /locus_tag="BACI_c03540"
FT   CDS_pept        316113..316262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03095"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR7"
FT                   /protein_id="ADK03095.1"
FT                   /translation="MGKYQLDYKGQVAVAKFHEKQTPVKFDKKQQIEKLRAEYLKKKQK
FT                   QTDK"
FT   gene            complement(316494..317057)
FT                   /locus_tag="BACI_c03550"
FT   CDS_pept        complement(316494..317057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03550"
FT                   /product="NAD(P)+ dependent isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="isochorismatase hydrolase, 2,3 dihydro-2,3
FT                   dihydroxybenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03096"
FT                   /db_xref="GOA:D8GYR8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR8"
FT                   /protein_id="ADK03096.1"
FT                   /translation="MKTALLLVDIQNDYFPHGKMELRNPAEASAYASQLLQLFRKKNEP
FT                   IFHIQHISIKEDATFFLPNTEGVHIHESVRPLREESVILKHYPNSFRETDLLKQLQCLA
FT                   IEHVVICGMMTHMCIDATVRAAFDFGLQCTVIHDACATKDLSFKNATIPAVYIHNTILA
FT                   SLNGVYANVMSTEEFLATKKHSLQ"
FT   misc_binding    317300..317406
FT                   /bound_moiety="SAM"
FT                   /note="BACI_c03560; SAM riboswitch, RF00162"
FT   gene            317530..318549
FT                   /locus_tag="BACI_c03570"
FT   CDS_pept        317530..318549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03570"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03097"
FT                   /db_xref="GOA:D8GYR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYR9"
FT                   /protein_id="ADK03097.1"
FT                   /translation="MISFNNVSKVYESGGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKS
FT                   TLLRLVNMLERPTAGTISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIA
FT                   YPLKLAKVPKNEIKERVNELLKFVGLEDKANNYPEQLSGGQKQRVGIARALATSPDILI
FT                   CDEATSALDPETTTEILNLLKKVNREYNLTILLITHKMHVVKEICHRVAVMEKGKVIEE
FT                   GKLFDVFTQPKTKTTQNFVRSVINDHLPESVLAKIQNGGQIYRLTFTGEETGQPVLSYI
FT                   AKNYNVDVNVLYGNIIELQNVLFGNLLVELQGEQREIQKALQHLRLQVQLKEVEAHAS"
FT   gene            318539..319204
FT                   /locus_tag="BACI_c03580"
FT   CDS_pept        318539..319204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03580"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03098"
FT                   /db_xref="GOA:D8GYS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS0"
FT                   /protein_id="ADK03098.1"
FT                   /translation="MRVDWSIFWPRILDATGDTLLMVIVTLIFATILGIPLGLLLYVTR
FT                   KGNFLENKWVFSILNIIINTIRPVPFIIFLVALSPLTRSVIGTTIGTAAAIFPMTLVAS
FT                   IGIARMVETNLVSVPKGVIEAAQAMGASPIRIVFEILVPEALAPLILGVTFMTVGLIEF
FT                   SAVAGLVGGGGLGDLAMTYGYQRFDTSVMFVTVVLLIILVQIAQNLGNYFAKVLLRRS"
FT   gene            319226..320080
FT                   /locus_tag="BACI_c03590"
FT   CDS_pept        319226..320080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03590"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03099"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS1"
FT                   /protein_id="ADK03099.1"
FT                   /translation="MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGD
FT                   AWEILKRKAEKEGIKIKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDIT
FT                   AVGTTQIAPMGLYSEKYKKANEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGL
FT                   FGDPSGIAENPKKLKITPVIAQQTPRVLKDVAASVINNGVAGQAGLDPAKDPIFLEDPK
FT                   NENAKPYINIFAARTKDKDDPTLKKVIELYHSKEVTDAIKKETNDGSISVDLSLDELEK
FT                   IVK"
FT   gene            complement(320256..320720)
FT                   /locus_tag="BACI_c03600"
FT   CDS_pept        complement(320256..320720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03100"
FT                   /db_xref="GOA:D8GYS2"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS2"
FT                   /protein_id="ADK03100.1"
FT                   /translation="MKRISTIIFWIIPLLFFIHNLEESFQMPQYLANQFSITFITSQHF
FT                   FIAISVLTLFVLVIIFLYQLNFLSSIYWIIFIQGAIFFNSVQHIILFFIYRSYNPGVIS
FT                   AVFIVIFSIFFFSSQKHLIHKKQFVITLVFSLFSYPIIIWITLLLASCFQ"
FT   gene            complement(320782..320973)
FT                   /locus_tag="BACI_c03610"
FT   CDS_pept        complement(320782..320973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03101"
FT                   /db_xref="InterPro:IPR025076"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS3"
FT                   /protein_id="ADK03101.1"
FT                   /translation="MHEELLRKIIRTKIKVGMHILEELPAPIQQSAKQMLNILQEELSS
FT                   YPNEQGHHKNNLKNIIIE"
FT   gene            complement(320966..321298)
FT                   /gene="arsA"
FT                   /locus_tag="BACI_c03620"
FT   CDS_pept        complement(320966..321298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="BACI_c03620"
FT                   /product="anion-transporting ATPase, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03102"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS4"
FT                   /protein_id="ADK03102.1"
FT                   /translation="MFEQEVVGLPMLERVGDALFKTEHCPTEVKFNGRTQYVKKDGDEY
FT                   IFVLSIPFSNKSELTLNQKGDELIIRAGSVKRNITLPKTLTHLSIQGAKFEEDVLNIRF
FT                   GGVVHA"
FT   gene            complement(321371..322147)
FT                   /gene="arsA'"
FT                   /locus_tag="BACI_c03630"
FT   CDS_pept        complement(321371..322147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA'"
FT                   /locus_tag="BACI_c03630"
FT                   /product="anion-transporting ATPase, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03103"
FT                   /db_xref="GOA:D8GYS5"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS5"
FT                   /protein_id="ADK03103.1"
FT                   /translation="MMRIILYTGKGGVGKTSISAATALQSAKQGLKTLVMSTDPAHSLG
FT                   DSFGVKLSSEPLEIRENLWAQEINTIYEMEKGWGKLQKYITLLFTSKAADDITTEELTM
FT                   FPGMEDLISLLRVLDYYKQNTYDVIIIDCAPTGETLAMLSFPDMLGWWMEKLFPIKRKV
FT                   LKVVRPVAQPLLGVPLPTDDIMDELTNTLEQLGEMRDILSNREVTSIRIVVNPEKMVIK
FT                   EAQRSFTYLNLYDYNVDAIMINRVIPNTVTDPYFQA"
FT   gene            complement(322224..322706)
FT                   /locus_tag="BACI_c03640"
FT   CDS_pept        complement(322224..322706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03640"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03104"
FT                   /db_xref="GOA:D8GYS6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS6"
FT                   /protein_id="ADK03104.1"
FT                   /translation="MLQYEHFLDLLLDNAKKLFYPEEWVSLDLTLSKTEVFCLLWMERN
FT                   MDITMTKIADLLDIPMSTTTGVVNRLVKKGYIERYRDENDRRIVLIRLTENGVILVQEV
FT                   KQNAAHYFNLVTEALSEEEKAFLLQIFQKIMNHIATSQQKTEEKVSTPKMKNIPIE"
FT   gene            322929..323165
FT                   /locus_tag="BACI_c03650"
FT   CDS_pept        322929..323165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03650"
FT                   /product="phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03105"
FT                   /db_xref="GOA:D8GYS7"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS7"
FT                   /protein_id="ADK03105.1"
FT                   /translation="MRRRNTQAFTFLAWTSFVCALSGMLIGIYTLDETLSVKGYYLIGT
FT                   LFLTMSCFVLQKTIRDNEEDNERFPKNKPSDKE"
FT   gene            323307..323597
FT                   /gene="gatC"
FT                   /locus_tag="BACI_c03660"
FT   CDS_pept        323307..323597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BACI_c03660"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03106"
FT                   /db_xref="GOA:D8GYS8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS8"
FT                   /protein_id="ADK03106.1"
FT                   /translation="MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNEL
FT                   DTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE"
FT   gene            323613..325070
FT                   /gene="gatA1"
FT                   /locus_tag="BACI_c03670"
FT   CDS_pept        323613..325070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA1"
FT                   /locus_tag="BACI_c03670"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03107"
FT                   /db_xref="GOA:D8GYS9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYS9"
FT                   /protein_id="ADK03107.1"
FT                   /translation="MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLT
FT                   LDEENARAKAKELDAKIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDA
FT                   TVVQKLKDADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAA
FT                   GEVLFSLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDN
FT                   AYLLQAISGLDRMDATSANVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLA
FT                   ALKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLMD
FT                   LYKNTRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVII
FT                   GPTTPTPAFKVGEKVDDPMTMYANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGK
FT                   HFDEATIYRVAHAFEQATDHHTKKASL"
FT   gene            325085..326512
FT                   /gene="gatB"
FT                   /locus_tag="BACI_c03680"
FT   CDS_pept        325085..326512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BACI_c03680"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03108"
FT                   /db_xref="GOA:D8GYT0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT0"
FT                   /protein_id="ADK03108.1"
FT                   /translation="MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYP
FT                   GVLPTLNKEAVNFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGKKKRIGITRLHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEA
FT                   YAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQK
FT                   GLEHEQVRQEKELLSGGIIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYID
FT                   DAWKEEVRASIPELPDARKARYVAEIGLPAYDAHVLTLTKEMSDFFEAAIADGADAKLT
FT                   SNWLMGEVLAYLNKQQKELKDVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGD
FT                   PEEIVKAKGLVQISDEGTLRKVVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPLVNKILLEEINKR"
FT   gene            326984..327889
FT                   /locus_tag="BACI_c03690"
FT   CDS_pept        326984..327889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03690"
FT                   /product="conserved hypothetical diacylglycerol kinase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03109"
FT                   /db_xref="GOA:D8GYT1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT1"
FT                   /protein_id="ADK03109.1"
FT                   /translation="MMKRARIIYNPTSGRELFKKSLPEVLQKLEQAGYEASCHATTGPG
FT                   DATVAARQAVERKFDVVIAAGGDGTLNEVVNGLVGHEHRPKFGIIPVGTTNDFARAIGV
FT                   PRSIEEAADIICEGKTVPLDLGRANDTYFINIAGGGRITELTYEVPSKLKTVLGQLAYY
FT                   LKGIEMLPSLHPTYVEIEYDGKLLQEEITMFLITNTRSVGGFEKVAPYASINDGLFDLL
FT                   VLKKGSIADLIKAATQAQRGEHINNPKVLYTQANRIKVHSPDKLMINLDGEYGGDAPME
FT                   FENIYHCLELFVPEHQEDAL"
FT   gene            328029..328772
FT                   /locus_tag="BACI_c03700"
FT   CDS_pept        328029..328772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03700"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03110"
FT                   /db_xref="GOA:D8GYT2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT2"
FT                   /protein_id="ADK03110.1"
FT                   /translation="MEKVKAILFDKDGTLMDFHSIWIKVAEELVAECINLYELPKSMQP
FT                   TLLKEIGVEGVFVNPRSAIAAGTSLDVAKGLCKYITSSKEEEMHEWVSEKLFSLMYEHR
FT                   SYMKMTADLPRILQSLKDRGFILGVVTADDFAPTELFLKQYQLESFFDYVVASDTFPAQ
FT                   KPDKRIVESFCDKFHLDACEVAVVGDTPTDLHLAKNGDCFAIGVLSGTGDRQTLEPLAD
FT                   LVVQSVGDFISHSGEFIWERGKSNV"
FT   gene            328855..330291
FT                   /gene="gabT"
FT                   /locus_tag="BACI_c03710"
FT   CDS_pept        328855..330291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BACI_c03710"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03111"
FT                   /db_xref="GOA:D8GYT3"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT3"
FT                   /protein_id="ADK03111.1"
FT                   /translation="MEKNVGIHFAIKRENNVKKRMGYVMNTKKFAKVNEQIPGPKAASL
FT                   LERRQNIVPKGVSNGIPTFVQSANGALVTDVDGNQYIDFAGAIGTINVGHCHPAVKEAL
FT                   HKQVDQYIHTGFNVMMYEPYIELAEKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKY
FT                   TKRPGIIAFSKGFHGRTLMTMTMTSKVKPYKFGFGPFAPEVYKAPFPYEYRRPEGLTEE
FT                   QYDDFMIEEFKNFFISEVAPETIAAVVMEPVQGEGGFIVPSKKFVQEVRNICSEHGILF
FT                   VADEIQTGFSRTGKYFAIDHYDVVPDLITVSKSLGAGVPISGVIGRKEIMNESAPGELG
FT                   GTYAGSPLGCAAALAVLDVIEKENLNDRAIELGKVVMNRFEEMKNKYNCIGDVRGLGAM
FT                   CAFELVQDRKTKTPDKTLTANLCTEANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEG
FT                   LTIIEESLQICYEKANTARV"
FT   gene            330404..331771
FT                   /locus_tag="BACI_c03720"
FT   CDS_pept        330404..331771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03720"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03112"
FT                   /db_xref="GOA:D8GYT4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT4"
FT                   /protein_id="ADK03112.1"
FT                   /translation="MVAEKERVLMDLQDVFEYAFDEIFVTDDKGIVVRVNSTCERHYQI
FT                   AAKELVGKHVKELQKDGIFYPSATLEVIEKKRPIELVQTTKSGEYLHVRTRPVFDDEGN
FT                   LRRVISYSRDLTELYQLRQKVEEMDNQLKTYKKELRETYEHEGLIFKSIAMQKIIETIK
FT                   KVSVVDSTVLVLGETGVGKSRLVRHLHEMSNRKNESFYEINCAALPTNLIESELFGYSG
FT                   GSFTGANREGKKGLLESAHKGTLFLDEIGEMPLEIQAKLLQVLQEKTFRPIGGRELKKV
FT                   DVRIVAATNRDLSMMVKQGTFRKDLYYRLNVIPILIPPLRERTEDILPLIYHYLQHFNE
FT                   KYGRNVKLAPSTLQMFVGYPWEGNNREIENVIERIVITADDIVTIEDLPIAMQESTVEQ
FT                   SGQSLYKMLEEVERNIILKAYKTYGSSYKVAEFLKISQSAATRKIKKLIEEEENIG"
FT   gene            331764..333215
FT                   /gene="gadD"
FT                   /locus_tag="BACI_c03730"
FT   CDS_pept        331764..333215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gadD"
FT                   /locus_tag="BACI_c03730"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03113"
FT                   /db_xref="GOA:D8GYT5"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT5"
FT                   /protein_id="ADK03113.1"
FT                   /translation="MDKKATFVNVEKKAMYINGEWITLQEQIEVNNPATKEIFATVPKG
FT                   GVTEAKQAVDAAHEAFKSWSKLTAADRAAKLKKWFTLIDENKEEIAAIMTKEQGKPFAE
FT                   ALGEVNYANSFVEWYAEEGKRVYGEMIPASHPNKRILVMKQPVGVMAAITPWNFPAAMI
FT                   TRKVAPALAAGCTAVVKPASQTPLTALKLAELAHEADIPKGVINIVTGSAKAIADTWME
FT                   DGRVRKVSFTGSTEIGKELMASAAQTMKKVSLELGGHAPFIVMNDADLDKAVEAVIGSK
FT                   FRNAGQTCICTNRVFVQEEVYEAFVEKFEKAVGQLKVGDGFGDGTTVGPLIDENAVSKV
FT                   QEHIEDAIQKGGTVLYGGQKVAELDGHFMQPTVIGLANDTMLCMNEETFGPVAPVAKFK
FT                   TVEEVIERANHTPYGLAAYIFTKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKE
FT                   SGIGREGGHFGIEEYLEIKYISLGL"
FT   gene            333263..333586
FT                   /locus_tag="BACI_c03740"
FT   CDS_pept        333263..333586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03740"
FT                   /product="multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03114"
FT                   /db_xref="GOA:D8GYT6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT6"
FT                   /protein_id="ADK03114.1"
FT                   /translation="MVYWLLLLVTIIFEVAGTIAMKLSNGLTKLVPSVLIFVFYGICFS
FT                   VFAIVVKKIHLSIAYAIWSGVGTLLITIISVYFFKEHISLFQAFCILFIVLGVIGLKVS
FT                   SAS"
FT   gene            complement(333626..334855)
FT                   /gene="ampS"
FT                   /locus_tag="BACI_c03750"
FT   CDS_pept        complement(333626..334855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="BACI_c03750"
FT                   /product="aminopeptidase; peptidase M29"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03115"
FT                   /db_xref="GOA:D8GYT7"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT7"
FT                   /protein_id="ADK03115.1"
FT                   /translation="MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEK
FT                   AYKSGAKHVYVDWNDETLTRLKFDLAPEEAFAEFPSWKAHAREELAKEGAAFMSIYAEN
FT                   PDLLKGVDSTRIATAHKVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDAAPEE
FT                   QEAKLWDAIFKATRADLENPVEAWKEHDKTLHTKVDYLNEKHYKALHYTGPGTDLTIEL
FT                   PEKHVWAGAGSLNEKNVPFMANIPTEEVFTMPLKTGVNGQVSSTKPLAFAGNIIDNFTL
FT                   TFENGRIVDYKAEVGEEALKHLVETDEGSHFLGEVALVPHDSPISNTNILFYNTLFDEN
FT                   ASCHLAIGSAYAFNLVGGKTMSKEELAENGANTSITHNDFMIGSAELDIDGITADGRHE
FT                   PIFRKGNWAF"
FT   gene            complement(334972..336054)
FT                   /locus_tag="BACI_c03760"
FT   CDS_pept        complement(334972..336054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03760"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03116"
FT                   /db_xref="GOA:D8GYT8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT8"
FT                   /protein_id="ADK03116.1"
FT                   /translation="MRKYASIALCTSAILAGCNTSNVSQEPNKERKVQETKKQAETVQE
FT                   QGKISYNPITHESTNTTIHMTDIKDTLTEVQYKIWRTADGKETAKSLSSKEKEKQFSLP
FT                   FDIKEFEGKRGEFQIEAIGIKEDGKTIPLTKSAITFEQKVPVLMYHAIDDYHGQGIKDL
FT                   FVSPANFEAQMKYLKDNGYTLLTFERWGDINKVNKPIFVTFDDGMKNNMNAFHVLQKLK
FT                   DDTFKPVATEYMIVNNVDAEGSLSTSDIKEMVDSGIFSMQSHTATHANLPKITNYEEEL
FT                   KKSKEKLEKITGKPVIAVAYPFGHVDDKVVAETKKYYQFATTTKPGKFITKGEPDELLK
FT                   MKRVRIHHTTTVEQFASSIK"
FT   gene            complement(336206..337309)
FT                   /locus_tag="BACI_c03770"
FT   CDS_pept        complement(336206..337309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03770"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03117"
FT                   /db_xref="GOA:D8GYT9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYT9"
FT                   /protein_id="ADK03117.1"
FT                   /translation="MKKYTYIALLSSAILVGCNTSSTSDKQIQETTAKQAVEQKKAKAV
FT                   ELPLTQGVITWDPYEYNAQNTTIYTKDLRDSFKEVRYTIWRTADGPESKQTFTSQEKER
FT                   DFALPLHLKTFHLKRGEFQIETVGIKEDNTETNLVTSKITFQQHVPVLMYHAIEKYPGP
FT                   SDGDYGLYVPPEQFEKHMQYLKDNGYTMLTFERWNDINRVNKPIFITMDDGRKNNMNAL
FT                   HILQKLKDDTFQPAATEFLTANEIDKPNRLSTDDIKQMMDSGIFSIQSHTANHTMMAHS
FT                   NNYDEELRGSKEKIEALTGKKVIALAYPVGSYNDPAVEETKKYYEFAVTTDHGNHITKG
FT                   MPNEQYLIKRHFVGPNTSMEKFISLIK"
FT   gene            complement(337584..338780)
FT                   /gene="nupC1"
FT                   /locus_tag="BACI_c03780"
FT   CDS_pept        complement(337584..338780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC1"
FT                   /locus_tag="BACI_c03780"
FT                   /product="nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03118"
FT                   /db_xref="GOA:D8GYU0"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU0"
FT                   /protein_id="ADK03118.1"
FT                   /translation="MQYVMSIIGILVVLGLCFALSNNKSKINFRAIAIMIGFQILIGWF
FT                   MFGTKIGQQIIIFISKVFNKLIKLGTTGVDFLFNGIQRDFVFFLNVLLIIVFFSALLSI
FT                   FSYLGVLPFIVRVVGGAISKVTGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRM
FT                   FIICCSAMSSVSASVTASYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVVQ
FT                   KFDRTVFGDSFIGAMINGALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVT
FT                   LQQIFGYLLAPFAFLMGIPAQDIIPAGGIMGTKIVLNEFVAILDLKGVAATLSPRTVGI
FT                   VTVFLISFASISQIGAIVGTIRALSEKQGSIVSKFGWKMLFASTLASILSATIAGLFI"
FT   misc_binding    338983..339084
FT                   /bound_moiety="puine"
FT                   /note="BACI_c03790; purine riboswitch, RF00167"
FT   gene            339206..340582
FT                   /locus_tag="BACI_c03800"
FT   CDS_pept        339206..340582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03800"
FT                   /product="RNA methyltransferase protein, trmA family"
FT                   /EC_number="2.1.1.-"
FT                   /note="tRNA uracil-5-methyltransferase, TrmA"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03119"
FT                   /db_xref="GOA:D8GYU1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU1"
FT                   /protein_id="ADK03119.1"
FT                   /translation="MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPG
FT                   EEAQIKIVKVKKNFAFGRLMKLHTESPYRKEAECPVYNQCGGCQLQHLTYEGQLQAKEK
FT                   QVRDVMQRIGGLGDVPVHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINM
FT                   ESCLIQAEENDTLIQEVKRICEKHGISAYNEERNKGTLRHVMARYGQVTGEIMLVFITR
FT                   TAELPNKKAIIEEIAAKFPEVKSIVQNVNPKRTNVIFGDKTTVLYGSEYIYDFIGDIKF
FT                   AISARSFYQVNPEQTKVLYDKTLEYAKLDGNETVIDAYCGIGSISLFLAQKAKKVYGVE
FT                   IVPEAIEDAKRNAALNNMTNAEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALL
FT                   NTIIDMKPKRVVYVSCNPATLARDLKVLEEGGYKTQEVQPVDMFPHTTHVECVAWLKLV
FT                   "
FT   gene            340679..341668
FT                   /gene="yfjN"
FT                   /locus_tag="BACI_c03810"
FT   CDS_pept        340679..341668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjN"
FT                   /locus_tag="BACI_c03810"
FT                   /product="probable dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03120"
FT                   /db_xref="GOA:D8GYU2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU2"
FT                   /protein_id="ADK03120.1"
FT                   /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGMKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFK
FT                   QDIANLSIHLRTREEMSQVDAHWELIPEIKKLRDRIAPNTLLTINGDILDRKMGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHR
FT                   FFKIYVKGFPGAAELRNQLMSTKSTDEVRGLLDKFEASVNVVEGSETV"
FT   gene            341986..344004
FT                   /locus_tag="BACI_c03820"
FT   CDS_pept        341986..344004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03820"
FT                   /product="sensor histidine kinase; possible sporulation
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03121"
FT                   /db_xref="GOA:D8GYU3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU3"
FT                   /protein_id="ADK03121.1"
FT                   /translation="MLSDQTRYSRLANITKIINTKLELREVLQRVTMAISEEIVRCDAV
FT                   GIYLPEEDGTFRGFAGKPETINGVTLDTQVIDPEVDLLAKEVIETKKTIYIPDTSKDHR
FT                   PDPRPVDAFKIKSLLALPISFGQELFGLVFLFDYGFPMNLTGSEIQSVEAYVNMAAVAI
FT                   QNAKNLTQKENLIAEKQLLLNVTRDLSMCSSIQESFDKCFFYLGQILESKNMAAHLLDP
FT                   LDKTTIKTTELSSGCDWIEADWMEKSYEAKIQEIIRTKHIDSKGLLMIPLVSMGEVLGV
FT                   IVVGKEEKTHNYDDSRIQLAKSIVDATAPTFSNLLYMDQLESMVEERTRELAAANEKVT
FT                   SVIESITDGFLTLNNKWEFTYVNKHQHFPQRKTEKDVLGKNIWEVFPSSVDTVIYKELH
FT                   RVMSERTTVHFEFFSTFDEYWHEVIAYPYDDGICCICKNITEKKQYEQELKRLSNIELI
FT                   GQMAAGISHEIRNPMTTIRGFLQLLKEENNYEKHNNYFNLMVEELDRANSIITEFLSIG
FT                   NTKKSDLQMLDLNSIIHDIIPLIKIDTHNQNKYIQVDTNDVPALLLNRNEIRQLLMNLY
FT                   RNGLEAMSTGKTLTISTYKEGQNCVVLAVRDEGKGISPEVLEKLGTPFYTTKENGTGLG
FT                   LGVCYAIATRHNAKIEIQTGSEGTTFFVKFNYENNKK"
FT   gene            344082..344600
FT                   /locus_tag="BACI_c03830"
FT   CDS_pept        344082..344600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03122"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU4"
FT                   /protein_id="ADK03122.1"
FT                   /translation="MAMSNNDILKRVRYALDIRDIDMVEIFKLGGIEVTKEDVVDMLTK
FT                   IKRAPQYEPENPDVEEDEYVKTCDMMMLEAFFNGFITLKRGKQDPKPGQPAPVQSKESA
FT                   NNLLLKKMKIALSLTSEDVLDILDSVGVKVTKGELGALLRKKGHKNYKECGDRYARNFI
FT                   KGLAVKYRG"
FT   gene            344695..345402
FT                   /locus_tag="BACI_c03840"
FT   CDS_pept        344695..345402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03840"
FT                   /product="possible zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03123"
FT                   /db_xref="GOA:D8GYU5"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU5"
FT                   /protein_id="ADK03123.1"
FT                   /translation="MVHTYLGETINFHITYKKKKSVRLFVDSYGNVEVQAPKGTPVEYL
FT                   IQLLEEKWDWIQTTRKEMQERARGPQEKDYDQGEGFLYLGNTYPIQISQDASIEQDNAI
FT                   FEGDKLHIYVKELKDEKIQQALKRFYYKQCKSLVEKSIKAYQSNFKTKPRSIRITDSSR
FT                   TWGTCDSNLQLTFNWKLAMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEM
FT                   ENWLALSSWKMTV"
FT   gene            complement(345609..346304)
FT                   /locus_tag="BACI_c03850"
FT   CDS_pept        complement(345609..346304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03850"
FT                   /product="benzoate transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03124"
FT                   /db_xref="GOA:D8GYU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU6"
FT                   /protein_id="ADK03124.1"
FT                   /translation="MTVLYEGRLKQNNELFHVTLLSLEHIEQILLLQNVVVEALEDKSR
FT                   LQPLSQEEFQYILEGNGMMIGAFIENELIAFRALLVPPIDDEHLGLDIGLPESELHRVI
FT                   YQEISNVHPNWRGNGMQKILATVIMDELQKEDSKYDYVCCTVAPFNIPSLKDKFAQGMK
FT                   IAALKEKYGGSMRYVFVKELRGVKERDWTDIKSVPMNNAGGQQALLSEGYRGYKMEKVD
FT                   EDFVVKFGR"
FT   gene            complement(346319..347428)
FT                   /locus_tag="BACI_c03860"
FT   CDS_pept        complement(346319..347428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03860"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03125"
FT                   /db_xref="GOA:D8GYU7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU7"
FT                   /protein_id="ADK03125.1"
FT                   /translation="MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIIKMETDEGIIGY
FT                   GEGVADDHVTGESWESTFHTLKHTLAPALIGQNPMNIEKIHDMMDNTIYGVPTAKAAID
FT                   IACFDIMGKKLNQPVYQLNGGRYHEEFPITHVLSIADPEEMAEEAASMIQKGYQSFKMK
FT                   VGTNVKEDVKRIEAVRERVGNDIAIRVDVNQGWKNSANTLTALRSLGHLNIDWIEQPVI
FT                   ADDIDAMAHIRSKTDLPLMIDEGLKSSREMRQIIKLDAADKVNIKLMKCGGIYPAVKLA
FT                   HQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPF
FT                   IRLNEKPGLGIEINEDTLRELTVFQDSVR"
FT   gene            347521..348792
FT                   /locus_tag="BACI_c03870"
FT   CDS_pept        347521..348792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03126"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU8"
FT                   /protein_id="ADK03126.1"
FT                   /translation="MMIKIAVVGSKEFMETLLPIAHKLEEIEIDSYVYLHPAESSELLK
FT                   RLKPCDFIFFSGALPYYMAKEIREQLRIPSTYLQQDETTVASSILSVMYHQGIQPHKIS
FT                   IDLVDRSFIINVFHDIGIKESPQVFDYENMLWSKDEINRVIDFHVAKYQSGKAHLALTS
FT                   IHAVYDELQKIGIPSERMIDPKQSIIHGLKDAKIKAELARSHSATVGACIISSLELRDG
FT                   LLEQLDVISKELRGSFKTIDEMTFILYTTRGDIESIIKTNIINNLFASIEGMIAIGFGY
FT                   GKTVKEAEQNAKIAQGFAKNNPIDHCFYILTSDKELFGPFPKEQRVQSLKNDNPELMKI
FT                   AKETKLSPANLSKIIQFSQSHPSLKFTAADLSEYLQVTRRSTERLLKKLVDYGYVHICG
FT                   EEMPYQQGRPRAIYELNLPLSLSF"
FT   gene            complement(348781..350202)
FT                   /gene="nhaC1"
FT                   /locus_tag="BACI_c03880"
FT   CDS_pept        complement(348781..350202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC1"
FT                   /locus_tag="BACI_c03880"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03127"
FT                   /db_xref="GOA:D8GYU9"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYU9"
FT                   /protein_id="ADK03127.1"
FT                   /translation="MKKEIPFGVAMIPIIITVAVMMVTIVVLKQSPHVPLIIGTTVASI
FT                   VAWRYGYKWNDIEEAMYKGIRLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLNLLTP
FT                   SLFLVSITIICSIVALAIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDK
FT                   MSPLSDTTNLAAGLTNTDLFTHIRHMLFTTIPGLIITLIVYAFLGRSFGANNIDAKSIE
FT                   QTLQVLQQNFVISPFLLIIPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSAS
FT                   VGALQAGFVIDTGNKLVDELFNRGGLDSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQI
FT                   LKLAKSAKGLIASTIASCFATNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALED
FT                   GGTLTSVFVPWNTCGVFILATLGVGAFEYAPYAILNFIVPIISIIYGITGLTITKLSDI
FT                   EKAELLKKQNAQLEA"
FT   gene            350496..351611
FT                   /gene="amhX"
FT                   /locus_tag="BACI_c03890"
FT   CDS_pept        350496..351611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BACI_c03890"
FT                   /product="probable amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03128"
FT                   /db_xref="GOA:D8GYV0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV0"
FT                   /protein_id="ADK03128.1"
FT                   /translation="MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITNFLKEEGISY
FT                   KIFDDCPGVIAEIGSGNPVIAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQL
FT                   KNMRWKSGTVRFIFQPAEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAAPSI
FT                   RHGAAGFLEGTIHGEDAHGARPHQGINAIDVISMINIGLKNIWLPPQSSYSVKMTRCQA
FT                   GGDNLNIIPGNGHFSLDVRAENNTLLEELKKRIEHVIESAASMGSKTSYEWIDLAPGAE
FT                   VSEEAERFMRKGILEVYGEDKCTGPLYTTGSDDFHYYTVKRPYLKAVMLGLGADLQPGL
FT                   HHPYMKFDHSCIMDGVEILKQTVLKVLEDRG"
FT   gene            351826..352434
FT                   /locus_tag="BACI_c03900"
FT   CDS_pept        351826..352434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03900"
FT                   /product="possible methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03129"
FT                   /db_xref="GOA:D8GYV1"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV1"
FT                   /protein_id="ADK03129.1"
FT                   /translation="MNEQYYDAVLHIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQY
FT                   EIRSSDRIVDFGCGKGRLNFYMHHKCGASAVGIEMNEEFYKEALDNLDRYARKVRDSKD
FT                   KIRFECCLAQEYEIDPCDNRFYFFNPFSVQVFMNVVNNILLSVEETGREVDIILYYPSE
FT                   DYIFFLENQTAFELKREVRLPGAYEKNGNERFLVYTLGL"
FT   gene            complement(352480..354006)
FT                   /gene="ahpF"
FT                   /locus_tag="BACI_c03910"
FT   CDS_pept        complement(352480..354006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="BACI_c03910"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03130"
FT                   /db_xref="GOA:D8GYV2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV2"
FT                   /protein_id="ADK03130.1"
FT                   /translation="MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELA
FT                   TMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVE
FT                   QKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVE
FT                   SKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVM
FT                   NLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHC
FT                   DGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVT
FT                   VLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRG
FT                   EIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN"
FT   gene            complement(354021..354584)
FT                   /gene="ahpC"
FT                   /locus_tag="BACI_c03920"
FT   CDS_pept        complement(354021..354584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BACI_c03920"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /note="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03131"
FT                   /db_xref="GOA:D8GYV3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV3"
FT                   /protein_id="ADK03131.1"
FT                   /translation="MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTF
FT                   VCPTELEDLQNQYATLKDLGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTI
FT                   TSNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPG
FT                   EVCPAKWQEGSATLKPSLDLVGKI"
FT   gene            355175..356404
FT                   /gene="mtrK"
FT                   /locus_tag="BACI_c03930"
FT   CDS_pept        355175..356404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrK"
FT                   /locus_tag="BACI_c03930"
FT                   /product="5-methylthioribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03132"
FT                   /db_xref="GOA:D8GYV4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV4"
FT                   /protein_id="ADK03132.1"
FT                   /translation="MSKFTKYFLMEANDVIVYVKEKLCKFEDAKGLQCKEIGDGNLNYV
FT                   FRVWDEQKNISVIVKQAGDTARISDEFKLSTNRIRIESDVLQLEEELAPGLVPKVYLFD
FT                   SVMNCCVMEDLSDHTILRTALINHEIFPRLAGDLTTFLVNTLLLTSDVVMNHKEKKELV
FT                   KNYINPELCEITEDLVYAEPFTNHNKRNELFPLNEGWIREHIYSDKELRIEVAKLKFSF
FT                   MTNAQALIHGDLHTGSVFVKNDSTKVIDPEFAFYGPIGYDIGNVMANLMFAWVNADATM
FT                   SAGAEKDTYMDWLQSTMVEVIDLFKKKFLDAWNIHVTEIMAKEEGFNEIYLQSVLEDTA
FT                   AVTGLELIRRIVGLAKVKDITCIENEEARARAERICLQVAKKFILRANQYKTGTSFVET
FT                   LKEQSMHYAK"
FT   gene            356414..357460
FT                   /locus_tag="BACI_c03940"
FT   CDS_pept        356414..357460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c03940"
FT                   /product="translation initiation factor IF-2B subunit
FT                   alpha"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03133"
FT                   /db_xref="GOA:D8GYV5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV5"
FT                   /protein_id="ADK03133.1"
FT                   /translation="MMEEQLIPIQWKDDALVLLDQTLLPNEVVYESFNTAEGVWDAIQV
FT                   MKVRGAPAIGVSAAYGVYLGVKEFVESTEAEFIDEVKRVCAYLATSRPTAVNLFWALER
FT                   MESVATDHTHLSITQLKDRLLEEAKEIHREDEEINRQIGEHALTLFHDGMGVLTHCNAG
FT                   ALATTKYGTATAPMYLAKEKGWDLKIYSDETRPRLQGSTLTALELQRAGIDVTVITDNM
FT                   AAMVMSQGKIDAVIVGCDRVAANGDVANKIGTLGVSILAKYYNIPFYVAAPTPTIDLKT
FT                   PTGKEIPIEERDASEVINRFGQYSAPKESKVYNPAFDVTPHENVTAIITEKGIVKAPFT
FT                   ENLKKLFQ"
FT   gene            357515..358156
FT                   /gene="fucA"
FT                   /locus_tag="BACI_c03950"
FT   CDS_pept        357515..358156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="BACI_c03950"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03134"
FT                   /db_xref="GOA:D8GYV6"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV6"
FT                   /protein_id="ADK03134.1"
FT                   /translation="MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPS
FT                   GLDYYETKPEDVVILNLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTI
FT                   ASLGWELPAVSYLIAFAGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGA
FT                   NHIKMAFTVAEEIEFCAQIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ"
FT   gene            complement(358197..359204)
FT                   /gene="fhuG1"
FT                   /locus_tag="BACI_c03960"
FT   CDS_pept        complement(358197..359204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG1"
FT                   /locus_tag="BACI_c03960"
FT                   /product="iron compound ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03135"
FT                   /db_xref="GOA:D8GYV7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV7"
FT                   /protein_id="ADK03135.1"
FT                   /translation="MIPSILRKQRLIILALLILTITTIVIGMGLGSASLSYDRLLPILM
FT                   GQGTFKEEFVLYSLRLPRIIITLLAGMALALSGAILQGITRNDLAEPGILGINSGAGVA
FT                   VAIFFLYFPIDVGSFLYLLPVVGFIGAFLTAVLIYVFSYSKSSGLQPVRLTLTGIGFAF
FT                   ALSGMMIVLISSADRMKVDFISKWIAGNIWGDDWIFIFAMLPWLIVLIPFVFYKANRLN
FT                   ILALNEPVAIGVGIEIEKERRYLLVAAVALAAAAVSVTGGISFIGLMAPHIAKSLVDPR
FT                   HQIFMPIALLIGGWLLLLADTIGRNIVEPNGIPAGIVVALIGAPYFMYLLLKKA"
FT   gene            complement(359201..360241)
FT                   /gene="fhuB1"
FT                   /locus_tag="BACI_c03970"
FT   CDS_pept        complement(359201..360241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB1"
FT                   /locus_tag="BACI_c03970"
FT                   /product="ferrichrome ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03136"
FT                   /db_xref="GOA:D8GYV8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV8"
FT                   /protein_id="ADK03136.1"
FT                   /translation="MKRKDVKRMTKEHDNTRSIAFTYKLILSIIAFFLIFMVAMVLGAA
FT                   DTSIKDVWLALTSSAKGDKISIIREIRLPREVAAIFVGAGLAVSGAIMQGLTRNPLADP
FT                   GLLGLSGGANAALALTLAFNPSISYLYLTLACFIGAAVGAIMVFGIGMVKKGGLSPLRI
FT                   VLAGAAVSAFLLAISEGVGIYFKISQDVSLWTAGGVIGTTWSQLKVIIPVISISIFIAI
FT                   LLAKKLTVLSFSEEVAIGLGQKIIVIKTILFIIIILLAGASVALVGNMAFIGLMVPHMV
FT                   RPIVGPDYRFVIPMSAIAGASFMLLADTIGRTINAPYETPVAAIVAIVGLPFFLFIVRK
FT                   GGKTFS"
FT   gene            complement(360290..361207)
FT                   /gene="fhuD1"
FT                   /locus_tag="BACI_c03980"
FT   CDS_pept        complement(360290..361207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD1"
FT                   /locus_tag="BACI_c03980"
FT                   /product="ferrichrome ABC transporter, periplasmatic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03137"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYV9"
FT                   /protein_id="ADK03137.1"
FT                   /translation="MKKLFISLTVLFVLVMSACSNGSTDKKKDAKGSKSETITYQSENG
FT                   KVEVPANPKRVVVLSSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEKI
FT                   AELNPDLIIGLSNIKNVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVDD
FT                   FKKRAQDAGKEIKAKIGEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKVK
FT                   EKALKEGYYALSTEVLPEFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANMM
FT                   EFYFNDPLTLDFQLDFFKKSFLGK"
FT   gene            361540..362589
FT                   /gene="trxB1"
FT                   /locus_tag="BACI_c03990"
FT   CDS_pept        361540..362589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="BACI_c03990"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c03990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03138"
FT                   /db_xref="GOA:D8GYW0"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW0"
FT                   /protein_id="ADK03138.1"
FT                   /translation="MNREELFDVTVIGGGPAGLYSAFYSGLREMKTKIIEFQPQLGGKI
FT                   HVYPEKMIWDIGGLLPVTGEKLIEQLVQQGLTFQPEVVLNTKIESIIRNKDGIFTLKTS
FT                   TGEEHFSKTVIVATGSGILNPQKLSIEGAERFEVSNLNYTVKSLKRFKNKTVIISGGGN
FT                   SAIDWANELEPIAKKVYLTYRKEELSGHEAQVKQLMNSSAECFFNTSITTLIAGDNHEA
FT                   IEYVELTNHETGEVSQLAIDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESS
FT                   VDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRN
FT                   RELIKQMMK"
FT   gene            complement(362786..363154)
FT                   /locus_tag="BACI_c04000"
FT   CDS_pept        complement(362786..363154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03139"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW1"
FT                   /protein_id="ADK03139.1"
FT                   /translation="MATRHIITMLEKTLQVETENTISHLTTSLSDRILSQSAAIQENNC
FT                   YHTIGEWYKNHFLFQQDDFLWAKYVFYDAYCEEIKKQGHLTKRVRQILESLARMHGKQY
FT                   IASILNMPFPKERAKGTA"
FT   gene            363345..363575
FT                   /locus_tag="BACI_c04010"
FT   CDS_pept        363345..363575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03140"
FT                   /db_xref="GOA:D8GYW2"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW2"
FT                   /protein_id="ADK03140.1"
FT                   /translation="MYITVEEAAEYLNLPKSYIEELIQQKKIRALFDGEQYLLNKEQFN
FT                   THLEQMEKYKQLVEEILNEPIPEDMDVKDED"
FT   gene            363811..364332
FT                   /gene="cotB1"
FT                   /locus_tag="BACI_c04020"
FT   CDS_pept        363811..364332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotB1"
FT                   /locus_tag="BACI_c04020"
FT                   /product="spore coat protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03141"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW3"
FT                   /protein_id="ADK03141.1"
FT                   /translation="MSLFHCDFLKDLIGSFVRVNRGGPESQRGTIISVCPDYFVLQNEK
FT                   GELYYYQLSHLKSITKSAKECGSSDCEWEDCACAEDFEALLESFKYCWVKINRGGPEKV
FT                   EGILQDVSCDFVTLIVKEEIILIAIKHIKSVNYNALACGESDESDDSSSKESNNNSGRA
FT                   RAQRQSSRGR"
FT   gene            364353..364802
FT                   /gene="cotB2"
FT                   /locus_tag="BACI_c04030"
FT   CDS_pept        364353..364802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotB2"
FT                   /locus_tag="BACI_c04030"
FT                   /product="spore coat protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03142"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW4"
FT                   /protein_id="ADK03142.1"
FT                   /translation="MENVLCCDQIKCLVGETVKVNLRGPESRVGELVSLGKDYLTLQLP
FT                   HGELVYYQLKHVKSLVKKVKESKCGDCYSSCFCSDEDTFLDILKDLKYKWVKINRGGPE
FT                   CVEGLLSEVHHGCITLVNCDEVIYVINSHIKSVSQVVKCKKNEDE"
FT   gene            364965..365633
FT                   /gene="ywrJ"
FT                   /locus_tag="BACI_c04040"
FT   CDS_pept        364965..365633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywrJ"
FT                   /locus_tag="BACI_c04040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03143"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW5"
FT                   /protein_id="ADK03143.1"
FT                   /translation="MNELNKSIGENIYVKLIGEKRFKGVLIDVGNDIVVLYNGQDYVYI
FT                   SLYHVQYYKILRPYDEEISKPDVDSVIKRESPSISLRKVLSTSKGIFTEIYVAGNAPIH
FT                   GYVTSIMNDYIVFYSPVYKTVYISLKHLKWLIPYKENQVPYALNKNELPVNPLNITLAR
FT                   TFEEQLIKMSGKIMVFDLGEESNKIGKMAKIDEGHIEILKARDAKMYVNIQHVKSVHCP
FT                   "
FT   gene            365870..367135
FT                   /locus_tag="BACI_c04050"
FT   CDS_pept        365870..367135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03144"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW6"
FT                   /protein_id="ADK03144.1"
FT                   /translation="MEQFPNSLSITLLGSAGGAAKAVLAILNQAIVNEKDPIYEVIKSV
FT                   TFHLVDIKQKDRTYYDELFPNLKDQLFLSEIDLQDVVTFKKHLKESSTSVVIDVSGADT
FT                   IRVLSCCNELGICYINSALENEAVDQDDSLIGFQLTERYTRFEKEKEKFTNTKAIIGSG
FT                   MNPGVVQWMVVELMKERPNEKPRACYIVEHDTSFLNDTALIKPHTLYTSWAVERFLDEA
FT                   IWSYPMYMSHHRPLYFYEDVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLY
FT                   RINEYTTNIIRQNLNKVEDLWNWNRKVFNPAEEEIAGEDLVGVLLVYENSETYMYNVMN
FT                   SSQVFHKYKTNATYFQVGCGIYAGLCSLLFDEFKQGAYYVEELLLNTESKYGEYLNLYM
FT                   KDFVVGENDFTDGLLHDRVRWI"
FT   gene            complement(367295..367558)
FT                   /locus_tag="BACI_c04060"
FT   CDS_pept        complement(367295..367558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03145"
FT                   /db_xref="GOA:D8GYW7"
FT                   /db_xref="UniProtKB/TrEMBL:D8GYW7"
FT                   /protein_id="ADK03145.1"
FT                   /translation="MSPPSRIDSIPFLITIVLIVYHHRLQVMHPHLFSSETSLYIALHN
FT                   FPLTAQHIKGFLVYYIIHNLLALVSLTNPLIFLNTFKASLSS"
FT   gene            368013..368393
FT                   /locus_tag="BACI_c04070"
FT   CDS_pept        368013..368393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03146"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZN7"
FT                   /protein_id="ADK03146.1"
FT                   /translation="MELTLNSTVCLHTIQFRKEQKNYIVKDTITGEKYEMPPLWIDALA
FT                   MMRDGFLLGEIEEKLKEEYPDEEINMLAFTRQLLELELVGMVDGEEIACTKKKEKDYLA
FT                   WLRPRVEQFFLSLNKKNRSKGQ"
FT   gene            complement(368421..369053)
FT                   /locus_tag="BACI_c04080"
FT   CDS_pept        complement(368421..369053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04080"
FT                   /product="possible cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03147"
FT                   /db_xref="GOA:D8GZN8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZN8"
FT                   /protein_id="ADK03147.1"
FT                   /translation="MKVIDLSQTFENNMSQFPGTPKINLEAITSVEETGYQVTDFHSVV
FT                   HVGTHCDAPAHFISGATTIDQLPLDQFVGEAVLIDVTHVQERKLRKEVLHNADIKEGDI
FT                   VIFHSNLSTKWNTEAYEQEAFYLSEELAEELVQLKVKSVGLDFISPDEVTTETSPIHHI
FT                   LLGNNIYLIENLTNLDAIHTKRFFFSAAPLKIKDSDGAFARAFAVIF"
FT   misc_binding    369139..369251
FT                   /bound_moiety="SAM"
FT                   /note="BACI_c04090; SAM riboswitch, RF00162"
FT   gene            369401..370510
FT                   /locus_tag="BACI_c04100"
FT   CDS_pept        369401..370510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04100"
FT                   /product="putative nucleotide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03148"
FT                   /db_xref="GOA:D8GZN9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZN9"
FT                   /protein_id="ADK03148.1"
FT                   /translation="MTGNVLNYFAGGNTARGFHNLYEENLKGLNRLFILKGGPGTGKSS
FT                   LIKAIGRDWVEKGYDIEFLHCSSDNKSVDGVIIPKLKVGIVDGTSPHVIEPKMPGVVEE
FT                   YINLGVAWDSDKLREQKVEIERFVSEASKAFQAAYARFNEALIIHDEWEKIYIDNIDFN
FT                   KANELTDQLIQKLFADKGGKQSLVKHRFLGAATPKGAVDFVPNLTEGLPHRYFIKGRPG
FT                   SGKSTMLKKLAKAAEEKGFEVEVYHCGFDPNSLDMVIVRELGFAIFDSTAPHEYFPSRE
FT                   GDEIIDMYALIVTPGTDEKYAEEIRDVSIQYKTKMNEAMSFLAKAKSVRDKLERIYIAA
FT                   MDFSKVDAYKEEIQKEFERIAISVTEKNK"
FT   gene            370632..371414
FT                   /locus_tag="BACI_c04110"
FT   CDS_pept        370632..371414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04110"
FT                   /product="possible nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03149"
FT                   /db_xref="GOA:D8GZP0"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP0"
FT                   /protein_id="ADK03149.1"
FT                   /translation="MREKIKLELERIEKEKDVKILFAVESGSRAWGFPSKDSDYDVRFV
FT                   YMHPVEWYLSIHDKRDVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSK
FT                   NSNFPEQLQQMSEKNFDPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKW
FT                   LEEKTTLPPVEFDRLITELSLERSVLDEIEQLLIKKKAGTELDVGLKIDVLNQFLEEKI
FT                   HYYQQYVKGIEKGSGIDIESLNILFRDMLFEVYKKEHE"
FT   gene            complement(371429..372730)
FT                   /locus_tag="BACI_c04120"
FT   CDS_pept        complement(371429..372730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04120"
FT                   /product="sugar transporter; possible benzoate transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03150"
FT                   /db_xref="GOA:D8GZP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP1"
FT                   /protein_id="ADK03150.1"
FT                   /translation="MQPSAPPHLESTKTIFSNSITKLVVFICWLAILADGYDLGIYGAV
FT                   LPKLLEDNSWALSPAHAGTIASYALFGMFIGAILVGTITDLIGRKWTLICCLALFSITM
FT                   GLAALAPSPELFGLWRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPLGIV
FT                   LGAILSMFMLEDFGWRIMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQEEVDKILNRF
FT                   QIEFHAKEKTHQAPSNIRKKNGFLTLFSKEYIKATLLFWITYIMGMFLIYGLNTWLPQM
FT                   MRQAGYPLGSSLSFLLMLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLLTIK
FT                   PSVTIIYLLIGLAGIGSVGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAIAGPILV
FT                   GIIMTMQYDLAWNFYLFSFAGLFAAISVFLIPAK"
FT   gene            complement(373026..374552)
FT                   /locus_tag="BACI_c04130"
FT   CDS_pept        complement(373026..374552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04130"
FT                   /product="probable oxidoreductase, with Rieske iron-sulfur
FT                   protein 2Fe-2S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03151"
FT                   /db_xref="GOA:D8GZP2"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP2"
FT                   /protein_id="ADK03151.1"
FT                   /translation="MTSDTFPQFPSSYWIESTQLPTFPPLSENIKTKVAVIGAGITGIT
FT                   TAYLLAKEGIDVVLIDSGLILNGTTGHTTAKITAQHDLIYDELINHFGMEKAGLYYESN
FT                   NHALQFINETVQTYKIDCNFSNEDSYLYTTTDKGLRNLSKEYEAYQKLNIPCDYVQSLS
FT                   IPIPVQSALVMKNQAQFHPLLYLKTLLAKFVEMGGKVYEQTTAMDVEKGDSPQIITKEG
FT                   HGITCEYVVSCSHFPFYDANSFFFTRMYAERSYALAIKAKTDYPGGMYLSIDDPKRSLR
FT                   YTTNNGEKLILIGGESHKTGQGINTMLHYEALYSFAEATFGVDEAPYRWSAQDLITLDK
FT                   LPYIGHINERNPNIFVATGYRKWGMTTGTTAAHLLKDSILKVHSPYKELYAPSRFHANP
FT                   DIKTFLSQNIDVAKHLIEGKIETALRKPEDLEVGEGSVVHVNGKRAGAYKDKEGKLHIV
FT                   DTTCTHLGCEVEWNNGDCTWDCPCHGSRFSIEGDVIEGPADQPLKRVDNE"
FT   gene            375286..376218
FT                   /locus_tag="BACI_c04140"
FT   CDS_pept        375286..376218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04140"
FT                   /product="possible fatty acid desaturase"
FT                   /EC_number="1.14.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03152"
FT                   /db_xref="GOA:D8GZP3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP3"
FT                   /protein_id="ADK03152.1"
FT                   /translation="MNVWANLGIAIVLGLCFASLGFLGHEILHGTVVRKAWLRDFLGAI
FT                   AFMPLSTGPKLWRKWHNATHHVHTQHEENDPDAWPTLEKLKKSKFLSWVYRMPLHVRSF
FT                   FSFLSLTIQFTLHSTRMFFHFIKEFKSSNQKSVWLQLLLPWTVWISLLFIMGPGKWLFA
FT                   YVIPLLIANFIVMAYIATNHRLNPIVPVNDPLANCLSVTVPRWVDVLHFNFSYHTEHHL
FT                   FPAMSSKYYPLVKEKIKEMWPERYHEMPMTKALAALWNTPRVYYQGSELVDPHREHFYG
FT                   SLGNGLDPHNISYREEHIEEEESIKKVNQ"
FT   gene            complement(376271..376963)
FT                   /locus_tag="BACI_c04150"
FT   CDS_pept        complement(376271..376963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04150"
FT                   /product="amino acid ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03153"
FT                   /db_xref="GOA:D8GZP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP4"
FT                   /protein_id="ADK03153.1"
FT                   /translation="MFEIFMSTYPTLLKATIVTLQLTLTSLLLGSLIGLLFAFFRISNN
FT                   KVLNSIAHVYIAIIRGTPLIVQIAILYFGITSVVVFTPFWAGAIALAIHNGAYITEIFR
FT                   GSIQSIDRGQMEAARSLGMPYSLAMRRIVLPQAFRQSIPPLGNQFIIGLKDSSLVAYVG
FT                   LSELWGSGLSIAAGNFQQLDTYIIVGLYYLVLVLLFTYLVNLLEKRLQRKETNSVQVSA
FT                   KKKKEVSL"
FT   gene            complement(377107..377901)
FT                   /locus_tag="BACI_c04160"
FT   CDS_pept        complement(377107..377901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04160"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein; bacterial extracellular
FT                   solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03154"
FT                   /db_xref="GOA:D8GZP5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP5"
FT                   /protein_id="ADK03154.1"
FT                   /translation="MKRKLLTIVASITLCTSFILGACSKESSTTSSNGEKEFRYAMSGL
FT                   YKPFNYKENDGKLVGFDVEIGEALAKKMNMKPTPITNPWETLIQGLKAKKYDVILGSMA
FT                   ITEERLKAVNFSNPYYRSGAQIFVAKKNTSISSPEDLKGKKIGVVKASTFKDLVAKHTD
FT                   QITEYDSDITALMDLEPGRIDAVITDQMVGLRMIKEGKSNIKEAGKPLNLDEMGIAIRK
FT                   DDKEMVEKVNKALDEIIKDGTYEKISKKWFGRNILGEEEKTK"
FT   gene            complement(378023..378745)
FT                   /gene="glnQ1"
FT                   /locus_tag="BACI_c04170"
FT   CDS_pept        complement(378023..378745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="BACI_c04170"
FT                   /product="glutamine transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03155"
FT                   /db_xref="GOA:D8GZP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP6"
FT                   /protein_id="ADK03155.1"
FT                   /translation="MIQVRNLVKSFGSLDVLKGIDLEVNEKEVVVLIGASGSGKSTLLR
FT                   CLNFLEMYDEGEIHLQGERIDPKHSNLNKVRENVGMVFQHFNLFPHMTSLENIIEAPIH
FT                   VKKLETANAKEIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMNPKIMLFDEP
FT                   TSALDPELVGEVLQVMKELAEEGMTMVIVTHEMNFARDVADRVIFMDDGKIVEDAPPAQ
FT                   FFSAPSHERAKQFLRNVL"
FT   gene            378956..379693
FT                   /gene="mcpA1'"
FT                   /locus_tag="BACI_c04180"
FT   CDS_pept        378956..379693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA1'"
FT                   /locus_tag="BACI_c04180"
FT                   /product="methyl-accepting chemotaxis protein, N-terminal
FT                   part"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03156"
FT                   /db_xref="GOA:D8GZP7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP7"
FT                   /protein_id="ADK03156.1"
FT                   /translation="MEKERKAFSFGLRTQLMLFTTVLALITYSTSIFFIYVIYDYFQSY
FT                   VSQTAYNIIVMLLGVVWSGILAYGAAVFLIKPLRKLEEAARKAAEGDIREDVPLPKTDD
FT                   EIKSLSVAFNMMLGNLRGMVKNIDTTFSYTNNQVQQIRKQTGEATKQAQGVSETLAEIS
FT                   SGAEQSAASIQAIVSAVDTTTSIASEVEEKAKQSDELSSEMVQALGHSTRVFTSLIQGI
FT                   QTLAKENEDSMQNVQKLEERMKQ"
FT   gene            379690..380256
FT                   /gene="mcpA1''"
FT                   /locus_tag="BACI_c04190"
FT   CDS_pept        379690..380256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA1''"
FT                   /locus_tag="BACI_c04190"
FT                   /product="methyl-accepting chemotaxis protein, C-terminal
FT                   part"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03157"
FT                   /db_xref="GOA:D8GZP8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP8"
FT                   /protein_id="ADK03157.1"
FT                   /translation="MKQVEHIVSVVSEIASQTNLLALNASIEAARAGEHGRGFAVVAEE
FT                   VRKLADESDHSARNISQLLRNMQEEVQQVAMKMTEQVKIAKEEARRGEATELILKEMSS
FT                   SVMEVADATKQISSYMNEQVSHIHQTGAQTKAVAAIAEETSAGSQEVACVTVQQSKNMV
FT                   VIDQLLKDLEKQAADLKQTIERFSM"
FT   gene            380493..382157
FT                   /locus_tag="BACI_c04200"
FT   CDS_pept        380493..382157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04200"
FT                   /product="alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03158"
FT                   /db_xref="GOA:D8GZP9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZP9"
FT                   /protein_id="ADK03158.1"
FT                   /translation="MNKTWWKEAVAYQIYPRSFMDSNGDGIGDLQGIIAKLDYLKDLGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMDEFGTMEDFDALLDEVHKRDMKLIIDLVINHT
FT                   SDEHPWFIESRSSKDNPKRDWYIWHDGKDGAEPNNWESIFNGSAWEYDEVTGQYYLHLF
FT                   SRKQPDLNWENKEVREVLYDTVNWWLDKGIDGFRVDAISHIKKEDGFKDMPNPKGLKYV
FT                   PSFDKHMNVDGIQPLLEELKENTFSKYDIMTVGEANGVKIEDAELWVGEEQGKFNMVFQ
FT                   FEHLSLWDAEKKKDLDVVGLKKVLTKWQKGLENKGWNALYIENHDKPRIVSTWGDDKQY
FT                   WRESATALGAMYFFMHGTPFIYQGQEIGMTNVQFPNIEDYDDVAIKNLYREKIAEGVSH
FT                   QDMMEIIWASCRDNSRTPMHWDDEINAGFTTGTPWFGMNQNYKEINVAKQKNEENSIFN
FT                   FYKKMIALKKEHDVLNYGTYDLLLEDDPQIYAYTRTLNDEKIVVISNISKEEAVYNEDL
FT                   FALERKRLLLNNYEVSEHEQLTTITLKPYETRVYRIS"
FT   gene            382363..384000
FT                   /gene="ptsG1"
FT                   /locus_tag="BACI_c04210"
FT   CDS_pept        382363..384000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG1"
FT                   /locus_tag="BACI_c04210"
FT                   /product="PTS system, glucose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03159"
FT                   /db_xref="GOA:D8GZQ0"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ0"
FT                   /protein_id="ADK03159.1"
FT                   /translation="MKITSFDFWQKFGKALLVVVAVMPAAGLMISIGKLIGMSAGDINA
FT                   VHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRAGGAFAALLAFVLTNRITGAIFGV
FT                   NAEMLADSKAKVSSVLAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKYYNY
FT                   NKLPQALAFFNGKRFVPFVVIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVV
FT                   APFVYGTLERLLLPFGLHHMLTIPMNYTELGGTYTMLTGSKIGQVVAGQDPLWLAWITD
FT                   LNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRAKYKPM
FT                   FLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELI
FT                   TRTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDESS
FT                   EGTGNVQDGSLATKVIDLLGGKENIADVDACMTRLRVTVKNLEVVAPEAQWKQNGALGL
FT                   IVKDKGVQAVYGPKADVLKSDIQDMLGA"
FT   gene            384005..384796
FT                   /locus_tag="BACI_c04220"
FT   CDS_pept        384005..384796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04220"
FT                   /product="possible endonuclease/exonuclease/phosphatase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03160"
FT                   /db_xref="GOA:D8GZQ1"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ1"
FT                   /protein_id="ADK03160.1"
FT                   /translation="MKLLTLNCHSWQEENQIEKIKYLAKVIQEEEYDVIALQEVSQSIG
FT                   AKNVCGNKKEDNFGLLLLEELKALHVKDYNITWDFSHIGYDVYEEGLAIITKHNVVKED
FT                   AFFISENKDTTYWKTRKIVSATIAYNGKNITFYSCHLGWWNDEEESFKDQVNRLVERVD
FT                   SNELSFLMGDFNNNARLQGEGYEYMMQEGLYDTYELAIEKDEGTTVQGEIAGWDENKHN
FT                   LRIDLILCNRSEKIRSSKVVFNGTNRKVISDHFGVEVQVDI"
FT   gene            385029..385104
FT                   /locus_tag="BACI_c04230"
FT   ncRNA           385029..385104
FT                   /locus_tag="BACI_c04230"
FT                   /product="putative group II catalytic intron"
FT                   /note="RF00029"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            385103..387964
FT                   /locus_tag="BACI_c04240"
FT   CDS_pept        385103..387964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04240"
FT                   /product="putative membrane protein, phage infection
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03161"
FT                   /db_xref="GOA:D8GZQ2"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ2"
FT                   /protein_id="ADK03161.1"
FT                   /translation="MKQIWRIYKTDLRNVAKHWAAIVIVVGLMILPSLYAWFNIKASWD
FT                   PYGNTKEVPIAVSNQDAGSNLRGKDINIGDEIVDSLKKNKNLGWKFVDEKQAIYGVERG
FT                   DYYASITIPKDFSEKIATVLDENPQKPELDYYVNEKVNAIAPKITAKGASGITEEISKN
FT                   FVKTANGEIFKIFNDLGIDLETNLPSIEKVKDLVFKLEAQFPEMNTLMDKALDDATRAE
FT                   DIVKVAQKDLPVVESVINDGQEALANLDKFFARQDQTLKNAPGTIRNDLVAAKGVMDSA
FT                   AAFTDFLMNPGVELNIPDLSGMNGLPEFPARPDLSKLNSDGYKGIAQNINQTVNNVLSS
FT                   SRAGTAYAQSVMDGLQNGSVDPEIAKKNISTISNNLQTHIDNLSYVIDVMARLEQGAQT
FT                   EFGQNFFKTRKEHLTDIKNGQQDLNNRFKRLNDLISTGQEVKQDVRDGINQKLNETNAL
FT                   IDRAEKDYNETFVADYKKAVSAVDQAKADANQIYDNAKADYDKAKNSLEGAKADLQKAK
FT                   EDVQNRGINGLDSTKVALNSLNGQFQSGIGLIDDMIPVLESTNKVLADVNSDKNLNNGI
FT                   AKLNKAKSSLQKGVDATNKGITLLNNGQKPTKDVIESINNAAKGGSAQLTDVLSTYDSE
FT                   IVPNFNTAIARTKEMSKNTTQILNDADKKLPDVKKLLEDSSKGLVDGRKKLADIKAEMP
FT                   ATEKKIKELADKIRDFESEEDLKDIIRLLKNDVEKQSDYFANPVNLKENKLFAMPNYGS
FT                   AMSPFYTVLALWVGALLMVSLLTVEVHEEGANYKSHEIYFGRLLTFLTIGLSQAFIVSM
FT                   GDIFLLGTYVVDKFWFVLFSLFIGGVFVCIVYSLVSIFGNVGKSMAIILLVLQVAGSGG
FT                   TFPIQMTPAFFQAIYPFLPFTYAISAIRETVGGMLWDIVTRDLLVLSAFVVVMIVAALL
FT                   LKTPINKSSEKFVENAKGSKIIH"
FT   gene            complement(388005..390194)
FT                   /gene="topB1"
FT                   /locus_tag="BACI_c04250"
FT   CDS_pept        complement(388005..390194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB1"
FT                   /locus_tag="BACI_c04250"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03162"
FT                   /db_xref="GOA:D8GZQ3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ3"
FT                   /protein_id="ADK03162.1"
FT                   /translation="MAKSVVIAEKPSVARDIARVLKCDKKGNGYLEGSKYIVTWALGHL
FT                   VTLADPESYDVKYKKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVAT
FT                   DAGREGELVARWIIDKVRINKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVAR
FT                   SEADWYIGLNATRALTTRFNAQLNCGRVQTPTVAMIANREDEIKNFKAQTYYGIEAQTT
FT                   NQLKLTWQDANGNSRSFNKEKIDGIVKGLDKHNATVLEIDKKQKKSFSPGLYDLTELQR
FT                   DANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVGTLPERLKACGVGEYRP
FT                   LAHKVLQKPIKANKSFVDDSKVSDHHAIIPTEGYVNFSAFTDKERKIYDLVVKRFLAVL
FT                   FPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDDVTDDVKEQLLPRIEK
FT                   GDTLTVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQLADTLKSTGGLGTVA
FT                   TRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTGEWEQKLEAIAKGK
FT                   LKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLEVNGKKGKMLVCQ
FT                   DRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSTFQERRKKESGN
FT                   KADKRDVQKYMKQQKKEEEPLNNPFAEALKKLKFD"
FT   misc_binding    390421..390530
FT                   /bound_moiety="TPP"
FT                   /note="BACI_c04260; TPP riboswitch, RF00059; THI element"
FT   gene            390603..391409
FT                   /gene="thiM"
FT                   /locus_tag="BACI_c04270"
FT   CDS_pept        390603..391409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="BACI_c04270"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03163"
FT                   /db_xref="GOA:D8GZQ4"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ4"
FT                   /protein_id="ADK03163.1"
FT                   /translation="MNTKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVM
FT                   AYAKEEVAEMANIAGALVLNMGTLRPDEVEAMLLAGKSANRNDVPVLFDPVGAGATSYR
FT                   TEVARHIPAEIELAIIRGNAAEIANVINEKWEIKGVDAGAGNGNVVSIAKQAADELNTV
FT                   AVITGKEDVVTDGERTIVIRNGHSILTKITGTGCLLTSVIGAFVAVEKDYVKAAVAALT
FT                   FYGVAAELAAAKTVEKGPGSFQIEFLNQLANTTSGDIEKYGKIEVI"
FT   gene            391426..392085
FT                   /gene="thiE1"
FT                   /locus_tag="BACI_c04280"
FT   CDS_pept        391426..392085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE1"
FT                   /locus_tag="BACI_c04280"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03164"
FT                   /db_xref="GOA:D8GZQ5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ5"
FT                   /protein_id="ADK03164.1"
FT                   /translation="MSRISKAEMSKLLSVYFIMGSNNCTKDPLQVLREALEGGITIFQF
FT                   REKGEGALTGEERICFAKELQAICKEYGVPFIVNDDVELALELDADGVHVGQDDEGITS
FT                   VREKMGDKIVGVSTHTIEEARWAIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAHFRE
FT                   QGITIPIVGIGGISIENTASVIEAGADGVSVISAISLAESAYESTKKLVEEVSRSL"
FT   gene            complement(392201..393514)
FT                   /gene="dcuB"
FT                   /locus_tag="BACI_c04290"
FT   CDS_pept        complement(392201..393514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuB"
FT                   /locus_tag="BACI_c04290"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03165"
FT                   /db_xref="GOA:D8GZQ6"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ6"
FT                   /protein_id="ADK03165.1"
FT                   /translation="MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTA
FT                   PPIDVMLMILAVITAAGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAG
FT                   TGHVAYSVLPVIAEVSRESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKI
FT                   TLLDILKVSIPSTFIACMIAAFVASKMGKELNEDPEYLKRLKEGMIPKIEEKKEFVGVK
FT                   GAKLSVILFLVGTFLVVLLGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFC
FT                   KPNVESIVSGNVFKAGATAVVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIA
FT                   LFILSILLYSQAATVRALMPLGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDR
FT                   TGTTGIGKYVLNHSFMIPGLIATFTSIGIGMLLISIMF"
FT   gene            394024..395763
FT                   /gene="cheW1"
FT                   /locus_tag="BACI_c04300"
FT   CDS_pept        394024..395763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="BACI_c04300"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03166"
FT                   /db_xref="GOA:D8GZQ7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ7"
FT                   /protein_id="ADK03166.1"
FT                   /translation="MKKYWHKLSFLQKNVLLTVLVILTLVGTMGALSFNMFQNSMMSIF
FT                   ERHSFETGDTVLHKLDEEIVRDVTKDPVAQREKREKLTEKLDEATEELNSVGQTYIVGA
FT                   KKNEKGELLIVDLSTDLANVVEVRPGEYYKQPDLWMEAYDKVMSTKKANMTVVYEDLLG
FT                   TWVTILEPIKDGEGNIVAIVAADVDASIVPSTKEKFIIQGLMFICISVLIATVIQFLIV
FT                   RNALAPLRDLREGLRRVGEGDLNIKLEERSDDIGIINSYFNNTIEKFKGIIDKVKQTAE
FT                   QVSSSSQELSVSTKENSMAVQEIVSSMVELRAGAQLQETSVPQYLGIVYEVEDKMEEIT
FT                   NAAKQMEKVSEGIEHHSVKGNGVTKQAINQMNIIQNAVQDLSSIIYSLEVRSKEISDIV
FT                   TVITSISNQTNSLALHATIEASRAEETGEGFAVVADEVRKLAEQMEASAKDIANLIGET
FT                   QAGTEEAVVSIRKASKEVESGMKLVEMNGAFFEEISKSAQSVTNQVRVVSSNSSDILQN
FT                   SQNIVRVVNELSLIANTYTNSSSNVEESMKEQEMSVQDIAELASSLSWLSQELQELIGE
FT                   FKS"
FT   misc_binding    395825..395926
FT                   /bound_moiety="TPP"
FT                   /note="BACI_c04310; TPP riboswitch, RF00059; THI element"
FT   gene            396027..396347
FT                   /locus_tag="BACI_c04320"
FT   CDS_pept        396027..396347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03167"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ8"
FT                   /protein_id="ADK03167.1"
FT                   /translation="MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMET
FT                   TLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPE
FT                   AI"
FT   gene            396325..397092
FT                   /locus_tag="BACI_c04330"
FT   CDS_pept        396325..397092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04330"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03168"
FT                   /db_xref="GOA:D8GZQ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZQ9"
FT                   /protein_id="ADK03168.1"
FT                   /translation="MQNQKQSKIITTIWLILLIAIWEGSVSLFKIEPWILPKPSAIVQE
FT                   LIGMKDLLLPNTMQTLQEVIIGLFFAILIGTSIAILMDVIPLFRILINPLLVISQTIPI
FT                   VVLAPLFIIWFGYGMLPKVMVVILVCFFPIALSILEGFQTVDKNMLKLLQTMKATKWQV
FT                   YQKVKFPAVLPYFFSGLKIAVTYSVMGAIIGEWLGASEGLGVMLTRATKSFLTARVFGV
FT                   AAIIVMVTLCLYFIVEFMARITAPWIYRKDGRK"
FT   gene            397089..398087
FT                   /locus_tag="BACI_c04340"
FT   CDS_pept        397089..398087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04340"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03169"
FT                   /db_xref="GOA:D8GZR0"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR0"
FT                   /protein_id="ADK03169.1"
FT                   /translation="MKKGLKVMLAALLAVGVAGCNPAKKEESASKDQKVKVVLDWFPNT
FT                   NHTGLYVAQAKDYYKKQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGI
FT                   PVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDRHQADFN
FT                   KVEKIILGQTDFFKSIGRDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPV
FT                   MITSEKHTKQDKDFVKKFMSATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWL
FT                   STKYQDDAKAWGVQKEEVWTNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK"
FT   gene            398084..398833
FT                   /locus_tag="BACI_c04350"
FT   CDS_pept        398084..398833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04350"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03170"
FT                   /db_xref="GOA:D8GZR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR1"
FT                   /protein_id="ADK03170.1"
FT                   /translation="MSGLQIKDIVKSFDGKNVLANISASIREGEFVSFVGPSGCGKSTL
FT                   LNMIANVENSTSGSVTYNDKQMQEQDVVSYMPQQDLLLPWRSALQNIVLPLEIEGKPKK
FT                   QRLTEGMEALKQFELDEYADHYPDELSGGMRQRISFLRTYLCEKPIMLLDEPFGKLDAF
FT                   TKMEVHSWLLNSWHQEKQTIVMVTHDLDEAILLSDRVFILSQRPASIVGEVQVKLPRPR
FT                   TMDMLTSIELKKDKEEILRVLAPYMKK"
FT   gene            398972..399113
FT                   /locus_tag="BACI_c04360"
FT   ncRNA           398972..399113
FT                   /locus_tag="BACI_c04360"
FT                   /product="putative anti sense RNA similar to SraC/RyeA RNA"
FT                   /note="RF00101"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            399219..400763
FT                   /locus_tag="BACI_c04370"
FT   CDS_pept        399219..400763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04370"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03171"
FT                   /db_xref="GOA:D8GZR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR2"
FT                   /protein_id="ADK03171.1"
FT                   /translation="MSILTVENLSHSYGEKTILYNACFRLLKGEHVGVVGENGIGKSTL
FT                   LRILTGELIHDDGNIEWFPHVRIGFLQQHMDLQEGMTIEGYLQSAFADLYAIECEMLKI
FT                   AEEMNGAGEVEKLLVKYGELQTILESSNFYHIHAEVEEVAIGLGLFEIGLKKDVSKLSG
FT                   GQRTKLLLGKLLLEKADVLLLDEPTNYLDTAHIEWLQSYLRLYEKAYVIISHDELFLNS
FT                   ITNIIFHLEGGKVKRYVGNYEKFVQSYQVQKKQLQSAYVKQQKEISQLETFIQKNKIRK
FT                   AKQAKSREKVLEKMQRIEKIHPVPRSRFDFNVYEEPVSRILQAEKLRIGYSDPLCPELN
FT                   LQVKKGEKIAIIGHNGIGKTTMLKTLLGQIKPLSGSISVGERVNPAYFAQEEFASETTP
FT                   LEKVWAERPDMTKKEVRQALAKCGLKEEHVLKPIRLLSGGEQTKVRLCELIVTRSNVLI
FT                   LDEPTNHLDIETKKSLQEALQQYKGTVLLVSHEPSFYEAWITKVWNIEEWNAEQYE"
FT   gene            complement(401221..403245)
FT                   /gene="chiA"
FT                   /locus_tag="BACI_c04380"
FT   CDS_pept        complement(401221..403245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chiA"
FT                   /locus_tag="BACI_c04380"
FT                   /product="chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03172"
FT                   /db_xref="GOA:D8GZR3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR3"
FT                   /protein_id="ADK03172.1"
FT                   /translation="MKSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQGQKIVGYF
FT                   PSWGIYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESGVP
FT                   LQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTI
FT                   ISVGGWTWSNRFSDMAADEKTRKVFADSTVDFLREYGFDGVDLDWEYPGVETIPGGSYR
FT                   PEDKQNFTLLLQDVRNALTKAGAEDGKKYLLTIASGASQRYADHTELKKISQILDWINI
FT                   MTYDFHGGWEATSNHNAALYKDPNDPAADTKFYVDGAIDIYTNEGVPADKLVLGVPFYG
FT                   RGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVR
FT                   EWNDVAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYS
FT                   CSGPKLLDTLVKELLGGPITQKDIEPPTNVKNIAVTNKNSNSVQLNWTASTDNVGVTEY
FT                   EITAGEEKWSTTTNSIAIKNLKPNTEYTFSILAKDAAGNKSQPTSILVKTDDANTTPPG
FT                   GNSNATFSVTSNWGSGYNFSIVIKNSGTTPIKNWKLEFDYNGNLTQVWDSKISSKINNH
FT                   YVITNAGWNGEIPPGGSITIGGAGTGTPAELVNASISEN"
FT   gene            403593..403964
FT                   /locus_tag="BACI_c04390"
FT   CDS_pept        403593..403964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03173"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR4"
FT                   /protein_id="ADK03173.1"
FT                   /translation="MDVFLNIAEEKIRQAIRNGDLDNIPGKGKPLQLEDLSMVPPELRM
FT                   SYKILKNAGMIPPEMELQKDILKIEDLIACCYDEEERKKLQEELTAKTLRFQQVMEKRK
FT                   IKDSSAFRMYQDKVFHKLR"
FT   gene            403975..404289
FT                   /locus_tag="BACI_c04400"
FT   CDS_pept        403975..404289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04400"
FT                   /product="possible thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03174"
FT                   /db_xref="GOA:D8GZR5"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR5"
FT                   /protein_id="ADK03174.1"
FT                   /translation="MKKIETIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLEN
FT                   YDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNGKEILRESRFISLENLERTIQLFEE
FT                   "
FT   gene            404303..404548
FT                   /locus_tag="BACI_c04410"
FT   CDS_pept        404303..404548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03175"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR6"
FT                   /protein_id="ADK03175.1"
FT                   /translation="MEFIIFILLFVVIGIIVTAVRSNKKKVNLMKQNNIHNSSNSSSPL
FT                   FFFAGSDNDSSHDGGSYDCGGSSGGDSGGSCGGGGD"
FT   gene            404675..404818
FT                   /locus_tag="BACI_c04420"
FT   CDS_pept        404675..404818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03176"
FT                   /db_xref="GOA:D8GZR7"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR7"
FT                   /protein_id="ADK03176.1"
FT                   /translation="MEREPKVKNKGKVMLFLLAAGGVFLVKLGFKIGIIHMIRTWFEST
FT                   FS"
FT   gene            404899..405480
FT                   /locus_tag="BACI_c04430"
FT   CDS_pept        404899..405480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04430"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03177"
FT                   /db_xref="GOA:D8GZR8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR8"
FT                   /protein_id="ADK03177.1"
FT                   /translation="MRRSAEEIKKEIAYKAEILFSQKGYAATSMEEICEITERSKGSIY
FT                   YHFKSKEELFLFVVKQHTYDWLEKWNEKEKLYSTSTEKLYALAEYHVEDIQQPISNAIE
FT                   EFSMSQVVSKEILDEMLALTRESYVMFETLIEAGIQSGEFREDNTRDLMYIVNGLLSGL
FT                   GVLYYELDYKELKRIYKKAIDVLLKGMAAE"
FT   gene            405547..406779
FT                   /locus_tag="BACI_c04440"
FT   CDS_pept        405547..406779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04440"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03178"
FT                   /db_xref="GOA:D8GZR9"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZR9"
FT                   /protein_id="ADK03178.1"
FT                   /translation="MNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVS
FT                   VSLLSVMEYAPIFIFSFIGGALADRWNPKRTMVAGDVLSVLSIIGIVLLLKLDYWQAIF
FT                   FATLISAIVGQFSQPSSSRIFKRYVKEEQVANAIAFNQTLQSLFMIFGPVVGSLVYTQL
FT                   GLFTSLYSLIILFLLSAIALSFLPKWVEQEQGARDSLKNDIKEGWKYVLHTKNLRMITI
FT                   TFTIMGLAVGLTNPLEVFLVIEHLGMEKEAVQYLAAADGIGMLIGGIVAAVFASKVNPK
FT                   KMFVFGMSILAMSFLVEGLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMVGR
FT                   VNGTILPLFMGAMLIGTALAGGLKEMTSLVIVFCIAMALILLAIGPVLRMQIKKEDVTT
FT                   KEELTNSLASK"
FT   gene            406893..407087
FT                   /locus_tag="BACI_c04450"
FT   CDS_pept        406893..407087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04450"
FT                   /product="transcriptional regulator, PBSX family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03179"
FT                   /db_xref="GOA:D8GZS0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS0"
FT                   /protein_id="ADK03179.1"
FT                   /translation="MKNQIYELRTENNISQGALADKCKVSRQTINAIENNKYDPSLALA
FT                   FRLAEVLGTTVDKLFLYKQ"
FT   gene            407100..407492
FT                   /locus_tag="BACI_c04460"
FT   CDS_pept        407100..407492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04460"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03180"
FT                   /db_xref="GOA:D8GZS1"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS1"
FT                   /protein_id="ADK03180.1"
FT                   /translation="MGKEKISLFVTILVAIGTLLYALYYWLTELQVNWYALFICSIALH
FT                   YLFKSSASHSVEGETEENQDLEKHVLKTSANVTYYVLVVFIFGLFFASVGFNRWIDFHN
FT                   IPLLFALCAAIVVKPAVEFLIVRRYR"
FT   gene            complement(407519..408793)
FT                   /locus_tag="BACI_c04470"
FT   CDS_pept        complement(407519..408793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04470"
FT                   /product="permease, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03181"
FT                   /db_xref="GOA:D8GZS2"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS2"
FT                   /protein_id="ADK03181.1"
FT                   /translation="MSRQEKSWILYDWANSVYSLVITTALFPIYFKAAAKEAGLSGATS
FT                   TAYWGYANSFATLLISILAPILGTVADYKGFKKRFFTFFFGLGIVFTSMLAVVPTSQWY
FT                   LLLGCYMLALVGFAGANIFYDAFLVDVTSEDRMDRISTRGFALGYIGSTIPFIGCIALI
FT                   ILAQKGTIPLSVGIASQISFAITALWWGLFTIPMLKNVEQTHYIERHPKPIAMSFKRLA
FT                   DTFKNIKEYKTVFMFLIAYFFYIDGVDTIITMSTAYGTDLGISATNLLIILFVTQIVAC
FT                   PFALLYGKLSTTFTGKKMLYVGIIIYIIICIYAYFLKTTLDFWILAMLVATSQGGIQAL
FT                   SRSYFAKLVPKESANEFFGFYNIFGKFAAIMGPVLVGVTTQLTGKTNAGVLSIIVLFII
FT                   GGFLLTRVPENNTSVTPPNPKTKTL"
FT   gene            complement(408910..410223)
FT                   /locus_tag="BACI_c04480"
FT   CDS_pept        complement(408910..410223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04480"
FT                   /product="possible type I phosphodiesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03182"
FT                   /db_xref="GOA:D8GZS3"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS3"
FT                   /protein_id="ADK03182.1"
FT                   /translation="MDKALTNRVIILSFDCLSALDFPILQKLPHFQSLIKKGTVVEKVE
FT                   PIYPSVTYPSHSTIVTGNYPNKHGVVSNTLLQPGRESPDWHWYRKSIKGTTLYDEAHKA
FT                   NLTTAALLWPVTGRANIDYNLPEIFPNRPWQNQVLVSLFSGSPLYQLDLNRRFGHIRNG
FT                   LSQPELDDFVLASAVHTIQTKKPNVMFVHFTDLDTQRHYHGFESKETIAAIHRHDERLG
FT                   QIIQALKDSDLYEESTIIALGDHSALSENKAIQLNVLFHQKGLISVNSKGNLVDWKVYC
FT                   QSCDGSAYVYVKDKNDTDTIREVQLLLEELLQHKQNGIEFILHDEDAKECGADGNCLFM
FT                   LEAREGYYFTENYTGDFIKDITEKDVTPSKKYTFGTHGYSPTKPNYETIFIAAGKGIKS
FT                   GVTIPYMRLIDEGPTIARLLGLHLGETDGSIVEDLLQL"
FT   gene            410359..410670
FT                   /locus_tag="BACI_c04490"
FT   CDS_pept        410359..410670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04490"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03183"
FT                   /db_xref="GOA:D8GZS4"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS4"
FT                   /protein_id="ADK03183.1"
FT                   /translation="MEGGNSMDWLDGFGIFYIIGGITIILVFAISYLLKKRFPDKQFDI
FT                   IFALSLILLCLASFPVTMMVIGGWKGMGYGFIGFFVLLGTLIGMIAHQLVKISRKSYV"
FT   misc_binding    410764..410970
FT                   /bound_moiety="uncharged tRNA"
FT                   /note="BACI_c04500; T-box leader, RF00230"
FT   gene            411018..412448
FT                   /gene="proS1"
FT                   /locus_tag="BACI_c04510"
FT   CDS_pept        411018..412448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS1"
FT                   /locus_tag="BACI_c04510"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03184"
FT                   /db_xref="GOA:D8GZS5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS5"
FT                   /protein_id="ADK03184.1"
FT                   /translation="MAKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYG
FT                   YALWENMQKVMDEKLKATGHENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGDEKL
FT                   AERLCVRPTSETLFCEHFSKIVQSYNDLPKLYNQWCSVVRWEKTTRPFLRTTEFLWQEG
FT                   HTIHETAEESQAETLNILNLYASFCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHD
FT                   GKALQTGTSHNFGTNFSEAFDIKFLDRTGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGL
FT                   VMPPKVAPVQVVIVPIAQHKEGVLAKATELQGHIQKVARVKIDASNKTPGWKFNEYEMK
FT                   GIPIRLEVGPKDIEKNQVVLVRRDTKEKEFISMDQLEERIPALLEEIHNSLFNKAKVFR
FT                   DENTYSVTSFEEMKKVADEKQGFIKAMWCGELACEEKLKEEVGVSSRCMPFEQEHLAEE
FT                   CVCCGKEAKQMVYWGKAY"
FT   gene            complement(412565..413428)
FT                   /locus_tag="BACI_c04520"
FT   CDS_pept        complement(412565..413428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04520"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03185"
FT                   /db_xref="GOA:D8GZS6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS6"
FT                   /protein_id="ADK03185.1"
FT                   /translation="MTKIFILASTLSLSFFSGLNIGNAATENFSPITNAIVQNNDYFAE
FT                   GNSKDNNKPPGNGGSQDDSDSDGNGSDGSGSGDNGSGGNGSGGNGSGGNGSGGNGSGGS
FT                   GSGDNGSGGNSSGGNGSGGNGSGGSGSGDNGSGGNGSGGNGSGGNGSGGNGSGGSGSGD
FT                   NGSGGNGSGGSGSGGSGSGDNGSGGNGSGGNGSGGNGSGGSGSGGSGSGDNGSGGSGSQ
FT                   GGNRVKGDSSSQGGNGSQGGNVKDNAKKQGDKLPNTATHYPASILMGLSTFLIGMLLFI
FT                   RRKNAK"
FT   gene            413632..414510
FT                   /locus_tag="BACI_c04530"
FT   CDS_pept        413632..414510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04530"
FT                   /product="ROK family protein; possible glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03186"
FT                   /db_xref="GOA:D8GZS7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS7"
FT                   /protein_id="ADK03186.1"
FT                   /translation="MKEYIAFDIGGTQIKYGIVSETGIVLKHKAVPTEIHLGGGQIIQK
FT                   LILLSKKLMSEHTISGIGISTAGIVDVNRGGVTGGADHIPGYSTIPIINRLQEVLKVPV
FT                   SIENDVNCAALGEKWNGIGREKENFIMLTLGTGIGGAIFIDGELYRGHSFSAGEWGNML
FT                   IEGKMFEEVASISGLIHLVRNYKGKGNWNGKTIFELYDKGDREVKQAVEVFFKHLAIGI
FT                   SNLAYIFNPETIIIGGGITDRGDQFLKEVKEEVGRYLNKEIYSDCEIELAQNGNRAGMI
FT                   GAIYHFLHHYK"
FT   gene            414639..415235
FT                   /locus_tag="BACI_c04540"
FT   CDS_pept        414639..415235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04540"
FT                   /product="probable tellurium resistance protein, TerD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03187"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS8"
FT                   /protein_id="ADK03187.1"
FT                   /translation="MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGS
FT                   KPNVDCDASVVMLEGDRFLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVEL
FT                   HKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPQTGEELTRYNLSDNYAGKTT
FT                   LIAGEMYRHGSEWKFSAVGEGTQDKNLSEIVSRYQ"
FT   gene            415259..415843
FT                   /locus_tag="BACI_c04550"
FT   CDS_pept        415259..415843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04550"
FT                   /product="probable tellurium resistance protein, TerD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03188"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZS9"
FT                   /protein_id="ADK03188.1"
FT                   /translation="MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQNDFDLDV
FT                   SIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDESIKVDLKNVPAHI
FT                   ERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGELY
FT                   RHAGEWKFNAIGSGFQGGLASLCNNFGLDVE"
FT   gene            415924..416502
FT                   /locus_tag="BACI_c04560"
FT   CDS_pept        415924..416502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04560"
FT                   /product="probable tellurium resistance protein, TerD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03189"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT0"
FT                   /protein_id="ADK03189.1"
FT                   /translation="MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDAS
FT                   AFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGDDEQLVVDLKKVPADVH
FT                   RIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCELYR
FT                   HNGQWKFNAVGSGFQGGLGALVRAYGLDA"
FT   gene            416576..417367
FT                   /locus_tag="BACI_c04570"
FT   CDS_pept        416576..417367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04570"
FT                   /product="integral membrane protein, TerC family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03190"
FT                   /db_xref="GOA:D8GZT1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT1"
FT                   /protein_id="ADK03190.1"
FT                   /translation="MSILQGILDTYAQFFDLDMWIKVLQDPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEEKRKKALFYGLIGAYVFRFIAIGIGMFLIKLAWVKVLGALYLAW
FT                   LSVKYFIDKRKGNAEEEEAHGMNQNSILFRMFGVFWGTVAMVELMDIAFSVDSVLAAFG
FT                   VSNEVWILLLGGMLGILMMRGIAGVFLKLLERIPELETTAYILILIIAAKMLLSVIHIE
FT                   VSHTLFFIILVVAFGATFILHYVKNSGQAKEEVAATKNNHK"
FT   gene            417477..419108
FT                   /locus_tag="BACI_c04580"
FT   CDS_pept        417477..419108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04580"
FT                   /product="possible tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03191"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT2"
FT                   /protein_id="ADK03191.1"
FT                   /translation="MFSRFTLQPYALKDESDLKHFETLLEKRPQYELTENEMKFSYIAC
FT                   RILGVPNDVDEYFNELFDYSEAKGIEVLHEQNLNKVIDSEKLRHIQEVFGLHQEAPNGL
FT                   TVNRLVAHLSGKQLLPKVDNPDLQHYIHTTFISVLKLYEKQHNQSLKTEGFRRFLIDMI
FT                   KLSENYVAKWFSTINYKKQMPRIIWYGDAQESRIYFLYFLIMLGCDVLYYHPEGKDGFE
FT                   NIDEEARTFVVSHSSRISLEPFPDRRRERVATVAYQASKEIEQVLHHDNSLLYKPWQFR
FT                   SYTPVARTLKTTYDELFLITKEKAFVRPTFFVENKHIYIPSLFAKISGVSKNDKEYFQR
FT                   LKAVTSFDNSLLINTFPFTKEQKANFQYHYRDALDRGGKLHPDLIMNSHWWPHKRLPEG
FT                   LQHGIAEAIIHTCESEMCKPIAKETKQDVALYVFAQLSQIPPNILEQLEKFDYSQDVPK
FT                   IVIFNNEKSGELTRSDAVLLLFLNQIGVDVFHFNPTGRNDIEPYIEAGAFDSHWLEEVN
FT                   FDLEFHGSSAYKNLSQTIKGLFRPFL"
FT   gene            419127..420209
FT                   /locus_tag="BACI_c04590"
FT   CDS_pept        419127..420209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04590"
FT                   /product="probable tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03192"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT3"
FT                   /protein_id="ADK03192.1"
FT                   /translation="MNNPVVLDSKTELNEQTAQDVRLQLRQDADVQRIYNAVDIKDQLE
FT                   LIELGKEPSMEISRFADQILHTMSLSKIEDSGELLKQLGKIMDRFDSKDFAEEKSGFFS
FT                   RMFKKADKMIEQIFSKYQTMGREIDKVYVEITKYQDEMKKSIGTLDGLYEQNLKYYLDL
FT                   EKYVVAGEMLLERLNTELVPMYEERVRNNDQLAGIELESLKNSVEILEQRIDDLEKARM
FT                   VALLTAPQIRMIQRGNNKLIGKINTAFITTIPIFKNGIIQAVNAKRQKLVADSMAELDR
FT                   RTNELLKKNAQNIATQSVEVARLSGSSSIKMETLEETWNIISRGMQETQQIEEQNKRER
FT                   EESRKRMATLTENIKKELQG"
FT   gene            complement(420245..422911)
FT                   /gene="pacL"
FT                   /locus_tag="BACI_c04600"
FT   CDS_pept        complement(420245..422911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="BACI_c04600"
FT                   /product="cation-transporting ATPase A, P type"
FT                   /EC_number="3.6.3.-"
FT                   /note="ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03193"
FT                   /db_xref="GOA:D8GZT4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT4"
FT                   /protein_id="ADK03193.1"
FT                   /translation="MSNWYSKTKDQTLIDLETNEQHGLTEEIVNERLTQYGANELATKQ
FT                   KRSLWQRIFAQINDVLVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQ
FT                   ALEALKKMATPKAIVKRDGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEE
FT                   SALTGESVPVDKDAICHPSMQSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQI
FT                   GKIATLLHEADDDMTPLQKSLAQVGKYLGFVAVAICIVMFLIGFLQGRDTLEMFMTAIS
FT                   LAVAAIPEGLPAIVSIVLAIGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNK
FT                   MTVTHFYSDNTYDQLERLNVNNDTQRLLLENMVLCNDASYNNESQTGDPTEIALLVAGS
FT                   TFNMQKDHLEKIHERVNELPFDSDRKMMSTVHTYDESYYSMTKGAIDKLLPLCTHIFKN
FT                   GKIEGLTEDDKNQILEAAEVMSQEALRVLSFAFKQYNSSDVDIDHLEENLIFIGLVGMI
FT                   DPPRTEVKDSISECKKAGIRTVMITGDHKDTAFAIAKELGIAEEISEIMIGTELDNISD
FT                   TELANKINHLHVFARVSPEHKVKIVKALRAKGNIVSMTGDGVNDAPSLKQADVGVAMGI
FT                   TGTDVAKGAADVVLTDDNFSSIVKAVEEGRNIYRNIKKSILFLLSCNFGEIIALFLAIL
FT                   LGWATPLRPIHILWVNLITDTLPALSLGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFN
FT                   GFVIGLLTLIAFIAGAKFYTGDTNLFPLFPERIDEDALLHAQTMAFVVLSFSQLVHSFN
FT                   LRSRTKSIFSIGIFTNKYLVFSLLIGVLMQVCIISIPPLANIFGVHALTMRDWGFVLLL
FT                   SIIPLVVSEFIKLVKRN"
FT   gene            complement(423103..423327)
FT                   /locus_tag="BACI_c04610"
FT   CDS_pept        complement(423103..423327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04610"
FT                   /product="acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03194"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT5"
FT                   /protein_id="ADK03194.1"
FT                   /translation="MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRD
FT                   IYEHVMKRETFSISEMQAITEELGTLIKK"
FT   gene            423502..423966
FT                   /gene="ptp"
FT                   /locus_tag="BACI_c04620"
FT   CDS_pept        423502..423966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptp"
FT                   /locus_tag="BACI_c04620"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03195"
FT                   /db_xref="GOA:D8GZT6"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT6"
FT                   /protein_id="ADK03195.1"
FT                   /translation="MVQVLFVCLGNICRSPMAEAIFRDLVVKEGLEEKIVIDSAGTGDW
FT                   HVDHPPHKGTQKILKENAVTFEGIKARQVEKEDLTKFDYIIAMDNKNIADLKSLGKTGG
FT                   YIGRLSDFVPDGGWTDVPDPYYTGNFQEVYDLVTEGCAKLLAFIRNEQGI"
FT   gene            424020..424535
FT                   /locus_tag="BACI_c04630"
FT   CDS_pept        424020..424535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04630"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03196"
FT                   /db_xref="InterPro:IPR025276"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT7"
FT                   /protein_id="ADK03196.1"
FT                   /translation="MAKKNNIARNIAIGVAAGVAVSMLKKENREKVKNTAEKAKTKMIE
FT                   IGENAKIKEKVQTVTDKGRELADLNVVKAKVAEIKKLTPSVVETLKETKEIFSKKKVEP
FT                   AEKPETIEIQAVSPKVDELKVEEEPVVAEDGGMKEARELFMKDSNVEEKKTEAYIELKQ
FT                   DKEEKKRV"
FT   gene            424542..425411
FT                   /gene="rbn"
FT                   /locus_tag="BACI_c04640"
FT   CDS_pept        424542..425411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="BACI_c04640"
FT                   /product="probable ribonuclease BN"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03197"
FT                   /db_xref="GOA:D8GZT8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT8"
FT                   /protein_id="ADK03197.1"
FT                   /translation="MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIF
FT                   PGLVFLITLLGFIDLQTESVLNLLEPYVPEDAMSLIEVNVDKVVNEQNGGLLSFGLLSM
FT                   LWFASNGVNAVMNAFNRAYDVKETRSFIKTRALSIVFTLAIIFMIVFALIVPVFGQVIG
FT                   AAVFKVIGLSDSFSYVWSITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGATFATV
FT                   GWIVVSYSFAYYVDKFANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTG
FT                   DNNSRNEK"
FT   gene            complement(425353..425550)
FT                   /locus_tag="BACI_c04650"
FT   CDS_pept        complement(425353..425550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03198"
FT                   /db_xref="GOA:D8GZT9"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZT9"
FT                   /protein_id="ADK03198.1"
FT                   /translation="MSVRTTTRFMLWMRTALLFIVIFIVVILFIITHEISPLFLIIMEQ
FT                   EVTFHYGNYCHPSYNDGVNH"
FT   gene            complement(425596..427521)
FT                   /locus_tag="BACI_c04660"
FT   CDS_pept        complement(425596..427521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04660"
FT                   /product="cation-transporting ATPase, P-type"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03199"
FT                   /db_xref="GOA:D8GZU0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU0"
FT                   /protein_id="ADK03199.1"
FT                   /translation="MNSEVKTLQVQKSISHPSLWDTLKKHYELIFAIASGIFILAGWLF
FT                   TKNDVMNVGITCYILAYIVGGYAKAKEGIEDTIEEKELNVEMLMLIAAIGAAMIGYWAE
FT                   GAILIFIFALSGAMESYTLSKSQKEISALLDLQPEEALRISNGTEERVPVGRLQINDII
FT                   LIKPGERVPADGTIHSGETNIDEAAITGEPIPNEKKHGDEVFAGTVNLRGAIEVKITKP
FT                   SDQTLFQKIIRLVQSAQSEKSPSQLFIEKFEGTYVKGVLLVVTLMMFVPHFLLDWSWNE
FT                   TFYRAMILLVVASPCALVAAITPATLSAISNGARNGILFKGGIHLERLASVKAIAFDKT
FT                   GTLTEGKPTITDVYVRENMTEKEVLSITAAIESHSTHPLAESIVKYAQHTYDITLKKPE
FT                   NVEDVTGFGLKGIFESKAYKIGKADFIGEETKTFHNGVSASLEKEGKTVVYISDENGIL
FT                   GLIALKDTLRQETIAAIRELQSIGVEAIMITGDNEETAKAIASESNIKEYYASCLPETK
FT                   VETIKKLKEKYGTVAMVGDGINDAPALATASIGVAMGEGTDVALETADVVLMKNELSRL
FT                   SQAIRLSKRMNRIVKQNVIFSLAVIAMLICSNFLQFLALPFGVIGHEGSTILVILNGLR
FT                   LLKGNN"
FT   gene            427792..428742
FT                   /locus_tag="BACI_c04670"
FT   CDS_pept        427792..428742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04670"
FT                   /product="permease, drug/metabolite transporter
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03200"
FT                   /db_xref="GOA:D8GZU1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU1"
FT                   /protein_id="ADK03200.1"
FT                   /translation="MKTEKFFTHPIGVFIAAIVATFLWGSAFPFIKLSYAELGIQPKEV
FT                   GEQILFAGYRFFLSGVMLLFFFKLLGKDMNFKKGTGKQLVQIGLFQTFLQYICFYIGMS
FT                   YSSGIEGAIISGTSSFFQIILAHFLYKDDALNMRKIIGVSIGFCGVVLVNVPSDGSLSF
FT                   HFGIGSLLLLSAAMLYSYGNILAKEGSKTLDVGYMTAYQMIFGSIGLLCIGALQVGIMP
FT                   FTFSVHAILMLIYLSFLSAAGFCIWNTIMKYNKVGKVSMYMFFIPVFGVLLSSMILGEA
FT                   IHSFVLFGLACVAAGIIVVNRTPAKQKIEQEKQVA"
FT   gene            428865..429545
FT                   /locus_tag="BACI_c04680"
FT   CDS_pept        428865..429545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04680"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03201"
FT                   /db_xref="GOA:D8GZU2"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU2"
FT                   /protein_id="ADK03201.1"
FT                   /translation="MNLLYMVLIGQIILFLIGAIYAIGQTKKTTNNMPLPLVVRLILSF
FT                   SLTISAIWIWLQDPSVEYSTWVALGMTLSTVGDLFMAGLIPIGHRLIGGMITFALAHCF
FT                   YVKAFLQTGISWNGFWIGLLIYGLFLIIGWFFFIRNDKQDKLFTIGALIYGLWVGGMAC
FT                   FAFALYYENTGIWWIPAFGGLLFVISDFIIGVTDIGGRKLKYEPLWIWFTYVAAQMCIV
FT                   YVGL"
FT   gene            429892..430311
FT                   /gene="sip"
FT                   /locus_tag="BACI_c04690"
FT   CDS_pept        429892..430311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sip"
FT                   /locus_tag="BACI_c04690"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="SPase I"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03202"
FT                   /db_xref="GOA:D8GZU3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU3"
FT                   /protein_id="ADK03202.1"
FT                   /translation="MKPTLQDGDKVIVNKLAKQFESYGREDIIVVKTDNFYVKRVIGLP
FT                   GDVIEVRNDQLYVNHEVIEEAYLQSNKKQAEKKLMNLTEDFGPITVPKNKIFVMGDNRL
FT                   ISRDSRNGLGLIDKADVLGELAVIYYPFEHMKIIN"
FT   gene            complement(430355..433117)
FT                   /locus_tag="BACI_c04700"
FT   CDS_pept        complement(430355..433117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03203"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU4"
FT                   /protein_id="ADK03203.1"
FT                   /translation="MTIENQFIQKVYYKTFLTEETSTPVSDVLGEAYINESTNEFSNIS
FT                   NIRFAQGELYYQNKDFEAAIFKWEKVNNELALWATKNIADAYFELGFLPKAEEMYQSIQ
FT                   TEDTTLTMEVSLQLLSLYIEQDRLGLAFKTISEAVAFQPDYPNITSIARSFYEKQEDWN
FT                   NAIELAVQEGIRTKSLHWFDTLINYVNQGFTKQIKPEYFYESLKALYAIDQVQFKELVI
FT                   ALWNSYQNEKSHLPWIETINHLFLHIETDNNDDWHEIVERYQDTYFELITGEHFMHEMQ
FT                   GLVPDLLTNWFSLTKAKDALFVSAAVLAWNEVSPTTLESLLVKSAGALLSNSTAETNVN
FT                   METVSHLFETIAVWAEKNDVDLSHQFTLLVHELCDLNVTQLLIAGTSDHDKLSFVNSIL
FT                   GENILTETITTPILFKDDSQTEITEFTALDVHNIPNFDEFHQIMATSDQSELENKCIEI
FT                   KLPSRFLRKNKFAFLVTPSVQGQVDKNSSYFEYLQAADSLIYVLNSASPLHGKELDTLL
FT                   YLREQVPNLQIHFVLHTNSADKNEKLMSKIKVHFPNAQFFPYSPSQESSQQLGNVTESI
FT                   LSNLATRDIEQERIEKLIWFTQKTIAYLVNERVELENTLVKSVRWNKHISVKLNGFINN
FT                   LTALEKDKIRSITESYLLTKEEITRDIHSQIPELLQSCSDLVQEDSDFKLVHEELNTAM
FT                   NERIQKHVQQVLLPKFTGFIQDWIETAHNEFIQAQSYLDEMSETFNKLYKEERMKLPCD
FT                   FKLLDDWHRDVVRMTNRITVSNINILLRFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQ
FT                   YIETEDYTEIAQTISKQFFLQFEVFEGALERDIMMFFKDPLSILKQNVEAAQLEIQEDE
FT                   QTLATLRSNPETYHDPLAFFKLQLLQHKFILSTHKNNEDIYEFNESPTI"
FT   gene            433592..434188
FT                   /locus_tag="BACI_c04710"
FT   CDS_pept        433592..434188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04710"
FT                   /product="conserved hypothetical transmembrane protein,
FT                   DedA family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03204"
FT                   /db_xref="GOA:D8GZU5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU5"
FT                   /protein_id="ADK03204.1"
FT                   /translation="MEQHIGELIAHYGYFGIIIALAGGIVGLPIPDEFLLTFVGYNVSK
FT                   GVMSGTAAFLSGMAGAMLGITLSYILGLKLGLPVLKKYGPKIRIKEHHIEKTHVLFEKY
FT                   GPFLLMIGYFIPGVRHLTAYFAGMSNLTIWRFCLYAYGGALIWISVFIGLGWKLGEKWR
FT                   FVEYSLHHYGIWILSISVVVTCVVWFYIKKKKNRE"
FT   gene            complement(434198..434626)
FT                   /locus_tag="BACI_c04720"
FT   CDS_pept        complement(434198..434626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04720"
FT                   /product="permease, drug/metabolite transporter
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03205"
FT                   /db_xref="GOA:D8GZU6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU6"
FT                   /protein_id="ADK03205.1"
FT                   /translation="MSSWLLFALLSAIAAALVSIFGKIGLDGIDANVATTVRSIIMALF
FT                   MVGVIIIQGKFQNIGDVLLNKKALLFITLSGVAGASSWLFYFLALKTGKVSQVAPVDKL
FT                   SVVFSIILAMIILGEKLNFMTGIGVVFITAGVLFIAFS"
FT   gene            complement(434733..434879)
FT                   /locus_tag="BACI_c04730"
FT   CDS_pept        complement(434733..434879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03206"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU7"
FT                   /protein_id="ADK03206.1"
FT                   /translation="MKREERKNMIEFIEKKKGIERDELLFMTDDEVEHIYNVTYFLYEE
FT                   IAE"
FT   gene            complement(435034..435450)
FT                   /locus_tag="BACI_c04740"
FT   CDS_pept        complement(435034..435450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04740"
FT                   /product="general stress protein 26"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03207"
FT                   /db_xref="GOA:D8GZU8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU8"
FT                   /protein_id="ADK03207.1"
FT                   /translation="MHLKEKIATIIQGQRTGVLSTVRNDKPHSAFMMFFHEDFVLYVAT
FT                   DRQSKKITDIENNPNVHVLLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWL
FT                   LGPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL"
FT   gene            435632..436687
FT                   /locus_tag="BACI_c04750"
FT   CDS_pept        435632..436687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04750"
FT                   /product="Ca2+/H+ antiporter"
FT                   /note="calcium/proton exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03208"
FT                   /db_xref="GOA:D8GZU9"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZU9"
FT                   /protein_id="ADK03208.1"
FT                   /translation="MFNKIFLIVALIGVPLSVLGKIFHWPQTIMFAVYCITIIALAGFM
FT                   GRATESLAIVSGPRIGGLLNATFGNAVELIISIFALQAGLIEVVLASLTGSVLGNLLLV
FT                   GGLSFFVGGLKYKRQSFNVYDARHNSALLIFAVVVAFVIPEIFSMKMDASKTYQLSIGV
FT                   SIIMIIMYLAALLFKLVTHRGVYQHKSDEVAHEEEPEWSKGKALLILAIATIAVAYVSE
FT                   ALVHTFETVAKSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKVNIAVEIAVGSTLQ
FT                   IAMFVAPVLVLLSMFFTQRMPLVFTIPELVSMITAVFLTIAISNDGDTNWFEGGTLLAA
FT                   YVIMGIGFYLL"
FT   gene            436769..437566
FT                   /gene="yfkD"
FT                   /locus_tag="BACI_c04760"
FT   CDS_pept        436769..437566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkD"
FT                   /locus_tag="BACI_c04760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03209"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV0"
FT                   /protein_id="ADK03209.1"
FT                   /translation="MKRVYSICLSTMVSFILLFPNMSFAKTTVETKMPSSVLNISKDNT
FT                   FPNDAQDLPRLQPSKFAQELLKTANIKIENPDLIRMFNETTISNAPLAVGYRAKIYLGQ
FT                   WALHYESIDTSINWEYKQVNRNVYDNRGGDRLYPLRYKQETQKTVEGDLTADMKDAADV
FT                   KKMMLLKALEKVQLPLSFKTTIGYGTGHERVYNISPSQLGYLYAYTPAVNEKGKVTFGE
FT                   VYLVLKGNQKRLVVKNITSQGIGAAIPIHDHLFFKFISSSHSQ"
FT   gene            complement(437601..438728)
FT                   /locus_tag="BACI_c04770"
FT   CDS_pept        complement(437601..438728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04770"
FT                   /product="probable moaA/nifB/pqqE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03210"
FT                   /db_xref="GOA:D8GZV1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV1"
FT                   /protein_id="ADK03210.1"
FT                   /translation="MTISQKMKPITPSYDPWEAYMDLEEYGKLLLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQPKDPNPLPMDLLLKRLDEIPHLRSLSITGGEPMLSKKSVDNYVTPLLK
FT                   YAHERGVRTQINSNLTIDLARYEQIIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTYE
FT                   QRAKLFERMITNSKALSDAGVLVSAETMLNKRTLPHIEHIHRQIVDEMGCKRHEVHPMY
FT                   PSDFASNLEILTKAEIRDAIEHLLEIRDENVWMLFGTLPFYACSDDERDIATFRKLQES
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDVPLLGNIQTNTLQEAYEKWSASKTAKSL
FT                   SCHCPAVKCLGPNVLVKNSYYPTEDFLSKTANITL"
FT   gene            438942..439124
FT                   /gene="yfjT"
FT                   /locus_tag="BACI_c04780"
FT   CDS_pept        438942..439124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjT"
FT                   /locus_tag="BACI_c04780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03211"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV2"
FT                   /protein_id="ADK03211.1"
FT                   /translation="MGKAIQDKDTQLVYLKERLNMFIEVIDTIEPEEVELEDVDRLLAM
FT                   LDELELKCEQFKKDE"
FT   gene            439331..440851
FT                   /gene="fumA"
FT                   /locus_tag="BACI_c04790"
FT   CDS_pept        439331..440851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BACI_c04790"
FT                   /product="fumarate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03212"
FT                   /db_xref="GOA:D8GZV3"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV3"
FT                   /protein_id="ADK03212.1"
FT                   /translation="MEKLQESMYQLIVETSTNLPKDVRRAIQQAKERENAGTRSAMALG
FT                   TITNNIKMADDNISPICQDTGMPTFKIYTPVGVNQLKLKEAIYNALERATKDGKLRPNS
FT                   VDSLFGDNSGNNLGPGTPVIKFEQWEKDYIDARLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLEGIRKCLLHAVYQAQGQGCSAGVIGVGIGGDRTSGYELAKNQLFRTLDDVNPIP
FT                   ELQQLEEYVLENANKLGIGTMGFGGETTLLGCKIGVYNRLPASFYVSVAYNCWAYRRLG
FT                   VTIHPETGEIMDWLYQEGDDTLQQEAQEKTEQREIVLQAPITEEQIRELRVGDVVTING
FT                   MMYTGRDAIHKHLMDNDCPVDLNGQVIYHCGPVVVKDENDNWQIKAAGPTTSIREEPYQ
FT                   GDIMKKFGIRAVIGKGGMGAKTLAALEEHGGVYLNAIGGAAQYYAECIKEVKDVDFLQF
FT                   GIPEAMWHLRIEGFKAVVTMDSHGNSLHADVDKTSLEKLASFKEPVFK"
FT   gene            440978..441760
FT                   /locus_tag="BACI_c04800"
FT   CDS_pept        440978..441760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04800"
FT                   /product="polysaccharide deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03213"
FT                   /db_xref="GOA:D8GZV4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV4"
FT                   /protein_id="ADK03213.1"
FT                   /translation="MKHKWLYIGLIFSIMMALVPVSALAYTNTPHNWGIPRPKNETVPD
FT                   AGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGH
FT                   YIKTQKDLLLRMKDEGHIIGNHSWSHPDFTAVNDEKLREELTSVTEEIKKVTGQKEVKY
FT                   VRPPRGVFSERTLALTKEMGYYNVFWSLAFLDWKVDEQRGWQYAHNNVMTMIHPGSILL
FT                   LHAISKDNAEALAKIIDDLREKGYHFKSLDDLVKSNQP"
FT   gene            441820..442683
FT                   /gene="alkA1"
FT                   /locus_tag="BACI_c04810"
FT   CDS_pept        441820..442683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA1"
FT                   /locus_tag="BACI_c04810"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03214"
FT                   /db_xref="GOA:D8GZV5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV5"
FT                   /protein_id="ADK03214.1"
FT                   /translation="MWSEHVTLEYPYHFEEVLKRLSFDPLNVIQLDEKVIYVPLCIDEE
FT                   QIVVRLQGIGTVQNPQFWISSQTGDPEKVMKRMRAIFHWNEPFQDIQNHFLNTSLRPLF
FT                   ETYAYTPIILEFDYFACLLRCIIHQQINLKFATVLTEQFVKRYGTEKNGVFFFPTPEIV
FT                   ANISIEELREQKFSQRKAEYIVGLGQSIASGTLNLASIETRAEEEVSARLLPIRGIGTW
FT                   TVQNFLMFGLGRKNMFPKADIGIQRAVQGVFQLDDKPDDAFLEKVKQECEPYCSYAALY
FT                   LWKSIE"
FT   gene            442694..444073
FT                   /locus_tag="BACI_c04820"
FT   CDS_pept        442694..444073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04820"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03215"
FT                   /db_xref="GOA:D8GZV6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV6"
FT                   /protein_id="ADK03215.1"
FT                   /translation="MIQKQHESKLEVGQTFPVTIKRLGINGEGVGYFKRQVVFIPGALP
FT                   GEEVVAETTKIQRGFAEAKVKKVRKASPHRVKAPCPVYEECGGCQLQHLDYKEQLNQKR
FT                   DIVVQAFEKYMKNSMEEKIRPTLGMENPWHYRNKSQLQVGRKDEKVITGLYKQNSHQLI
FT                   DIAHCMIQHKATNEATKVVRRILEKLNVSIYNEKKQKGLVRTIVTRTAVQTGEVQVTLI
FT                   TTKEELPNKEQFIAEVQKQMPAVKSIMQNVNWRKTSVIFGDKTFKLAGKEVIQETLGDL
FT                   SFELSARAFFQLNPEQTVVLYNEAKKAAALTGNEKIVDAYCGVGTIGLWLANDAAEVRG
FT                   MDVIPEAIADARKNAKRHGFTNTKYEAGKAEQWLPKWVKEGWRPDVIVVDPPRIGCDDK
FT                   LLETILKVKPKQVVYVSCNPSSLARDVQALMKSYEVEYVQPVDMFPHTAHVENVVKLVR
FT                   K"
FT   gene            444130..444867
FT                   /gene="truA2"
FT                   /locus_tag="BACI_c04830"
FT   CDS_pept        444130..444867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA2"
FT                   /locus_tag="BACI_c04830"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03216"
FT                   /db_xref="GOA:D8GZV7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV7"
FT                   /protein_id="ADK03216.1"
FT                   /translation="MNNYKLTIQYDGARFKGWQRLGNNDNTIQGKIESVISEMIGKEIE
FT                   IIGCSRTDAGVHALNQVANFQSDEKLVEHKVKKYLNQYLPNDISITNVEEVHDRFHARY
FT                   NSKAKTYLYKIWNEEHTNPFMRKYSMHVNKKLNVKSMKEAAKHLVGSHDFTAFSNAKSK
FT                   KKSMVREVYSLEVMEEAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLAAEAIPQILE
FT                   AKQRNQINCLAEASGLYLENVEF"
FT   gene            complement(444918..445121)
FT                   /locus_tag="BACI_c04840"
FT   CDS_pept        complement(444918..445121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03217"
FT                   /db_xref="GOA:D8GZV8"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV8"
FT                   /protein_id="ADK03217.1"
FT                   /translation="MSNDNKLKLLQYLYFFPAILCMMLFINTDTSSFPYAKLLGTISGS
FT                   FAAIMLAAFWNFKIRMKREKSS"
FT   gene            complement(445233..446636)
FT                   /gene="rocR1"
FT                   /locus_tag="BACI_c04850"
FT   CDS_pept        complement(445233..446636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR1"
FT                   /locus_tag="BACI_c04850"
FT                   /product="arginine utilization regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03218"
FT                   /db_xref="GOA:D8GZV9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZV9"
FT                   /protein_id="ADK03218.1"
FT                   /translation="MRTEEINLKQIIEMNMLYETLLNELDIGIHIINEESKTIIYNRKM
FT                   MEIESMERSDVLYKSPLEVFAFEENKNSTLIEALKLGKTNKNIKQTYFNNKGQEITTIN
FT                   DTFPIIENGKIKGAIEISKEMNHLKQTIKMDSFRKQNTKFTFDHIIGDSEAIQSTIAEG
FT                   KRVIRTSSSILLVGETGTGKELFAQSIHNESQRSTKPFISQNCAAIPDTLMESLLFGTN
FT                   RGAFTGAIDKAGLFEEANGGTLLLDEINSLSPALQAKLLRAIQEKTIRRIGGTQEKEID
FT                   VRIIATINEDPLEAITYNRLREDLYYRLSVVTLCLPPLRERKEDISALVQHFIEKYNIQ
FT                   FGLAVTDVDIHVREFLYAYDWPGNVRELEHIIEGSMNLVEDENIITAFHLPTRFREQIK
FT                   KEFNTQPFLTNNDTDAPKTLKHTIAEMEKNYITQILKEYHGNISQAAKFLGLSRQNLQY
FT                   RIKKLHLNI"
FT   gene            446910..447164
FT                   /locus_tag="BACI_c04860"
FT   CDS_pept        446910..447164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04860"
FT                   /product="possible biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03219"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW0"
FT                   /protein_id="ADK03219.1"
FT                   /translation="MKTVIEGVYSPCYGKVEKLFVKESSYVYEWEKLALIETIDKQKVE
FT                   IKVGISGYIESLEVVEGQAIADQKLLITMRDDLLITGSD"
FT   gene            447270..448691
FT                   /gene="rocE1"
FT                   /locus_tag="BACI_c04870"
FT   CDS_pept        447270..448691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocE1"
FT                   /locus_tag="BACI_c04870"
FT                   /product="amino acid ABC transporter,possible arginine
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03220"
FT                   /db_xref="GOA:D8GZW1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW1"
FT                   /protein_id="ADK03220.1"
FT                   /translation="MMNQNQGLKRELKSRHIFMIALGGVIGTGLFLGSGYTIHEAGPGG
FT                   AIVAYLVGGFVMYLTMLCLGELAVAMPDAGSYQTYATKHISPAAGYVVGWMSWLNWSAT
FT                   IGIELIAVSILMKRWFPDVPSWIWCVVFAVLLFAINALSSRSFAEVEFWFASIKVITII
FT                   AFIILGGAAMFGFLDMKGNEPAPMFSSFTDYGGLFPNGLSAILITMIAVNFSFQGTELV
FT                   GIAAGESENPEKTIPKAINNTVWRILVFFVLSIFILAGLFPWQQAGVIESPFVVVFDKI
FT                   GIPYAADIINFVIITAVLSVANSGLYATSRMLWSMSNQGMISPIFGKLSKNGVPIYALI
FT                   VSTIVGCLSLLSGIYAEDTVYLWLLSIAGFGAILVWASIALSNLLARRSYIKQGGDVKD
FT                   LKFKTPLYPFVPLLALVLNVTVIVGMAFIPEQRMALYCGIPFMIVCLLFDRATRNKAHK
FT                   VEHIEKTDTTEVESL"
FT   gene            448787..450067
FT                   /gene="argE1"
FT                   /locus_tag="BACI_c04880"
FT   CDS_pept        448787..450067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE1"
FT                   /locus_tag="BACI_c04880"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03221"
FT                   /db_xref="GOA:D8GZW2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW2"
FT                   /protein_id="ADK03221.1"
FT                   /translation="MNEEVSQLLEQIDLRKDELLELTKTLIRFETPAPPARNTNEAQEF
FT                   VAEFLRKRNFSVDKWDVYPNDPNVVGVKKGTESDTHKSLIINGHMDVAEVSADEAWETN
FT                   PFEPFIKNGWLVGRGAADMKGGLAGALFAIQLLQEAGIELPGDVIFQSVIGEEVGEAGT
FT                   LQCCKRGYNADFAVVVDTSDLHMQGQGGVITGWITVKSPQTFHDATRRQMIHAGGRLFG
FT                   ASAIEKMMKIVQSLQELERHWAVMKTYEGYPSGTTTINPAVIEGGRHAAFIADECRLWI
FT                   TVHFYPNETHEQIIKEIEEYIGKVAAADPWLSENPPQFKWGGESMIVDRGEIFPSLEID
FT                   SEHAAVKTLSSVHESILSKNAILDMSATVTDGGWFSEFHIPAVIYGPGTLEEAHSINEK
FT                   VEIEQLIEFTKVITAFIYEWCHTKKID"
FT   gene            complement(450162..450815)
FT                   /locus_tag="BACI_c04890"
FT   CDS_pept        complement(450162..450815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04890"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03222"
FT                   /db_xref="GOA:D8GZW3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW3"
FT                   /protein_id="ADK03222.1"
FT                   /translation="MPKDNPNERLSKLIKKLLKERALSMRQLGMLTSIDPATISRIMNG
FT                   KQPPKQKHLQKFAECLQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFD
FT                   FDYTTTRVKQELENYERYAQTTEGEKRIHESFASKLEQIDSAGPFIEQLTDMYQQFCNE
FT                   TISKEERAVLGGALLYFILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT"
FT   gene            450945..451556
FT                   /locus_tag="BACI_c04900"
FT   CDS_pept        450945..451556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04900"
FT                   /product="probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03223"
FT                   /db_xref="GOA:D8GZW4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW4"
FT                   /protein_id="ADK03223.1"
FT                   /translation="MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFL
FT                   GFLFTLLAGFFGNWIALFISEFTANLIGAIVLGIIGMFILCQPFLGQKNTVGSKDGNVL
FT                   MGILRDPEKADFDGSKTISFSEAVVLGVALSINNIAGGFDAGVTNLNLWLTATISGVFS
FT                   FICISGFAYVGKRFLAEYLGKWATVIAGLLLIFIGIDQLL"
FT   gene            451671..451829
FT                   /locus_tag="BACI_c04910"
FT   CDS_pept        451671..451829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03224"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW5"
FT                   /protein_id="ADK03224.1"
FT                   /translation="MGRGKAFDHKKKGHDHQPPKGAFIHKDVNEHTLEEEELPVNIEAY
FT                   KNSLKKH"
FT   gene            complement(451852..452193)
FT                   /locus_tag="BACI_c04920"
FT   CDS_pept        complement(451852..452193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03225"
FT                   /db_xref="InterPro:IPR025083"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW6"
FT                   /protein_id="ADK03225.1"
FT                   /translation="MKLIFQMGKQPVLEKTILLFILSIVESLKLKVVSLDEAHRYIFNL
FT                   EVLELLMDRNIDDQVLELIHFGMGLEDIHHVLPEELEHTIEELKWLCIQVLSEYSMHEE
FT                   SEQLIEDIR"
FT   gene            complement(452369..453298)
FT                   /gene="glsA"
FT                   /locus_tag="BACI_c04930"
FT   CDS_pept        complement(452369..453298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BACI_c04930"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03226"
FT                   /db_xref="GOA:D8GZW7"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW7"
FT                   /protein_id="ADK03226.1"
FT                   /translation="MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIF
FT                   HKETEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLE
FT                   TTSPSKPLNPMINAGALAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSEL
FT                   ETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYK
FT                   KKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFG
FT                   PALDANGNSIAGFKILELLSAQEGWSIF"
FT   gene            453623..455125
FT                   /gene="nagE"
FT                   /locus_tag="BACI_c04940"
FT   CDS_pept        453623..455125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="BACI_c04940"
FT                   /product="PTS system, N-acetylglucosamine-specific EIIBC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03227"
FT                   /db_xref="GOA:D8GZW8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW8"
FT                   /protein_id="ADK03227.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGLLLRLGQPDVFDIPVMAQAGAA
FT                   VFDNLALIFAIGIAIGLSVDGSGAAGLAGAIGYLVMKNSIDALSKGYSTAELQDKLGKV
FT                   QDLIGNSANVDPSKLADTMTQVSKAAELSTKVDMKVLGGIIVGVIAGLLYNKFHKIKLP
FT                   EWLGFFAGKRFVPIVTSVVMLILGILFAQIWPTIQNGIDALAHGIVNLGAIGSGLFGLL
FT                   NRLLIPIGLHHVMNTYFWFVFGDFTNAAGNVVNGDIARFLAGDKTAGMFMTGFFPVMMF
FT                   GLPAACFAMIAAAKPEKRKMVTGMLGGLALTSFLTGITEPIEFSFMFLSPVLYGIHAVL
FT                   TGLSLFITTSLGIHDGFSFSAGAIDYALNFGIATKPVLLAGIGLIYAAIYFVVFYFLIK
FT                   KFDLKTPGREDEEEVVEGEEAPVAGSIGETYVLALGGKENLTVIDNCATRLRLQVKNAG
FT                   QVNEAALKRAGAKGVMKLSNTSVQVIVGTNVESVADDMKKHV"
FT   gene            455380..456621
FT                   /gene="pbpX"
FT                   /locus_tag="BACI_c04950"
FT   CDS_pept        455380..456621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="BACI_c04950"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03228"
FT                   /db_xref="GOA:D8GZW9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZW9"
FT                   /protein_id="ADK03228.1"
FT                   /translation="MDHEKNNANGKSRRPIVYIKRTIILVLLFSLVYFMYTKIVAHNKK
FT                   EETLKAAAEMKKQEELKKKEEKKKQEAKKQIEQEEQVKQAQAAEQPAEGPPQEINENAQ
FT                   LDQYLQNIGFSGTAVIVKNGKVLVNKGYGMANKEKQVPNNSETTFYIGSISKAFVATAI
FT                   MQLKDLHKLNVEDTVAKYIPDFPQGKSIQLKHLLTHTSGIPEYEQGTEDISHEELIKRI
FT                   GKQKRIGSPGEKWKYSDSNYSILAYIAEKVSGQPLEEYIKQHIFAPAGMKHSGFGRELE
FT                   QTRFPSTGYKIVNNNMTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALFSGKLISKESYD
FT                   QMFTGGKKDYGFGWYVDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQNNIKSFGK
FT                   VNNDIYTMLRNIEV"
FT   gene            456699..456932
FT                   /locus_tag="BACI_c04960"
FT   CDS_pept        456699..456932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03229"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX0"
FT                   /protein_id="ADK03229.1"
FT                   /translation="MDDKEFGKVTGDLSATMQKIDWRDGTHIDVKEDSIPLEAVKYFSA
FT                   SGGSLVTASISERAELPRAVYYSVSAIVTIKN"
FT   gene            457098..457499
FT                   /locus_tag="BACI_c04970"
FT   CDS_pept        457098..457499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03230"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX1"
FT                   /protein_id="ADK03230.1"
FT                   /translation="MCLFGKYWEKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQ
FT                   RNSKQATEEVIESSRFQSIICNILKECNTSPFKEIAEQYLGKNVEITVTVGQLTGVIVA
FT                   VGDDFLILQEGIGTEVLLPFASIISIKEA"
FT   gene            457516..457710
FT                   /locus_tag="BACI_c04980"
FT   CDS_pept        457516..457710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03231"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX2"
FT                   /protein_id="ADK03231.1"
FT                   /translation="MLFTDELRNHVGELVQVVTAVEIVSGVLLSVTDGAVSVRTSPSYG
FT                   PPEDVIVRIPVIAYVRLEG"
FT   gene            457691..459277
FT                   /locus_tag="BACI_c04990"
FT   CDS_pept        457691..459277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c04990"
FT                   /product="glycosyltransferase, involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c04990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03232"
FT                   /db_xref="GOA:D8GZX3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX3"
FT                   /protein_id="ADK03232.1"
FT                   /translation="MFAWKGKRDKSMKVSVVIPVHNEASTLSKVLAEVKKLEPYEIIIV
FT                   DNGSTDGTKEIALQHHCRVIYYNHSLGNDVGRAIGAREAKGEIVLFLDGDIVMKSEELY
FT                   PFIKGIQQGHQIVLNNLTWSVYLKVRPHYTTVGKYMLNRYLNKKEFVVGSLIAIPHAIS
FT                   REVIEKLGWWNLADPALFQAMAMSRGVDISDMASVDVIYTNKVRPVHTGTSPDSPYPKA
FT                   TSRIMGDHLRALQYITETYGKRGGFSEGNRDREFIGKYKPVVLKKEKAKYSAIIPVSEE
FT                   KTTIRSVIQEVKKAGVDEIIIVANGADIETIKQVNLENVIVIEFEEAIGHNVARAVGAM
FT                   HATADICLFVDGGLIIPAKKLVPFLRAIEDGSDMALNDLQCLLDIFHPADPISMGKYFV
FT                   NLVAKRPDLWNNSLTAVPHAIHKKVIEKIGYDSLIIPPLAQMKAILEGFSITTVEFVDV
FT                   IKTNRVRPEQHEFVNGRISAFDRIFGDQLEAIAYLLQHTDERGGFTDGDRDREIIQQLR
FT                   REEENTNEYWS"
FT   gene            459261..460505
FT                   /locus_tag="BACI_c05000"
FT   CDS_pept        459261..460505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05000"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family
FT                   protein"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03233"
FT                   /db_xref="GOA:D8GZX4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX4"
FT                   /protein_id="ADK03233.1"
FT                   /translation="MNTGRKVAIIGLGYVGLPLAVHLAERGHTVLGLDKDTRKIESIIK
FT                   GESYIPDVSSKELQSLLTKKKLIVNTPDQGIAEFQNSDYVIVTVPTPINEQREPDLSAL
FT                   ISASHYIQQNLQKGQTFIFESSTYPGTLEEVIIPIISQTGKKAGEDFYIGYSPERIDPA
FT                   NSQYSVQTIPKVISGQTEKCKQKVQALYSTIFDVVVPVSSPKVAEMCKLFENIQRLVNI
FT                   SLVNELNTLCESLGIDFYEALEAASTKPFGFTPYWPGPGIGGHCIPVDPLYFQWRIKKN
FT                   GAMSQLIEAAHVINEEMPEKMVQKVKGVVQPPATVLIVGIAYKKDVNDLRESPALPIIE
FT                   LLIKEGYEIEYHDPYISSAKFGDKVYQSVSLNEQAVNQASCILILTDHSNIDWKLFKGI
FT                   KRVVDTRGIVKKVSK"
FT   gene            460502..461467
FT                   /gene="galE1"
FT                   /locus_tag="BACI_c05010"
FT   CDS_pept        460502..461467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE1"
FT                   /locus_tag="BACI_c05010"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="NAD-dependent epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03234"
FT                   /db_xref="GOA:D8GZX5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX5"
FT                   /protein_id="ADK03234.1"
FT                   /translation="MSKKCLITGGAGFIGSHLAEELVGRGYNVTIVDNFYKGKNKYHDE
FT                   LMKEIRVIPISVLDKNSIYELVNQHDVVFHLAAILGVKTTMEKSIELIETNFDGTRNIL
FT                   QAALKGKKKVVFASTSEVYGKAKPPFSEEGDRLYGATSKIRWSYAICKTLEETLCLGYA
FT                   LEGLPVTIVRYFNIYGPRAKDGPYAGVIPRFISAALQGEDILVYGDGEQTRCFTYVSDA
FT                   VEATIRAMDEKVNGEIINIGSENEKSIKEVAEVIKKLTDSSSKIVQVPFEEVYPHGFEE
FT                   IPNRRPDVTKLKDLVQFQAKVTWEDGLKETIKWFREEDNG"
FT   gene            461460..463004
FT                   /locus_tag="BACI_c05020"
FT   CDS_pept        461460..463004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05020"
FT                   /product="glycosyltransferase, involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03235"
FT                   /db_xref="GOA:D8GZX6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX6"
FT                   /protein_id="ADK03235.1"
FT                   /translation="MAKSLSVIIPACNEIDTISDVIQSVKGLNPLEIIVVANGCTDGTE
FT                   TVAEHLGCKVLRYTEKLGNDVGRAAGAKEAIGDVLLFIDGDFAIQTSKLQLFLNPIVYN
FT                   QADVVLNNLDALFLKRQKPNSITVWRQILNAILEREELKIDSLLAVPHALTKEVVQSIG
FT                   YECFVNPILAHLRLVQGKWRISRHCAIDVITPNKFRPTEHAAYGTDLSPSEKRMIGDHI
FT                   EAVAERIVGSDERGGYCDGNRKRDSVYHTLDFEDFYQGWGVTSNLYKGKQLSVIIPVQD
FT                   EEKTIGNVIEELRKIEPFEIIVVVNGSSDQTATIAKDKGATTIVYKEALGNDVGRSLGT
FT                   YFAKGEIVLFIDGDFVIPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTAFKYA
FT                   LNLACDRKDLGVGSLIAVPNAFSRKCLKQIGYRSLLAPCVAQVKAILSGFEVACVSRVE
FT                   VDKMNRIRPSEHFAKIGHPPAVLRIIGDHIEGLEQLIGLTGSRGGFHDGNRKRDIL"
FT   gene            463344..465593
FT                   /gene="pflB"
FT                   /locus_tag="BACI_c05030"
FT   CDS_pept        463344..465593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /locus_tag="BACI_c05030"
FT                   /product="formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="formate acetyltransferase, pyruvate formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03236"
FT                   /db_xref="GOA:D8GZX7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX7"
FT                   /protein_id="ADK03236.1"
FT                   /translation="MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLA
FT                   GATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHEPGYLNKETEKVVGFQTDK
FT                   PFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKS
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDHLIEAKKADLNLTGGVMSEDTMRLREELSEQ
FT                   IRALQELKQMAASHGFDISKPATTAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YIERDLANGTLTEEDVQEIVDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALD
FT                   GRPLVTKNSFRFLHTLDNLGPAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYENDD
FT                   IMRADYGDDYGIACCVSAMRIGKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYA
FT                   PITSEVLDYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTM
FT                   ATGIAGLSVVADSLSAIKHAKVKPIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLV
FT                   KTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRD
FT                   TKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDEVQVRNLVSMLDGYAVKEGHH
FT                   LNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTMHESM"
FT   gene            465663..466394
FT                   /gene="pflA"
FT                   /locus_tag="BACI_c05040"
FT   CDS_pept        465663..466394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="BACI_c05040"
FT                   /product="formate acetyltransferase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03237"
FT                   /db_xref="GOA:D8GZX8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX8"
FT                   /protein_id="ADK03237.1"
FT                   /translation="MVKGRIHSVESCGTVDGPGIRYVIFTQGCLLRCQYCHNADTWEIG
FT                   KGKEITVEEVMQDVTCYLPFIEASGGGITVSGGEPLLQLDFLIELFKKCKEIGIHTTID
FT                   SSGGCYSEEPEFQNKLDILMEYTDLVLLDLKHIDSKKHRKLTGKPNEHILQFARYLSDK
FT                   NKPIWVRHVLVPGVTDNEEDLQKLSSFIQSLSNVQKIEVLPYHKLGVYKWEALGHKYPL
FT                   ANVEPPTEKNVEQARHILQAV"
FT   gene            466807..467973
FT                   /gene="ugtP"
FT                   /locus_tag="BACI_c05050"
FT   CDS_pept        466807..467973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugtP"
FT                   /locus_tag="BACI_c05050"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.157"
FT                   /note="UDP-glucose-diacylglycerol glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03238"
FT                   /db_xref="GOA:D8GZX9"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZX9"
FT                   /protein_id="ADK03238.1"
FT                   /translation="MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGE
FT                   SHPVITDITKYLYLKSYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEK
FT                   PDIVINTFPIIAVPELKKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMV
FT                   DIGVPAEQIVETGIPIRSSFELKINPDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELC
FT                   QSFMSVPDLQVVVVCGKNEALKQDLVGVQETNPDALKVFGYVENIDELFRVTSCMITKP
FT                   GGITLSEAAALQVPVILYKPVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDM
FT                   KLLQMKEAMKSIYRPEPADHIVDTILAENHVKPNHIPIKSPALAQSFT"
FT   gene            complement(468568..469125)
FT                   /locus_tag="BACI_c05060"
FT   CDS_pept        complement(468568..469125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05060"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03239"
FT                   /db_xref="GOA:D8GZY0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY0"
FT                   /protein_id="ADK03239.1"
FT                   /translation="MLKKRDLHDSHVLYELMVDPAVFPFVRQKAYSYEEYLFLTKQTIE
FT                   AEERGELISRTILDEWGNPIGTITLFDVQEKAGFLGTWLGKPYHGKGYNKLAKDSFFSE
FT                   LFYELDIETIFMRIRKINIRSIKAAEKLQYVNLANETRKAVYDEINANEEVYNLYEIPK
FT                   DQYTLATMRATTFQDAHHLKEA"
FT   gene            complement(469367..470497)
FT                   /gene="hutI1"
FT                   /locus_tag="BACI_c05070"
FT   CDS_pept        complement(469367..470497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI1"
FT                   /locus_tag="BACI_c05070"
FT                   /product="probable imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03240"
FT                   /db_xref="GOA:D8GZY1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY1"
FT                   /protein_id="ADK03240.1"
FT                   /translation="MKILLKQAMVYPITSQKFQGDVLVIGEKIAEVKPFIQPTQDMTVI
FT                   DARALHLLPGFIDVHTHLGLYDEGTGWAGNDANETSEVSTPHIRSLDGIHPLDIAFQDA
FT                   VQNGITTVHVMPGSQNIIGGTTCVIKTAGTCIDHMIIQEPAGLKIAFGENPKKVHSNGT
FT                   KESITRMGIMGLLRESFYEAQHYGHEADFRMLPILKALRREIPVRIHAHRADDISSALR
FT                   FATEFNLDLRIEHCTEGHFIIEELSKHNLKVSVGPTLTRRSKIELKNKTWDTYHILSKN
FT                   GVEVSITTDHPYTPIQYLNLCAAVAVREGLDEKTALEGITIFPARNLRLEDRIGSIEVG
FT                   KDADLVLWTHHPFHYLAKPVLTMIDGKIIYKKNKKN"
FT   gene            complement(470638..471582)
FT                   /locus_tag="BACI_c05080"
FT   CDS_pept        complement(470638..471582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05080"
FT                   /product="possible epimerase, NAD dependent epimerase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03241"
FT                   /db_xref="GOA:D8GZY2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY2"
FT                   /protein_id="ADK03241.1"
FT                   /translation="MLFKNIYNEEEILVKIAISGGTGFIGTYLSTFFIQKGYTVYILTR
FT                   KKTTETSHPNLQYVQWTPDLQTFPLSSIDVVINLAGESINSRWTKKQKKVILNSRILTT
FT                   KGLIKQLQALPAKPHTFINASAIGYYGTSETESFTEQHVTPGNDFLANTVYSWEQEASK
FT                   ARSLGIRTIYARFGVILGPDGGALPKMLLPYQFYIGGTVGSGKQWLSWIHIDDVASMID
FT                   FIIQKKEIDGPLNITAPEPIRMKEFGETIATIMKKPHWLPVPSFMLHALLGEMSILVLE
FT                   GQHVLPSKAIEHGYQYTFPTIDHALQNILSHTM"
FT   gene            471625..472437
FT                   /gene="recX"
FT                   /locus_tag="BACI_c05090"
FT   CDS_pept        471625..472437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="BACI_c05090"
FT                   /product="RecA regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03242"
FT                   /db_xref="GOA:D8GZY3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY3"
FT                   /protein_id="ADK03242.1"
FT                   /translation="MAVITKIEVQKRSKERFNIYIDKGQGEEYGFSVNEVILIKHGLQK
FT                   GLEIDEIALGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVGQAIISEVVSK
FT                   LLHDRYINDKEYAILYTRTQSNVNRKGPTVIKRELLNKGVQDLIITHSLQEYPKEKQIE
FT                   NALILIEKKKKSYQKHSFLQMKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEAL
FT                   HYHGNKYYEKYKKYDGWTFENKMKQALYRKGFSIDEIEIFLQMKREEG"
FT   gene            472447..472764
FT                   /gene="yfhH"
FT                   /locus_tag="BACI_c05100"
FT   CDS_pept        472447..472764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhH"
FT                   /locus_tag="BACI_c05100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03243"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY4"
FT                   /protein_id="ADK03243.1"
FT                   /translation="MNMPKRYSEMTPYELREEIGVLKEQAIKAEQLGIVNEFDVLMRKI
FT                   AMARAYMTDINKFHIGETYELVEEPGILFEITYFNGVFAWGHKQNDNEEIGIPISLLQE
FT                   K"
FT   gene            complement(473025..473204)
FT                   /locus_tag="BACI_c05110"
FT   CDS_pept        complement(473025..473204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05110"
FT                   /product="small acid-soluble spore K family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03244"
FT                   /db_xref="GOA:D8GZY5"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY5"
FT                   /protein_id="ADK03244.1"
FT                   /translation="MMRRAFAMGKQAEFWSESKNNSKIDGQPKAKSRFASKRPNGTINT
FT                   HPQERMRAANQQEE"
FT   gene            473305..473571
FT                   /gene="yfhJ"
FT                   /locus_tag="BACI_c05120"
FT   CDS_pept        473305..473571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhJ"
FT                   /locus_tag="BACI_c05120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03245"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY6"
FT                   /protein_id="ADK03245.1"
FT                   /translation="MNDIYEALTKELLDKNDKLSYAQARAWVELLWEDFQTTYAKSGRY
FT                   QGEEMTEQVVRSWINNHGGRLHEMRTNNPKYSHLINQEDHLKH"
FT   gene            complement(473596..474576)
FT                   /gene="yfhP"
FT                   /locus_tag="BACI_c05130"
FT   CDS_pept        complement(473596..474576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhP"
FT                   /locus_tag="BACI_c05130"
FT                   /product="possible membrane-bound metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03246"
FT                   /db_xref="GOA:D8GZY7"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY7"
FT                   /protein_id="ADK03246.1"
FT                   /translation="MDTATHLVMGVTLGSLATLDPAIAQSDIGPQAVMLATIAGSNIPD
FT                   IDTVLKLRNNAKYIRNHRGITHSIPAVILWSFLISGISFAFFSDAPYLHLLLWSFIAVF
FT                   LHVFVDIFNAYGTQALRPFTKKWVALGIINTFDTVIFFIHILAIACMLVGSHKGYTALA
FT                   AYILMIVYYIGRIMMHRNIRSVVQKRFKHVEKIIISPSYRFYHYHLAIVTTNYYYVARW
FT                   HRGNIMVYDKFDRVPFPDNAIMRAAKQDENISAFLSFSPVYRWDIFDYDHYYEVRFIDL
FT                   RYRSKDYYPFVAIVQLDHNLNIISSYTGWIFSEEKLRKKLELLPH"
FT   gene            474726..475823
FT                   /gene="mutY"
FT                   /locus_tag="BACI_c05140"
FT   CDS_pept        474726..475823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BACI_c05140"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03247"
FT                   /db_xref="GOA:D8GZY8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY8"
FT                   /protein_id="ADK03247.1"
FT                   /translation="MTLEILNNFNIEQFQNDLIGWFEKEQRDLPWRKNKDPYRVWVSEI
FT                   MLQQTRVEAVKPYYANFMGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVK
FT                   EVYGGIVPSDVKKIEKLKGVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIA
FT                   KPKTRKVFEEVVREIISAENPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGV
FT                   QKELPVKSKAKAPTMVPIVAGVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQ
FT                   KEQLIDYMKEKFELSISIEEYAMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKE
FT                   AFEQLPFSKSHRTIYENCVEKITMQ"
FT   gene            complement(476009..476233)
FT                   /gene="yfhS"
FT                   /locus_tag="BACI_c05150"
FT   CDS_pept        complement(476009..476233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhS"
FT                   /locus_tag="BACI_c05150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03248"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZY9"
FT                   /protein_id="ADK03248.1"
FT                   /translation="MYIGRDMTELTMVSKNEWKEDELAYFHHSLQQILPYLNAEGQSIY
FT                   KEIVIEIESRGGLQEGEASWTHGTKISYD"
FT   gene            476359..476640
FT                   /gene="sspE"
FT                   /locus_tag="BACI_c05160"
FT   CDS_pept        476359..476640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspE"
FT                   /locus_tag="BACI_c05160"
FT                   /product="small acid-soluble protein gamma type"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03249"
FT                   /db_xref="GOA:D8GZZ0"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ0"
FT                   /protein_id="ADK03249.1"
FT                   /translation="MSKKQQGYNKATSGASIQSTNANYGTEFATETNVQAVKQANAQSE
FT                   AKKAQASGAQSANASYGTEFATETDVHAVKKQNAQSAAKQSQSSSSNQ"
FT   gene            476829..477089
FT                   /gene="ygaB"
FT                   /locus_tag="BACI_c05170"
FT   CDS_pept        476829..477089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaB"
FT                   /locus_tag="BACI_c05170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03250"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ1"
FT                   /protein_id="ADK03250.1"
FT                   /translation="MNDFDKLVGEQLETMDELLKLQAHLEKYQQIEMSEKDTCDKKELH
FT                   FIRQEIYRTELALKLLHEKFEEQTNNVIQSFETEKMISNLG"
FT   gene            477323..477853
FT                   /gene="ygaC"
FT                   /locus_tag="BACI_c05180"
FT   CDS_pept        477323..477853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaC"
FT                   /locus_tag="BACI_c05180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03251"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ2"
FT                   /protein_id="ADK03251.1"
FT                   /translation="MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRT
FT                   VVTESDGRTWITREPAICYFHANYWFNVIGMLREEGVYYYCNLSSPFAYDSEALKYIDY
FT                   DLDIKVYPDMTYTLLDEDEYEKHSQIMQYPPVIDTILKRNVAQLTQWIHQRKGPFAPDF
FT                   VDMWYERYLMYRN"
FT   gene            477908..479668
FT                   /locus_tag="BACI_c05190"
FT   CDS_pept        477908..479668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05190"
FT                   /product="ABC transporter ATP-binding and permease;
FT                   multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03252"
FT                   /db_xref="GOA:D8GZZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ3"
FT                   /protein_id="ADK03252.1"
FT                   /translation="MQGIKRYLQFVKPYRWLIAITIMIGLVKFGIPLIMPWLLKYIIDD
FT                   VIQGGGSLQDKTSQLVTAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGH
FT                   LQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIK
FT                   LTFVALLILPIYVVAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEY
FT                   EGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAYEVIQGQLTLGTM
FT                   VAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNVPSAVQTKKLNGE
FT                   VIFDNVSFRYNADEKEILHNLSSTMLPGEKVALVGASGGGKSSLASLIPRFYDVSSGAV
FT                   YVDGIDVRKYDMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATEEEVIAAAKAAQIH
FT                   DFIIELPDGYDTVVGERGVKLSGGQRQRVAIARVFLKNPSLLILDEATSALDLENERYI
FT                   QEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMKKRGYYYNLYQL
FT                   QHITETAPLA"
FT   gene            complement(479682..480770)
FT                   /gene="ygaE1"
FT                   /locus_tag="BACI_c05200"
FT   CDS_pept        complement(479682..480770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygaE1"
FT                   /locus_tag="BACI_c05200"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03253"
FT                   /db_xref="GOA:D8GZZ4"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ4"
FT                   /protein_id="ADK03253.1"
FT                   /translation="MKLGARILKTGIAITLALFACILLNLPSPVFAGISAIFAVQPSVY
FT                   RSYLTALEQIQANVIGAVFAIAFATAFGHNPFIIGLTCILVIALTLQLRLENTISIALV
FT                   TVIAIMEYQGEDFFSFALLRFATIMVGIIAASLVNLVFMPPKYETKLYHRIVDNTEEIV
FT                   KWIRMNSRQASDFTTLKTDIDRMKEKMIKLNHYYLLYKEERSYTKKVQFAKIRKLVLFR
FT                   QMLATTSRALSTLKSLHRTENELRYMPEEFQESIQNELDSLTHYHEQVLLKFIGKAKKQ
FT                   QSVEMLDEVETGKQELIDIFMEYQNKDDEEAYKTWLHLFPLISAIINYSEEVEHLDLLV
FT                   DSFYTYHKPEAELKIDDKKEDE"
FT   gene            complement(481031..485467)
FT                   /gene="gltB"
FT                   /locus_tag="BACI_c05210"
FT   CDS_pept        complement(481031..485467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="BACI_c05210"
FT                   /product="glutamate synthase, NADPH, large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03254"
FT                   /db_xref="GOA:D8GZZ5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ5"
FT                   /protein_id="ADK03254.1"
FT                   /translation="MLNKTNTWTPSLFRDYKNAEHDACGIVSVMEKRKIPTKENIDLCI
FT                   QSLVKMNHRAGFINGEGDGIGIHIDVPKALWNEKLKSSGYNPTIVDHPHFIVGHFFLNK
FT                   NENIVDLKNHIRTQLNTKNFAILFESDNVINSDALGPLGKQEEPLFWQVALIAENEVVN
FT                   IEQTLFSVTIKIEENEAIHVASLSRDHVVYKVLGAGDTLVAYYNDLQHPLIASTMTLGH
FT                   NRYSTNTLSNFFRVQPFSILGHNGEINTIAKLRDQAEMIHVPLTAGGSDSQDLNRTLET
FT                   LLVQYGYSLFEAMDILFPPIINEIKLYETHLQDLYTYIREAWGHFAQGPAGIISRYKDE
FT                   AVFSVDSLGLRPVWKVETESSYIFSSEPGVVSPTEYVAEPKPLAPGEKVGLKWNEQDEL
FT                   VLYEHDDYQTQVYNRFKKKVDVTNYHLHLSIPKTKEIPDACDSMQVETKQYVAFGWDRE
FT                   HIQLLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREVEH
FT                   FSTRTILGERPSLLSDAKKPFVVEMLSPIILEGSVAQSIAQELHTITYEQLIELFNTHS
FT                   SITTISATFRQAETLQCALSRISSEAITAVNDGASLLLIDDADAHLNERLWIDPHLVTA
FT                   KVHQVLSENKLRRNCSLVIRSGALRSLHDIVTLYGLGADSINPYLLFATVNDGTKTPIT
FT                   NLYNALNKGLEKVISTIGIHELRGYGRLYSSIGLHEEIANILQVTNFLGSNDLAFSLES
FT                   LAEDAQMRADDYNDPKVRIRKSFHIFPRIWKAIGDVAKGNSYDDYRDKLSELEENNPIA
FT                   IRHLIQTKETKHVIPTEEVSISIQNHDLPFIISSMSFGSQNEIAFRAYAEAADQLNMIS
FT                   LNGEGGEIKDMIGKYPHTRGQQVASGRFGVNAELLNSSNLIEIKIGQGAKPGEGGHLPG
FT                   SKVTAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMITEIKTANQLAKVAVKVPVVPN
FT                   IGTIAVGIAKAGADFINISGFDGGTGAARIHALQHVGLPVEIGVKAAHNALLEANMRHN
FT                   VEIWADGGIRSVNDALKIMLLGANRIGFGTLSMIAIGCTTCRGCHLDTCHVGIATQIES
FT                   EAQAKEHGLRRFVPRELESAVAGLLHLFTTFGEELKRLTGNLGYTNLQEIVGRSDLLEQ
FT                   VRGKNLLNLCNLLQTIEHPSVIKTEHVLEKQFEPIHSPHSKELVGVGVEQRVMGGLESC
FT                   YRVRSKLYEDTKLEPLTLKYTNGSIPGNGLGAYNSENLFIHVNGGAQDGIGKTSFGGGI
FT                   YITKAKGKDGLYYNGSVGKGFGYGAQKGALYVQGNADARAGIRLSGADMIIGGRMTKPL
FT                   REKEQGNIGAYSNIKGFAFEYMTNGRALVLGDPGPWICAGMTGGVVYLRHDSSLGLTEQ
FT                   ALKRRIAKGANVTLQPISKNGVRDVNELLLDYIRVLNEHEQYEEVALLTPLLDDMQQQF
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(485666..486970)
FT                   /gene="gsaB"
FT                   /locus_tag="BACI_c05220"
FT   CDS_pept        complement(485666..486970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsaB"
FT                   /locus_tag="BACI_c05220"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03255"
FT                   /db_xref="GOA:D8GZZ6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ6"
FT                   /protein_id="ADK03255.1"
FT                   /translation="MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGK
FT                   GAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKML
FT                   KEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPS
FT                   TLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKP
FT                   GFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAY
FT                   GGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGI
FT                   LEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAP
FT                   SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK"
FT   gene            487092..488105
FT                   /locus_tag="BACI_c05230"
FT   CDS_pept        487092..488105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05230"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03256"
FT                   /db_xref="GOA:D8GZZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ7"
FT                   /protein_id="ADK03256.1"
FT                   /translation="MKSVIEVQGLRKEFTAYSSRPGLKGAFRDLLNRNYKIVPAVNDVS
FT                   FTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGDILVNGMNPHKQREEFVRTIGVVF
FT                   GQRSQLWWDIAVQESFRLLKKVYGVSDAQYKEHMEHVIETLDMGPLLDKPVRKLSLGQR
FT                   MRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIREFLKEMNERYKTTILLTTHDITDIE
FT                   ALCERVIMLDEGNIMYDGSLNNLRTQWGAEKEIHFQFVAPVSYQALSMVMPDSHVVWSK
FT                   AKEENAWIAKIPNEEVIISMLISKVVQAFQIKDLKINEVSTEEIIRNIYEEGIKHG"
FT   gene            488098..488889
FT                   /locus_tag="BACI_c05240"
FT   CDS_pept        488098..488889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05240"
FT                   /product="putative ABC transporter permease protein,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03257"
FT                   /db_xref="GOA:D8GZZ8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ8"
FT                   /protein_id="ADK03257.1"
FT                   /translation="MGKYIEMIRIRFLMMLAYRTNYYSGILIYTINIGAYYFLWQAIYS
FT                   GKENIESLSISQMTTYIAIAWMARAFYFNNIDREIAMEIQEGRVAVELIRPYNYLGMKV
FT                   MQGLGEGIFRFAFFSIPGMVIVTLLFSLQITTNFQTWLYFFLSLIFSFIINTQINLMTG
FT                   MLTFFLFNNSGIMYAKRVVIDLFSGLLLPISFYPLWAQKAMVFLPFQAISYIPSMIFSE
FT                   GIQGSKLYEALLFQVIWAIVLIIPIVLMWRTARKRLIVQGG"
FT   gene            488894..489679
FT                   /locus_tag="BACI_c05250"
FT   CDS_pept        488894..489679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05250"
FT                   /product="putative ABC transporter permease protein,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03258"
FT                   /db_xref="GOA:D8GZZ9"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GZZ9"
FT                   /protein_id="ADK03258.1"
FT                   /translation="MIYIKLFLQYASQYIKTKLEYRGDFIVGLLSDLSLQAVNLIFILV
FT                   VFGHTQALKGWSREEVIFIYGFFLVPFAIFSAFFNIWDFNDRYIIKGEMDRILTRPIHS
FT                   LFQIILERMELESLIGAITGMIVMGYAAVELQLSFYWYDFFLFLLMVGGGALVYGGIFV
FT                   TLASLGFWSDAKSSIMPLMYNIGNYGRYPVNIYNRVIRFILTFVLPFAFVGVYPAAYFL
FT                   RKTEWNSYAFATPLVGVICFTIAITLWNQGVKRYRGAGN"
FT   gene            489752..490156
FT                   /gene="lctB"
FT                   /locus_tag="BACI_c05260"
FT   CDS_pept        489752..490156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctB"
FT                   /locus_tag="BACI_c05260"
FT                   /product="possible LCTB protein, potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03259"
FT                   /db_xref="GOA:D8H000"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D8H000"
FT                   /protein_id="ADK03259.1"
FT                   /translation="MLWGFILLIVAIAILKSVQLLWSSYSDSTRFFSLYNLATLFLIYT
FT                   TVLIAFGLSYVVLEEMGFAVLKEDGKSLSAHSFQLVEICLYFSAVTLLSVGYGDISPIG
FT                   IGRWIAIGEALIGYTLPFAFVMRSVIDNEK"
FT   gene            490201..490656
FT                   /locus_tag="BACI_c05270"
FT   CDS_pept        490201..490656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05270"
FT                   /product="bacterioferritin comigratory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03260"
FT                   /db_xref="GOA:D8H001"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8H001"
FT                   /protein_id="ADK03260.1"
FT                   /translation="MITVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCT
FT                   TEACDFRDAYGLFQEKDTVILGVSPDPVNRHLKFIEKHELPFTLLVDEDHKVAELYNVW
FT                   KLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEEVLSYIK"
FT   gene            490955..491383
FT                   /gene="perR"
FT                   /locus_tag="BACI_c05280"
FT   CDS_pept        490955..491383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perR"
FT                   /locus_tag="BACI_c05280"
FT                   /product="ferric uptake regulator"
FT                   /note="similar to peroxide operon regulator in B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03261"
FT                   /db_xref="GOA:D8H002"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H002"
FT                   /protein_id="ADK03261.1"
FT                   /translation="MVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDIYK
FT                   ALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDYVTSQHYHVICEKCGKIVD
FT                   FPYGGLEELEEEAAKTTGFVINSHRLEIYGVCPECHKA"
FT   gene            complement(491591..491947)
FT                   /gene="ygzB"
FT                   /locus_tag="BACI_c05290"
FT   CDS_pept        complement(491591..491947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygzB"
FT                   /locus_tag="BACI_c05290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03262"
FT                   /db_xref="GOA:D8H003"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/TrEMBL:D8H003"
FT                   /protein_id="ADK03262.1"
FT                   /translation="MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMM
FT                   VGFLAVIASTVVYFWIGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEG
FT                   KEFDEKYNKKSYKS"
FT   gene            492342..493881
FT                   /locus_tag="BACI_c05300"
FT   rRNA            492342..493881
FT                   /locus_tag="BACI_c05300"
FT                   /product="16S ribosomal RNA"
FT   gene            494035..496952
FT                   /locus_tag="BACI_c05310"
FT   rRNA            494035..496952
FT                   /locus_tag="BACI_c05310"
FT                   /product="23S ribosomal RNA"
FT   gene            497055..497169
FT                   /locus_tag="BACI_c05320"
FT   rRNA            497055..497169
FT                   /locus_tag="BACI_c05320"
FT                   /product="5S ribosomal RNA"
FT   gene            497177..497251
FT                   /locus_tag="BACI_c05330"
FT   tRNA            497177..497251
FT                   /locus_tag="BACI_c05330"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            497256..497345
FT                   /locus_tag="BACI_c05340"
FT   tRNA            497256..497345
FT                   /locus_tag="BACI_c05340"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            497363..497437
FT                   /locus_tag="BACI_c05350"
FT   tRNA            497363..497437
FT                   /locus_tag="BACI_c05350"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   gene            497443..497518
FT                   /locus_tag="BACI_c05360"
FT   tRNA            497443..497518
FT                   /locus_tag="BACI_c05360"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            497543..497619
FT                   /locus_tag="BACI_c05370"
FT   tRNA            497543..497619
FT                   /locus_tag="BACI_c05370"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            497623..497698
FT                   /locus_tag="BACI_c05380"
FT   tRNA            497623..497698
FT                   /locus_tag="BACI_c05380"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   gene            497708..497783
FT                   /locus_tag="BACI_c05390"
FT   tRNA            497708..497783
FT                   /locus_tag="BACI_c05390"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            497802..497877
FT                   /locus_tag="BACI_c05400"
FT   tRNA            497802..497877
FT                   /locus_tag="BACI_c05400"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            497888..497971
FT                   /locus_tag="BACI_c05410"
FT   tRNA            497888..497971
FT                   /locus_tag="BACI_c05410"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            497979..498052
FT                   /locus_tag="BACI_c05420"
FT   tRNA            497979..498052
FT                   /locus_tag="BACI_c05420"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   gene            498072..498147
FT                   /locus_tag="BACI_c05430"
FT   tRNA            498072..498147
FT                   /locus_tag="BACI_c05430"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAC"
FT   gene            498211..498285
FT                   /locus_tag="BACI_c05440"
FT   tRNA            498211..498285
FT                   /locus_tag="BACI_c05440"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            498291..498365
FT                   /locus_tag="BACI_c05450"
FT   tRNA            498291..498365
FT                   /locus_tag="BACI_c05450"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            498380..498450
FT                   /locus_tag="BACI_c05460"
FT   tRNA            498380..498450
FT                   /locus_tag="BACI_c05460"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   gene            498461..498545
FT                   /locus_tag="BACI_c05470"
FT   tRNA            498461..498545
FT                   /locus_tag="BACI_c05470"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   gene            complement(498752..499072)
FT                   /locus_tag="BACI_c05480"
FT   CDS_pept        complement(498752..499072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03263"
FT                   /db_xref="InterPro:IPR024979"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0P8"
FT                   /protein_id="ADK03263.1"
FT                   /translation="MTHSNEKKTHGLKGVGEKLNPTIYQVRFMKLDEPIQFESFPELKE
FT                   LGDWLSTSTHMWACHSTMYKYNKEEFKKRFLEITNLTVDHVLISTGGVGFNFMSPGWRD
FT                   SL"
FT   gene            499425..500144
FT                   /gene="yeeI"
FT                   /locus_tag="BACI_c05490"
FT   CDS_pept        499425..500144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeI"
FT                   /locus_tag="BACI_c05490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03264"
FT                   /db_xref="GOA:D8H0P9"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0P9"
FT                   /protein_id="ADK03264.1"
FT                   /translation="MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQ
FT                   ALRVVLERAKTYNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVN
FT                   RTAADVRAAFSKNSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILE
FT                   EEDAVIVYAEPDQFHAVQSALKDAGVEEFTVAELTMLAQNDVTLPEDAQAQFEKMVDAL
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            500290..500751
FT                   /locus_tag="BACI_c05500"
FT   CDS_pept        500290..500751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05500"
FT                   /product="MutT/NUDIX family protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03265"
FT                   /db_xref="GOA:D8H0Q0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q0"
FT                   /protein_id="ADK03265.1"
FT                   /translation="MEHKTPKHIVAVAGYLTNEKDEVLLAKVHWRADTWELPGGQLEEG
FT                   EALDQAVCREIKEETGLTVKPIGVTGVYYNASMHILSVVFKVAYVSGEIKIQHEEIQEA
FT                   KFVALNEENIDEYITRPHMKSRTLDAMRSSHFIPYETWEVQPYNLLGRL"
FT   gene            501237..502013
FT                   /locus_tag="BACI_c05510"
FT   CDS_pept        501237..502013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05510"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03266"
FT                   /db_xref="GOA:D8H0Q1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q1"
FT                   /protein_id="ADK03266.1"
FT                   /translation="MKERVLSRVNYHQKVALNPMTKFFYKAIILLLLLSFTLLFIGNVM
FT                   IEKSDISKLHVPAKLEVPESLTHAFIATEDKRFYHHNGLDYIAIVRASVENIKAGGVVQ
FT                   GGSTITQQLSKNAFLTNERTFSRKWKEIFYTKKIERTFTKDEILKLYVSNIYYGEGAWG
FT                   IEKAANLYFGKKVSQLTLAESAMMAAVVKAPAYYSPVQNYDKAVERRNVVLRLMEKEGY
FT                   INHDEYVQAVSEKLVIRHDIKTEQSMLNSAREKAVS"
FT   gene            502193..502843
FT                   /gene="bdbD"
FT                   /locus_tag="BACI_c05520"
FT   CDS_pept        502193..502843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdbD"
FT                   /locus_tag="BACI_c05520"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /note="disulfide bond formation protein D,
FT                   disulfideoxidoreductase D"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03267"
FT                   /db_xref="GOA:D8H0Q2"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q2"
FT                   /protein_id="ADK03267.1"
FT                   /translation="MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQ
FT                   QSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSD
FT                   LGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVAQFKK
FT                   DLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKKAIDKELKK"
FT   gene            502958..503031
FT                   /locus_tag="BACI_c05530"
FT   tRNA            502958..503031
FT                   /locus_tag="BACI_c05530"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   gene            503230..504372
FT                   /gene="yhbA"
FT                   /locus_tag="BACI_c05540"
FT   CDS_pept        503230..504372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbA"
FT                   /locus_tag="BACI_c05540"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03268"
FT                   /db_xref="GOA:D8H0Q3"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q3"
FT                   /protein_id="ADK03268.1"
FT                   /translation="MDFEQLKQDVIAYSKTIGIDKIGFASASPFEELKQRLIQQQQLNY
FT                   QSGFEEPDIEKRTNPQLLLPGAKSIIAIALAYPSKLKNAPLSKRGERRGIFCRASWGQD
FT                   YHLVLRDRLQKLEAYLIEKLPDIEVKSMVDTGELSDRAVSERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNVPFPPDQPIEDQCGSCTKCIDICPTGALIQGGQLDSKKCIAFLTQTK
FT                   GFLPEEYRDKIGNRIYGCDTCQTVCPKNKGMDFHNHPEMEPDPELVKPLLTPLLTISNR
FT                   DFKEKYGIMSGSWRGKKPLQRNAILALAHFKEASAIPDLIGVMKDDPRPVLRGTAAWAL
FT                   GKIGGDGVGEAIEKAMQREKDEEVLHEMNRGLELLAQKKE"
FT   gene            504417..505304
FT                   /gene="yhbB"
FT                   /locus_tag="BACI_c05550"
FT   CDS_pept        504417..505304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbB"
FT                   /locus_tag="BACI_c05550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03269"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q4"
FT                   /protein_id="ADK03269.1"
FT                   /translation="MVVKINIEKQVQQFLAYVTEKRTNVDGIAEDLLQIAKRKRQLFQK
FT                   RSADIVKATADVSFMRQFNNSNHQEIDYQIHFKYLIKHKELFYIEEEQLKRRVCLNNSR
FT                   IISDYAIEVPEAVGMSETLEREVAKEKYGSYQYNRLEAVKYAERWWDDRNPVYRNFPDN
FT                   CTNFISQCLHTGEVPMNGYPNIRKGWWQRENQWSWSWAVAHSFYWYLSGATTGLRAEAV
FT                   ERPEDLILGDVIAYDFEDDGRWNHTTIVVAKDADGMPLVNAHSANSRRRYWNYEDSSKY
FT                   TPQMKYKFFHIING"
FT   gene            505363..505851
FT                   /gene="cspR"
FT                   /locus_tag="BACI_c05560"
FT   CDS_pept        505363..505851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="BACI_c05560"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03270"
FT                   /db_xref="GOA:D8H0Q5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q5"
FT                   /protein_id="ADK03270.1"
FT                   /translation="MGVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKML
FT                   KRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFG
FT                   RETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEIVY"
FT   gene            505979..508048
FT                   /locus_tag="BACI_c05570"
FT   CDS_pept        505979..508048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05570"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03271"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q6"
FT                   /protein_id="ADK03271.1"
FT                   /translation="MKEQYSNQNTFLSMIDMDLIRRGLLHAIQDLVFIVKVIDDETFKY
FT                   IYVNKLGMDYAKLSEECYGKTFAEVLPEDTAEILQVQYAKVASEAKAHTFCDVVSLPKG
FT                   ELHYESSLNPVFDEEGVCQFIICITRDITAQIEEKMEIEEKQMLFKSLLEYNNDSIISI
FT                   DSIGRITYANPATYEIFGYRFEELNNKFIFEFINKEYEKDFQIIFKEAMQGRAKQIVSK
FT                   KYVHKEGYELYISLRTIPIIVNGEIVGVYIVTRDVTKQVLNEMRTEYLAYYDQLTGLMN
FT                   RISCTNKLNDFLNEKVAFAFIFIDLDEFHLINDTFGHKEGDKVLQKVTECLSSFQIPDM
FT                   HLFREHDDQFVMLIENITKERVEVFAKSIQKKISEHFVIEEEDVYLSASIGIVMAPTDG
FT                   EDEKILFQRVDAALEKAKEKGKGHYHFYGNGLDCEREKRFIIENQLHRAIEKNEFFLYY
FT                   QPQMNIETKKIASMEALIRWENKELGFVSPNQFIPLAERTGFIIKLDEWVINEVCRQIR
FT                   EWLNKGYEVVPIAVNISARHFRSITLIEMITRALHKYNVSAHLLAIEVTEGALIHKDIS
FT                   KRVLLQLKEQNLKIHLDDFGTGYSSLSYLKTYPIDTLKIDRSFMEGIHVDERDTNITAA
FT                   IIHLAHTLELDVIAEGVEKAEQIQFLKEKNVKFVQGYYYSRPLSKYDVENVYYK"
FT   gene            508440..510335
FT                   /gene="prkA"
FT                   /locus_tag="BACI_c05580"
FT   CDS_pept        508440..510335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="BACI_c05580"
FT                   /product="serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03272"
FT                   /db_xref="GOA:D8H0Q7"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q7"
FT                   /protein_id="ADK03272.1"
FT                   /translation="MDILKKIEQHREAEERLQWEGTFAEYLELVKERPWVAQTAHSRIY
FT                   NMIKDAGIEEVDGRRKYNFFSNQLFGLEDALERLVEEYFHPSAKRLDVRKRILLLMGPV
FT                   SGGKSTLVTMLKRGLETYSRTDRGAIFAIKGCPMHEDPLHLIPHHLRDDFFDEYGVRIE
FT                   GNLSPLNVMRLEQEYGSRIEDVVVERIFFSEDRRTGIGTFSPSDPKSQDIADLTGSLDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFIANKKNEALHSRIIVMPVPYNLRVSEEEHIYEKMIRES
FT                   DVSDVHIAPHTLRVAAMFTILTRLKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELQR
FT                   EYQDEGMKGIDPRYVINRISSTIIRKEVPSINALDVLRSLKDGLDQHPSISNEDRERYM
FT                   NFISLARKEYDEIAKKEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKSKLRDPLTGEEM
FT                   SPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDENQLKKINDVVARLIDEHGYNSSSANELLRYVGSLLNR"
FT   gene            510781..511956
FT                   /gene="yhbH"
FT                   /locus_tag="BACI_c05590"
FT   CDS_pept        510781..511956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="BACI_c05590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03273"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q8"
FT                   /protein_id="ADK03273.1"
FT                   /translation="MGEENQPNYTISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLV
FT                   TEESIVMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGNGDSKVGDVVARDGSGGQKQ
FT                   KGPGKGQGAGDAAGEDYYEAEVSILELEQAFFKELELPNLKRKEMDENRIEHVEFNDIR
FT                   KTGLWGNIDKKRTMISAYKRNAMRGKASFHPIHQEDLKFRTWNEVLKPDSKAVVLAMMD
FT                   TSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVPEEEFFSKGESGGT
FT                   ICSSVYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVKLVEELMKKCNMFGYG
FT                   EVNQYNRHSTLMSAYKNIKDENFRYYILKQKADVFHAMKSFFREESGEKMA"
FT   gene            512216..515371
FT                   /locus_tag="BACI_c05600"
FT   CDS_pept        512216..515371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05600"
FT                   /product="internalin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03274"
FT                   /db_xref="GOA:D8H0Q9"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Q9"
FT                   /protein_id="ADK03274.1"
FT                   /translation="MKNNKRKHINAMLIAATLSLPLPFATYSTPALAAVVSEVNKAGHI
FT                   LKDGTYDVVLKAYNEKTNEESRATTYIKEPKVTIENGKKIVTATLNDSDFFQYLKVEDS
FT                   QNLGTLHDVKVLSEDKRKNGTKVIQFEIGELGKRYKMQMHIFIPSMGYDEKYQVQFEVN
FT                   TVHSENNTVEESKEKKEEQQQVKNIISDNKLQQYINKSVLQRADINAPITEEDAAQIKE
FT                   LKVYLGKGIESLEGLQYMVNLEAFELHESNVKDISPISSLKKLKTMKLYLNPIENIEPI
FT                   SQLEKLQFLTLRDNKISDLTPLSQLKKVKVLDLIGNEITDIKPLFSMDSVTKLYLSNNK
FT                   ISDLTDIEKLDDLRLLWIGNNYIDNLTEISKLKNLVELEVANAEIRDLTPLAKMQQLQS
FT                   LDLEQNYISDISPISKLNNLYALNLIANEIRDIRPVKELGKRVPIKLQRQKIFLSDGVV
FT                   NEDIKIPIYDSNGEIVQNIKWQGEEGTLNNGSVKWNSTGEKVYEFKLETDSAESQILFN
FT                   GTVYQNIVEKHEYINIIQDKNLQKFINKNGLGRANLELSITKEDLLQIKSLKIVDGKNQ
FT                   GITDISGLEYMTNIEELVLDNIELKNVDFISNLRSLKAVKLTSNQLENIEPLSKLDKLE
FT                   KIDISDNNVKDIRPLFTLNAMKNLNVSNNKLNDASLQEIQQLKNLEVLKLNHNEISNVE
FT                   AISEISMLNELELVGNKVVDITPLSKLKNLQWLDLSDNKIQDISIFASMLDLISLKLPG
FT                   NEIRDIRPIIQLSQWSTIDIRRQKITLDDVQMNQAVKIPVHDVEGVPLEDITMKSEGGI
FT                   INEEGTITWSTPGEKVYEFTFDGNDYFGLGIWFSGEVIQNVVNKTESKEETPKPVVEEK
FT                   LKEETTKPVVEEKPKEETTKPVMEEKPKEETSKPVVEERPKEEMTKPVMEEKPKEETSK
FT                   PVVEEKPKEGTPKPVVEEKPKEETTKSAVEEKSKEETPKLVMEEKSKEGTSKSVVEEQR
FT                   KEENKLAKENESNKQVDNKKEESKNTLAATGGQESNVSLLSGLAFVLSALSMFVFRKKL
FT                   FKK"
FT   gene            515683..516546
FT                   /locus_tag="BACI_c05610"
FT   CDS_pept        515683..516546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05610"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03275"
FT                   /db_xref="GOA:D8H0R0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R0"
FT                   /protein_id="ADK03275.1"
FT                   /translation="MYVSSILKIEEIASFIANMNKDATHHVGYCGDQKEELLHTILHDF
FT                   SDIGWEKSFVVTYENNKIIGVLGFDVDEVKKCAEIWGPFIKAENWEEVALHMWKELIEK
FT                   VPFHIEKFYGFYHVENNNCARLMKNLYAKEQDRHSIFILNNIVEQRIICNVEEALPQVF
FT                   EQFIALHNHVFPNTYYEGNEIIERLSDTNKLFVSMKNGKLEGYVYVEVNPEFHEANIEF
FT                   IATAENSRRKGVGEQLLQGAIQYIFSFQEMKEIELCLNTNNDRAMKLYKKVGFEEKACL
FT                   QHYIIE"
FT   gene            complement(516650..518200)
FT                   /gene="opuD1"
FT                   /locus_tag="BACI_c05620"
FT   CDS_pept        complement(516650..518200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuD1"
FT                   /locus_tag="BACI_c05620"
FT                   /product="glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03276"
FT                   /db_xref="GOA:D8H0R1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R1"
FT                   /protein_id="ADK03276.1"
FT                   /translation="MIKKENSVFYISILLTTLFIIWGITPASWIQGYDLQSVTSSLNSF
FT                   ILNKFGWFYSLLMTAMIILATYLAFSKYGSIRLGKDGEKPKYSYPSWLSMLFGAGMGIG
FT                   LLFYGIAEPISHFTDPLTGKAGTEESAKLAMQYSFFHWGLFPWALYAMVALTIAYFTFR
FT                   KQKGSTIGATVTPLFNRSKNSPIGKTVDILAVLATVFGIVPSVGIGAQQIAGGLSYLFP
FT                   SIHNTLLTQLVLIAIFAVLYLISAQTGLDRGIKYLSNLNFSLAGILLVSFLLLGPTVFI
FT                   MKYFTSTLGSYIGALPSMGLNLGAFNEKSSSWIENWTIFYWGWWISWSPFVGTFIARIS
FT                   KGRTIKEFIFGVVLVPTLICTFWFAVFGGTAIHMEMFQSLGVADEIAKNGTEIGLFAVI
FT                   SHLPFSTFLTIIGLILVATFFVTSADSATFVVSMQTSNGSLSPKNSLKLIWGLTIAIIA
FT                   AILLQAGGLNALQIAAIIAALPFSIVVVLMVTSLFKELRKEDINSQTKEVPKKIKKVM"
FT   gene            518469..521366
FT                   /gene="colC"
FT                   /locus_tag="BACI_c05630"
FT   CDS_pept        518469..521366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="colC"
FT                   /locus_tag="BACI_c05630"
FT                   /product="microbial collagenase metalloprotease"
FT                   /EC_number="3.4.24.3"
FT                   /note="peptidase M9A family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03277"
FT                   /db_xref="GOA:D8H0R2"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R2"
FT                   /protein_id="ADK03277.1"
FT                   /translation="MNKKSKINKVMLSISTMALSLGALQAPVSAEEKVPYNVLKTKPVG
FT                   IEKPVDEIGHVSKAEETLSFQERLKVGDFSQRPASITNKATVKQVKESYSMADLNKMND
FT                   QELVETLGSIKWHQITDLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQT
FT                   FTEVLRSAFYLAFYNNELSELNERSFQDKCLPALKAIAKNPNFKLGTAEQDTVVSAYGK
FT                   LISNASSDVETVQYASNILKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARK
FT                   EANETMWYGKVDGFINEINRIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVV
FT                   TQAMHMYPRLSEPYFVAVEQITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGS
FT                   IVFKTGDKVSEEKIKRLYWAAKEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQ
FT                   LNRQLYGYETNNGGIYIEETGTFFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLF
FT                   GRGDMYQNERLTWFQEGNAEFFAGSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKY
FT                   GSWDFYNYSFALQSYLYTHQFETFDKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEY
FT                   MQQLIDNQDKYNVPEVADDYLAEHASKSLTAVEKEITETLPMRDAKMTKHSSQFFNTFT
FT                   LEGTYTGSVTKGESEDWNAMSKKVNEALEQLAQKEWSGYKTVTAYFVNYRINSSNQFEY
FT                   DVVFHGIAKDDGENKAPTVNINGPYNGLVKEGIQFKSDGSKDEDGKIVSYLWDFGDGST
FT                   SAEVNPVHVYEREGSYKVALIVKDDKGKESKSETTVTVKDGSLTELEPNNRPEEANRIG
FT                   LNNTIKGSLIGGDHTDVYTFNVATTKNIDISVLNEYGIGMTWVLQHESDMQNYAAYGQA
FT                   NGNHIEANFNAKPGKYYLYVYKYDNGDGTYELSVK"
FT   gene            521613..522161
FT                   /locus_tag="BACI_c05640"
FT   CDS_pept        521613..522161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03278"
FT                   /db_xref="GOA:D8H0R3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R3"
FT                   /protein_id="ADK03278.1"
FT                   /translation="MVLFGYPLETIYLYGFIIATILTVIYIFFGDIFESIFSFGGGSVS
FT                   VVTLLLSFFAMLCGLSYIGEYLFSFNSILIFVAAFAISFIGVFIMKILILKPIAEAEQN
FT                   TVQRMDEFIGCKGEVITTIPTEGFGEVLISSQFGSNAIPAKTIGKKDISQGTEVIIEGV
FT                   QDGVLLVQNIAYSLKKPKL"
FT   gene            522174..523748
FT                   /locus_tag="BACI_c05650"
FT   CDS_pept        522174..523748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05650"
FT                   /product="band 7 protein, SPFH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03279"
FT                   /db_xref="GOA:D8H0R4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R4"
FT                   /protein_id="ADK03279.1"
FT                   /translation="MTIPLIIGGVLLAILILLILVFITKYRTVGPDEALIVTGNWLGGG
FT                   KNVVTTDDGKKIKIIRGGGTFVVPIMQRAEPLSLLNYKLEVGTRDTYTKQGVPVTVNGV
FT                   SIIKVGSTIEEVSTAAEQYLGKETEELKVEAKEVLEGHLRAILSSMTVEDAYSNREQFA
FT                   QKVHEVASTDLKKMGLRIVSFTIKEIMDKNGYLDALGQPQIATVKRDATIANAEREKEA
FT                   RIEKARAEKEAKEAEYQRDAQIAEAEKHKELKVQSYKREQEQARADADLSYELQQAKAQ
FT                   QGVTEEQMRVKIIEREKQIELEEKEIARREKQYDAEVKKKADADRYAVEQSAEAEKVKQ
FT                   IKKADADQYKIEAEARARAEEVRVEGLAKAEIEKAQGQAKAEVQKAQGTAEADVIRLKG
FT                   LAEAEAKQKIAEAFELYGQAAIMDMVLKMLPSYAKEVASPLSNIDKITVVDTGGGGKNS
FT                   GAGKVAGYATDLMATMQETLKASSGIDLKELLEGFAGKGAVQQLSNDKPVVSVVEDEKK
FT                   EVEKDKE"
FT   gene            523991..525967
FT                   /gene="cheW2"
FT                   /locus_tag="BACI_c05660"
FT   CDS_pept        523991..525967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW2"
FT                   /locus_tag="BACI_c05660"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03280"
FT                   /db_xref="GOA:D8H0R5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R5"
FT                   /protein_id="ADK03280.1"
FT                   /translation="MLQGKLRRSSLKAKLLVSFVIVLILPSIVIGWTSYQQAKTNFNET
FT                   ILQSAEDNVKILNNVINKEIDSKKVDAVYFTKLFNGVSYGTDQLQNVQNKLEEYNKLHP
FT                   EIEAIYTGSSTGQFIQSPSIQMPDGYNPTERDWYKEAAKKSGEVVITAPYKSSTTGNIV
FT                   ITIAKQNEDKSGVLGIDLIINDIVNISKMVNIGKKGYVAIFDQSQHVIAHPTMKPGDKI
FT                   EEKLEKELYKQETGDFKFKLDGDDRNVTFITNKQTGWKIAGIMPSKEIIEAANPIFYKT
FT                   LTVIGISLIIGGVLIYFIIASIISPLKQLVISSKKISEGDLTETITVHSRDEIGQLGES
FT                   FNEMAASLHHVISNINTSASHVAASSEELTASMKQTSEATEQITQAIEQVSSGSEIQTK
FT                   EVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAEDGGKLVEQTVNQMQLIHESVS
FT                   QSDKVIVLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVR
FT                   KLAEQSGQSSTEIGKLVKEIQFDIKETVSSMKQVGTEVQSGLVVANETKQSFAEILKST
FT                   DDTAVQIDNMVDVAKQMTVDARQVSASINEIAAAIEENAASVQNIAGSSEEQLASVDEI
FT                   NAAAVHLSQMAEELQEMIGKFKV"
FT   gene            526125..527729
FT                   /gene="citS1"
FT                   /locus_tag="BACI_c05670"
FT   CDS_pept        526125..527729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citS1"
FT                   /locus_tag="BACI_c05670"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03281"
FT                   /db_xref="GOA:D8H0R6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R6"
FT                   /protein_id="ADK03281.1"
FT                   /translation="MKFKKLKLQPRITLTISALIVVVLLLTSYLFYYILSETVEEQIGK
FT                   RALHVAKTVAAIPEIKEAFQTENPASIIQPIAERIRIDTDADFIVVGNKEGIRYAHPRK
FT                   DKIGEAMVGGDNKGVLLEGKSYVSKATGSLGPSLRGKVPIRNQENEIIGVVSVGFSMDD
FT                   IHGAVEVYGKRVFWITIIGLLIGVIGSIYLAGSIKRMMFGMEPEEISSLYEEHSTVIQS
FT                   VREGIIVIDQNGMISLVNQAAYDILSLDEQRNIIGEFILDVIPNSTILDVLQTGEEQFD
FT                   RQLNIKGQAVIANRLPIKVKNKVTGVVSSLRLKSEMDQLTAELSQTKQYTEALRAQTHE
FT                   YNNLLYTLSGLIQLELYEDALELIHKETAVYQDFVQFIMKRIQNPWLGGILIGFYNRAR
FT                   ELKIDFMLDRESSLDKLSPHIESNYVVSILGNLITNAFEAIERNEEHDKKVRMFVTDIG
FT                   EEIVIEVEDSGQGIHDEVITSIFYKGFSTKEGEKRGYGLAKVKELVEDLNGSIAIEKGD
FT                   LGGALFIIALPKERGEL"
FT   gene            527729..528421
FT                   /locus_tag="BACI_c05680"
FT   CDS_pept        527729..528421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05680"
FT                   /product="response regulator, cheY-like receiver domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03282"
FT                   /db_xref="GOA:D8H0R7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R7"
FT                   /protein_id="ADK03282.1"
FT                   /translation="MDEEIEVLIVEDDIRIADIHRRFTEKIEGFKVIGTATTGEQAKEW
FT                   LDLVKPQLVLLDVYLPDMQGTELVTYIRHNLHDTDIIMITAASETDVVRHALRGGVTDY
FT                   IVKPLMFDRFKASLENYQKKLVQLKKNNQLSIEQIEHLWSQRGVKGNEIEYAPKGIDPL
FT                   TLAKIKKHMLTVNEEGITAEMLSTMVGVSRSTARRYLEYLISGKKVHAELTYGSVGRPE
FT                   RRYFLVSS"
FT   gene            complement(528464..529768)
FT                   /gene="citN"
FT                   /locus_tag="BACI_c05690"
FT   CDS_pept        complement(528464..529768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citN"
FT                   /locus_tag="BACI_c05690"
FT                   /product="citrate transporter, citM family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03283"
FT                   /db_xref="GOA:D8H0R8"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R8"
FT                   /protein_id="ADK03283.1"
FT                   /translation="MLALLGFAMVFVFMFLIMTKRMSALVALILIPITFALIGGFYADM
FT                   GPMMLEGIQKLAPTGIMLMFAILYFGIMIDSGLFDPVISRILKFVKGDPLKIVVGTAIL
FT                   TIIVSLDGDGTTTYMITVSAMYPLYKRLGMNPLILAGVVMLGAGVTNLTPWGGPTARVM
FT                   SALGLDASELFTPLIPGMIAGALWVVFVAYYLGKKERKRLGIMDIQYLKQMQTTDEQAA
FT                   TVEAAVHKRPKLLWINFLLTATLLVCLILEVMPLPVLFTIAFAIAVMLNYPNLEQQKER
FT                   IASHAGNVLAVVSLVFAAGVFTGILSGTKMVDAMAQSVVTLIPDALGPQLPIITALLSM
FT                   PFTFFMSNDAFYFGVLPILTKAAATYGISAAEMGRASLLGQPVHLLSPLVASTYLLVGM
FT                   AKVDFGEHQRFTLLWAVGTTMVMLIAGIIIGIIPI"
FT   gene            530021..530275
FT                   /locus_tag="BACI_c05700"
FT   CDS_pept        530021..530275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03284"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0R9"
FT                   /protein_id="ADK03284.1"
FT                   /translation="MKTRMEEICSSHEGKVEEIFVNESSYVYEWEKLMMIRKNNGELEK
FT                   VAVGISGNIRLVNVVVGQQIHTDTLLVRLEDDLLITGCE"
FT   gene            530410..530913
FT                   /locus_tag="BACI_c05710"
FT   CDS_pept        530410..530913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05710"
FT                   /product="hypothetical protein; possible lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03285"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S0"
FT                   /protein_id="ADK03285.1"
FT                   /translation="MRTKYVMFAICLFFVFTIVGCGKKQAEAVAIDEKHDKCDICQIGV
FT                   MDNQFATEIILENGKALKFDDIGCMYKWMEINPGEKTKEKFVRDYDSKDWVSLEDATYV
FT                   YDKTITTPMAYNVISFKNKKDAENFVSNYKGKVLSYKELAEHKWEMNKEMMGNPKKGDH
FT                   GGHH"
FT   gene            531203..532072
FT                   /locus_tag="BACI_c05720"
FT   CDS_pept        531203..532072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05720"
FT                   /product="ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03286"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S1"
FT                   /protein_id="ADK03286.1"
FT                   /translation="MYSRRVIVCDGGMVKKTLSFIGAVVVRKQKILLCMLLGLLMTVVA
FT                   CDKQEEPESKPVHVKNEKKQEKHKEQEESKEEKSINLMDKQLLLSATLGDTETAMKLIQ
FT                   DGANINVEGDNGETPVLAATYQNHVETVKALIGAGANIEIKDEKQSNPLLYASREGYTD
FT                   IVKVLIDAGVNTKETTKSGGTALISASERGHVEVVKELLEHTDIDVNYKNARGGTALVE
FT                   AIVLGNGSENHKKVIQMLIDHGADVNTANKENITPLQFAEKRGFKDIANMLRAAGANEV
FT                   VQPQQPVE"
FT   gene            532632..533198
FT                   /gene="glpP1"
FT                   /locus_tag="BACI_c05730"
FT   CDS_pept        532632..533198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpP1"
FT                   /locus_tag="BACI_c05730"
FT                   /product="glycerol-3-phosphate responsive antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03287"
FT                   /db_xref="GOA:D8H0S2"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S2"
FT                   /protein_id="ADK03287.1"
FT                   /translation="MFKEPYIAMIKDWKGYNTYKKLPKTVFLMTGSMLELPERVYELQK
FT                   HGHDVFLHCDFIQGLNTNTEEALSYIQDVIGAQGIISTKGSTIRNANKIGLKTIQRIFI
FT                   VDTLSLTKSIENCKTTKPNAVEIMPGIMPSIIKQLAEEIEFPIIAGGLIQTREDAEIAI
FT                   RSGASAISTSHYEVWIQEEKRSAIL"
FT   gene            533195..534292
FT                   /locus_tag="BACI_c05740"
FT   CDS_pept        533195..534292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05740"
FT                   /product="ABC transporter, ATP-binding protein; probable
FT                   glycerol-3-phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03288"
FT                   /db_xref="GOA:D8H0S3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S3"
FT                   /protein_id="ADK03288.1"
FT                   /translation="MIELKSVSKVYQNAEETAVKGVSVHIKKGEFFVLVGPSGCGKSTL
FT                   LRMIAGLEEISSGDLIINECVANDLEPKDRNLSMVFQNYALYPHLSVEENILFGLKVRK
FT                   VQKEERQKRLMEAVEMVGLKEYVKMKPGQLSGGQRQRVALARAIVSQAPICLMDEPLSN
FT                   LDAKLRAQMRIEIREIQQRLGITMIYVTHDQIEAMTMGDRIMVLNKGSIQQVGTPLDIY
FT                   NKPANEFVASFIGSPSMNINDGEVDKEKGVLHIGQLQIPLSIGQLKQLPAGTVRVGMRP
FT                   EHIALSEEGQEVTLQSVEVLGNESILNFVINGTTWSAKVIGQLLLNKGDKVKLLFSEEK
FT                   LCFFNQNTNERLKVVAEEELKVVAK"
FT   gene            534292..534660
FT                   /locus_tag="BACI_c05750"
FT   CDS_pept        534292..534660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05750"
FT                   /product="probable glycerol-3-phosphate ABC transporter,
FT                   permease"
FT                   /note="N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03289"
FT                   /db_xref="GOA:D8H0S4"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S4"
FT                   /protein_id="ADK03289.1"
FT                   /translation="MIEVSKLPVQTKVSKKKKLWGRTKDLRIGLLFLAPSILLFSIFLF
FT                   YPLFRTIYYSFYLTDIHGEANLFVGLENYQYLFSDPAFYKSIKSTLLFVLYTVPTSIIF
FT                   ALFLALIANGKVRGIGLF"
FT   gene            534679..535224
FT                   /locus_tag="BACI_c05760"
FT   CDS_pept        534679..535224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05760"
FT                   /product="probable glycerol-3-phosphate ABC transporter,
FT                   permease"
FT                   /note="C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03290"
FT                   /db_xref="GOA:D8H0S5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S5"
FT                   /protein_id="ADK03290.1"
FT                   /translation="MGISVAASAVIWLFLFHPSVGLFNNILASMNLPAIAWLTSPDWAL
FT                   FSVSVTTVWVNTGFAFLVILGGLQNIDTSLYESASIDGASYLYKLRRVTLPMLSPTLFF
FT                   IVTVTLISAFQSFGQIDILTHGGPNDATNLIVYSIYKEAFVNHQFGTASAQAMVLFVFI
FT                   FIATLLQFKFAERKVHYK"
FT   gene            535221..536042
FT                   /locus_tag="BACI_c05770"
FT   CDS_pept        535221..536042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05770"
FT                   /product="probable glycerol-3-phosphate ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03291"
FT                   /db_xref="GOA:D8H0S6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S6"
FT                   /protein_id="ADK03291.1"
FT                   /translation="MIVKQWKQNLLLYMLLIISAVMVFFPVLYAFLISFMTPDDIQMRR
FT                   IFPTQFTFDNFINIFQKVPLFTYLYNSLVVSTVVMIGQLIVSSLAAYAFVFLQFKGRNL
FT                   IFFLFISTMLIPWEATMVPNFLTIQNFGWINSFAGMTVPFFATAFGIFLLRQHFMTLPN
FT                   ELKEAAFIEGIGNVRFLFSVVIPYCKTSFITLGVYSFLTTWNMYLWPLLVTTDEKVRTV
FT                   QIGVKQLQSQEVATDWGSVMAGVTVIVIPTLILLFLGQKQLQQGLTKGAIK"
FT   gene            536064..536339
FT                   /locus_tag="BACI_c05780"
FT   CDS_pept        536064..536339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05780"
FT                   /product="probable glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03292"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S7"
FT                   /protein_id="ADK03292.1"
FT                   /translation="MGLVKKGAALLMVATMALSSAACSNSKTEGKPEAQAKVAPVEKNG
FT                   DKTVIRFWHAMGGKTQGVLDGLVADYNKSQNKYEIKAEFKGHMKSL"
FT   gene            536354..537439
FT                   /locus_tag="BACI_c05790"
FT   CDS_pept        536354..537439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05790"
FT                   /product="probable glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03293"
FT                   /db_xref="GOA:D8H0S8"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S8"
FT                   /protein_id="ADK03293.1"
FT                   /translation="MSATKEAPALVQSSEITTKYMIDSKKITPIDSWIKKDKYDTSKLE
FT                   KAITNYYSVDGKMYSMPFNSSTPVLIYNKDAFAKAGLDPEKAPKTYAELQEAAKKLTIK
FT                   EGGNVKQYGFSMLNYGWFFEELLATQGALYVDNENGRKDAAKKAVFNGKEGQKVFGMLD
FT                   ELNKAGALGKYGASWDDIRAAFQSGQVAMYLDSSAGVRDLIDASKFNVGVSYIPYPEDS
FT                   KQNGVVIGGASLWMTNMVSEETQQGAWDFMKYLTKPDVQAKWHTATGYFSINPDAYNEP
FT                   LVKEQYEKYPQLKVTVDQLQATKQSPATQGALISVFPESRDAVVKALEAMYDGKNSKEA
FT                   LDEAAKATDRAISISARTSEK"
FT   gene            537859..538563
FT                   /gene="pphA"
FT                   /locus_tag="BACI_c05800"
FT   CDS_pept        537859..538563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /locus_tag="BACI_c05800"
FT                   /product="serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03294"
FT                   /db_xref="GOA:D8H0S9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0S9"
FT                   /protein_id="ADK03294.1"
FT                   /translation="MKRILVISDIHGEIEKFEQLLEEAQYDAKQDQLILLGDYIDRGPN
FT                   ARAVIEKVKELKEDGALVLKGNHEDMMIKALTTDEERSWNHWVKRNGGDKTLYSYGFVE
FT                   EDIMVNEKDFRKPILQSRVLEEHVKFIQKLDHYIETEEYIFVHAGVEPLKRVSECEPYT
FT                   LMWIRNEFHSEYSGEKVVVFGHTETKTLHGNDNCNVYFGNNRIIGIDGGAVYGGQLNCL
FT                   ELPSKKVYVVKS"
FT   gene            538713..539384
FT                   /locus_tag="BACI_c05810"
FT   CDS_pept        538713..539384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05810"
FT                   /product="probable response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03295"
FT                   /db_xref="GOA:D8H0T0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T0"
FT                   /protein_id="ADK03295.1"
FT                   /translation="MRLLVVEDNASLLESIVQILCDEFEVDTALNGEDGLFLALQNIYD
FT                   AILLDVMLPEMDGFEVIQKIRDEKIETPVLFLTARDSLEDRVKGLDFGGDDYIVKPFQA
FT                   PELKARIRALLRRSGSLTTKQTIRYKGIELFGKDKDVQVDGQSMKLTLKQYELLEYLVQ
FT                   NSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKE
FT                   Q"
FT   gene            539396..540631
FT                   /locus_tag="BACI_c05820"
FT   CDS_pept        539396..540631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05820"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03296"
FT                   /db_xref="GOA:D8H0T1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T1"
FT                   /protein_id="ADK03296.1"
FT                   /translation="MFQKTRIRLTILNSLVFIILIGVLGSIIYSYTYKRIYSGVNESIE
FT                   KAVQHRKNADDKKLPKKIRGYPPIGDPRIMELTWLGNTVEIDIENGKRRFIFEDNLEKF
FT                   SPKKLGTLQDIEVQGRYFRIFAFQKDAKIVQIARDITAEKEMLHTLFLILVIGCSIGSL
FT                   CAIGIGFFLAGRALVPIQNSWEKQQQFVSDASHELRTPLAVIQSKTDVLFQSPSATIEE
FT                   KAMDISTISKECRRLSKLVSNLLLLARSDSNQIEMDKKTFELDKLLEEIVAPYKEIASY
FT                   QEKEMILKVERGVSFMGDRERIHQMMVILLDNAMKYTNEGGQIQIDCTQTSSSIRIQVK
FT                   DDGIGVKEEDIPKLFDRFYQGDKARSTSEGAGLGLSIANWIVEKHYGKISVESKWEEGT
FT                   CFEVIFPKHQKI"
FT   gene            540838..541659
FT                   /locus_tag="BACI_c05830"
FT   CDS_pept        540838..541659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05830"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03297"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T2"
FT                   /protein_id="ADK03297.1"
FT                   /translation="MKKKMMMVFTIGVMSLSILGGASPSETLKGKTDYKQRSKEQLNNG
FT                   KIHAVHTEEKAENLGIETAGKEQITLEKEIHETEVGREAKQLGISIEGKDVGTLSEEIY
FT                   ETKVKQEALKLGISIENTSIINLINQINTIKINDEADKLGISTNGKEIEEIAEEIYGTK
FT                   VREEAGKLGISQKGKEIEVLAQEVYEQKVQEEAKEYHIDLYGKDIYQVLSEINEQKVLQ
FT                   MADELNMDKTNMNVQELAEKIKKDQPEKGKELNFVPVIRTDADAFYSYLTN"
FT   gene            541673..542419
FT                   /locus_tag="BACI_c05840"
FT   CDS_pept        541673..542419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03298"
FT                   /db_xref="GOA:D8H0T3"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T3"
FT                   /protein_id="ADK03298.1"
FT                   /translation="MIRKFKWYIGVALLGIAVWGIYTNGITKYVEKLTFFHIRSGKQVE
FT                   FNRDEKIILSNVPLIQQLPELDRGCEVTSLAMMLQYAGITVDKMKLANEIKKVDFMNDG
FT                   VRGNPNEGFVGNIYTFSESGYGVYHGPLFQLAKKYLPNKAVDLTGKNIEELYKSVKAGQ
FT                   PVVMITNAKFEPLDEDEFTTWETNSGDVSITYNEHCVVLIGYDQESVYIRDPLKDSLDV
FT                   KVPREKFEQAWVQMGSQAISYVKSSK"
FT   gene            542673..544655
FT                   /gene="mcpA2"
FT                   /locus_tag="BACI_c05850"
FT   CDS_pept        542673..544655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpA2"
FT                   /locus_tag="BACI_c05850"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03299"
FT                   /db_xref="GOA:D8H0T4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T4"
FT                   /protein_id="ADK03299.1"
FT                   /translation="MQKIFNWVKCMSIKKKLIISFFLILTIPGLIIGGVSYQTAKTNFE
FT                   QQITGKAKENISILNTVISQNIEEKFVDAAYFADILTEDTYPNGQEEIVRTKLAQYIKL
FT                   HPEVEGIYIGTQTGKFIREPFIQMSDGYNPTDRDWYKEAHENKGKVIVTAPYQSASTKN
FT                   MVVTIAKEVKDGKGVIGINLNLDNILKISKMINIGEKGYAVILDQNKQIVSHPSRKPGA
FT                   KVTDPWIKPIYEDKQGNVAYTEKDDKKNLIFATNEKTGWKVVGVMFDEEITQAANPVFY
FT                   KTFIVIAIAIVFGSVLIYFITKSITRPLRKIADSAYKISKGDLTEKITIHSKDDIGKLG
FT                   NSFNEMSASLQDVITQISFSAEHVAASAEELTASVQQANDATDQITIAMEQVSGGAESQ
FT                   SQGVEEGAATLQQVNAAIQDVNGSAESISISSLHARERAKEGEDLVEQTATQMQSISRS
FT                   VSESDAIIKLLDEKSKQVGAISEAIQNIATQTNLLALNAAIEAARAGEQGRGFAIVADE
FT                   VRKLAEQSGESSGEIANLIAEIKADIEHTVKAMDNVNGEVQQGLDVVTKTKVSFTEILS
FT                   STTHIVSQVNEMVETTKRIAGDANEVTNAIDEIAAAAEENTASMQSVAASTEEQVNSME
FT                   EISSASQNLAEMAEELQAMTSKFKV"
FT   gene            544734..546338
FT                   /locus_tag="BACI_c05860"
FT   CDS_pept        544734..546338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05860"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03300"
FT                   /db_xref="GOA:D8H0T5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T5"
FT                   /protein_id="ADK03300.1"
FT                   /translation="MKKRKRLWNLWKTITLLVCTVVIFSLLVTDILISHNVERTTEDSQ
FT                   AEKAKTIAHIVANDSIVIDGLIGKADTSAIQTYTNRILKNTGVQFIVVMDMNGIRKSHP
FT                   NPQKIGHHFIGGDEGPALKGKEHVSLAEGTLGISMRVFVPVFSETGEQLGAVAVGISAD
FT                   NVKERVKESRHIIYIGVGVGVLVGMIGAILLARHIKKSLFGLEPHRIAKILEERNTMLQ
FT                   SVKEGIIAVDKEANVTLINNEAKRLFKKSGLEEDFIGKDVELYMPNSRIKEVLQTGEVQ
FT                   LNEEQNIYGITIVTNRVPLYVKGEIVGAIATFRDKTEIRKLAEELTGIRLYAEALRAQS
FT                   HEFMNKMHVVLGLTHMKQYEELQKYISGMVSEHQYEIGGVMKRIKSPVFAGFLLGKLSY
FT                   AREKNIKLIISEDSYMPEIDDESITHELITIVGNLIDNALEAVTNCEKKQVEVEIQYGN
FT                   TLIITVQDTGKGIQEKEIEALFTKGYSTKGDNRGYGLYLVKESIQRINGEIHMHSLVGK
FT                   GTKITIEIPKGRDERQI"
FT   gene            546335..547042
FT                   /locus_tag="BACI_c05870"
FT   CDS_pept        546335..547042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05870"
FT                   /product="response regulator"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03301"
FT                   /db_xref="GOA:D8H0T6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T6"
FT                   /protein_id="ADK03301.1"
FT                   /translation="MIKVLIVEDDPMVAMLNTHYLEQVGGFELVQAVNSVKSAIEVLEE
FT                   SRIDLVLLDIFMPEETGFELLMYIRNQEKEIDIMMISAVHDMGSIKKALQYGVVDYLIK
FT                   PFTFERFKEALTIYREKLTFMKEQQKISQSELDSLILQKEKREPTVTKELPKGLTKQTL
FT                   QLIWQKIKSLNGRAFTTDEMSQLVGISRVSIRKYVMFLTDIGVLENEMMYQHVGRPVSK
FT                   LRCVDQKKIEFYV"
FT   gene            547165..548511
FT                   /gene="maeN"
FT                   /locus_tag="BACI_c05880"
FT   CDS_pept        547165..548511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeN"
FT                   /locus_tag="BACI_c05880"
FT                   /product="Na+/malate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03302"
FT                   /db_xref="GOA:D8H0T7"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T7"
FT                   /protein_id="ADK03302.1"
FT                   /translation="MGIQKNVEAVSFSEGNEVQRESFASKIMNVKIGVIPLPLYVVLAA
FT                   IIYGASVYNKLPADMIGGFAVIMIMGIFLGDIGMRIPILKNIGGPAILSLFIPSLLVFF
FT                   NWMNPASMEAATMLMKKSNFLYLYISCLVVGSILGMNRKVLVQGFVRMFIPLVVGTLAS
FT                   VAVGLLVGSLFGFEMKQTFFFIIVPIVSGGIGEGILPLSLAYSDILNESSATFVSQLIP
FT                   AAIIGNMFAIVSAGYMKRLGEKKPELSGNGVLVKTDNQAELLKEQNTEKPIDFSLMGAG
FT                   LLIACTFFIFGGFASKFIGIPGAIIMIFSAALVKYFKLMPAKMEQGAFHLYKFISKNLT
FT                   WPLMVGLGLLYIPLKDVAAVLSVGYVVVCASVVITMVASGFLVGKVMKMYPVESAIVTG
FT                   CHSGLGGTGDVAILSASNRMELMPFAQISTRLGGAAMVVTATILLKMFS"
FT   gene            548571..549770
FT                   /gene="sfcA"
FT                   /locus_tag="BACI_c05890"
FT   CDS_pept        548571..549770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfcA"
FT                   /locus_tag="BACI_c05890"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.38"
FT                   /note="malic enzyme, NAD-malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03303"
FT                   /db_xref="GOA:D8H0T8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T8"
FT                   /protein_id="ADK03303.1"
FT                   /translation="MLENQINERSLLLHKELVGKIEITSKVEVNSADDLSLTYTPGVAE
FT                   SCKAIAADEETVYDYTARGNMVAVVSDGTAVLGLGNIGPKAAMPVMEGKSILFKKFANV
FT                   DAFPLCLGTTDVDEIVTLVKNLEPTFAGINLEDIAAPRCFEIEKRLKEETNIPVFHDDQ
FT                   HGTAIVVLAAVINALKVVSKQMDHVKIVINGAGSAGIAIGKLLLKAGAQHITLVSLEGI
FT                   VCEGEAWMNEAQIEVSKKTNREHVRGTLKEAIHQADIFIGVSAPNVLTKELVQMMNEKA
FT                   IVFAMANPIPEIFPEDALEAGAAVVGTGRSDYANQVNNVLAFPGIFLGALDVRATDITE
FT                   EMKLAAAYGIANIITDEERNANYVIPNPLDKRVVPSVAEAVAKAAIDSGVAQIMKIPSY
FT                   "
FT   gene            complement(550066..550590)
FT                   /locus_tag="BACI_c05900"
FT   CDS_pept        complement(550066..550590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05900"
FT                   /product="hypothetical protein; possible lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03304"
FT                   /db_xref="InterPro:IPR032366"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0T9"
FT                   /protein_id="ADK03304.1"
FT                   /translation="MKKIGTMLLFSILIAGCTQAQPDLKKTKKEAIATSSTQVNAPSFF
FT                   HLSVLKDVNWEETPSFIQEKIPLKGIEEKIAIADSPIIANEKNEIMWYFLDPEMPTGKL
FT                   SIIALKQGSVTPTPLLFQQESSEPTWTTSNTIDSTTNELPLTMSLPSSGLWVLNIYVNE
FT                   KYYDQFVITAE"
FT   gene            complement(550706..551638)
FT                   /locus_tag="BACI_c05910"
FT   CDS_pept        complement(550706..551638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05910"
FT                   /product="probable transporter, DMT family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03305"
FT                   /db_xref="GOA:D8H0U0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U0"
FT                   /protein_id="ADK03305.1"
FT                   /translation="MIMNNSRRIGLIMIITGATLWGLSGPMIQWLFQHTNVSSVDFLTI
FT                   RLLLAGIFILSFLLIKKQNIFQIWKHPRYSIQLIIFSILGMLGAQYAFIETVHISNAVT
FT                   ATLFQFLGPVLITMYVAFEQRKFPAPIQLLAIITALTGTYFIITNGSIENIVLSKEAII
FT                   FGLLTAIGFAFYTLHPASLIKECGTIVVIGWGMLIGGIALLICNRSFEWTQLSQTFTLK
FT                   TFSMLILIIISGTLSFLLYIGSLKYLAATETSILSSIEPLVAAIVSIAWLNESFGAYQL
FT                   LGGLCIVLSVIFLTMPQKENEATFSTEQI"
FT   gene            551753..553153
FT                   /locus_tag="BACI_c05920"
FT   CDS_pept        551753..553153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05920"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03306"
FT                   /db_xref="GOA:D8H0U1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U1"
FT                   /protein_id="ADK03306.1"
FT                   /translation="MLELTPNLNMNSKKALYVQLYEYIKKEIKDGTISAFTKLPAKRKL
FT                   AGYLQVSKNTIEAAYEQLLAEGYIESISRKGYFVCKFEQMMDVEGSEVEVEEIPFREGN
FT                   YTFDFTQTGVDTNTFPFTTYRKLINDVWQPHNNDLLFLGHPQGELSLREEIANYLYESR
FT                   GVRCSASQIVLGAGTQILVKLLFQLLKGSNYAVENPGYHRKMVVFEQGEKKVQMLSLDR
FT                   DGICMADLENSDANVVFVTPSHQFPYGMIMPITRRTQLLQWAKKEEDRYIIEDDYDSEF
FT                   RYSGRPIPALQGLDTDGKVIYMGTLSKALLPSLRMSYIVLPKNLIKKYQKEYLFYTQSV
FT                   SRMDQEVIRKFLNEGYSEKHIHKMRVVYRKKRDRLVFEIEKYFSNHVEVIGEDSGLHIL
FT                   LKVHNGMREEELIKEAAKYSIKIYPVSTYYKADTAPENVVLLGFAILSEEEIEQAVQLL
FT                   NIAWFRKK"
FT   gene            complement(553187..553699)
FT                   /locus_tag="BACI_c05930"
FT   CDS_pept        complement(553187..553699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05930"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03307"
FT                   /db_xref="GOA:D8H0U2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U2"
FT                   /protein_id="ADK03307.1"
FT                   /translation="MDIHVLTKDEAEIYLELRVEGLKQNPEAFSSSYEDIINKECAIEY
FT                   KAQKLAQDENYTLGAFKDGKLIGVATLETKPYVKQEHKAKIGSVYVSPKARGLGAGKAL
FT                   IKECLELAKSLEVEQVMLDVVVGNDGAKKLYESLGFKTFGVQERSLKYNGQYWDEEHMV
FT                   LFLDENK"
FT   gene            complement(553991..555454)
FT                   /locus_tag="BACI_c05940"
FT   CDS_pept        complement(553991..555454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05940"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03308"
FT                   /db_xref="GOA:D8H0U3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U3"
FT                   /protein_id="ADK03308.1"
FT                   /translation="MSKLSLKIGTYFLILALCIETIAFVSFYKSISKMRIEEETLALLE
FT                   KGNRYSNKITRRAKWSAHAQEKKNIERTEYNKNPNRPIYPDFDIADEAEHLVESESISN
FT                   SDIAIIITDNNGKIISTSEPVTKAMQKQLTCKTEPIPKNGLIVEKNWKKSKFITTVSPI
FT                   HTTEFQGKLYMLLKTSFLENMLLKLMKQFLIISVLTIILTTISVFIFSRVITEPLIKMK
FT                   RATEKMSKLNKPIQLGIKRNDELGSLAKTIEDLSSELTYMKKERGEFLASVAHELLTPL
FT                   TYMKGYAKVAKRDSLTKEEREEYLQIIEDETDSVTDLVQDLFMLVQLEQHQFVIKKQKV
FT                   LLRPFLERMVEKTKTTLTNKQMQLHVYCKDDLEVCIDERRMEQVMLNLLHNAYQHSLEN
FT                   TTITIRVLAETNSFTISVQDEGEGIPEEDIPHIFDRFYRVDKSRTRATGGKGIGLAVAK
FT                   EIVELHNGSILVTSKLDVGTNFIIELPFE"
FT   gene            complement(555520..556191)
FT                   /gene="llrF"
FT                   /locus_tag="BACI_c05950"
FT   CDS_pept        complement(555520..556191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="llrF"
FT                   /locus_tag="BACI_c05950"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03309"
FT                   /db_xref="GOA:D8H0U4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U4"
FT                   /protein_id="ADK03309.1"
FT                   /translation="MVKILLVDDEERMLRLLDLFLSPRGYFCMKATSGLEALKLIEQKD
FT                   FDIILLDVMMPNMDGWDTCYQIRQISNVPIIMLTARNQNYDMVKGLTMGADDYITKPFD
FT                   EHVLVARIEAILRRTKKDGFVSFNGIEWDKTKHTVTVYDEKISLTPIEFSLLGLFLQNT
FT                   NRAYSRDDLIEKIWGYETDIEYRTIDSHIRNIRDKLRKKGFPVENYLETVYKVGYKWKS
FT                   E"
FT   gene            complement(557003..557509)
FT                   /locus_tag="BACI_c05960"
FT   CDS_pept        complement(557003..557509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05960"
FT                   /product="acetyltransferase, GNAT"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03310"
FT                   /db_xref="GOA:D8H0U5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U5"
FT                   /protein_id="ADK03310.1"
FT                   /translation="MEIRLLTTEDAEIYLKVCMEGLTKNPEAFSSSYEDVLKHEDPVAA
FT                   MAKRLSNPDKYTLGVFKDKDLIGIATLETKPFIKQEHKAKIGSVFVSPKARGLGAGRTL
FT                   IKAIIENADKLHVEQLMLDVVVGNDAAKKLYESLGFQTYGVQERSLKHNGQYWDEEHMV
FT                   LFLND"
FT   gene            complement(557738..558544)
FT                   /gene="fdhD1"
FT                   /locus_tag="BACI_c05970"
FT   CDS_pept        complement(557738..558544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD1"
FT                   /locus_tag="BACI_c05970"
FT                   /product="formate dehydrogenase accessory protein"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03311"
FT                   /db_xref="GOA:D8H0U6"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U6"
FT                   /protein_id="ADK03311.1"
FT                   /translation="MGPTQETYTIVRYHSGTFSKQIDEIVTESPITIKLNGEEYVTVVC
FT                   TLNYIEDMVIGFLISEGIISSYKDVGELWVQKDNGIVHVTSSKVNPLYQNLYNKRYITS
FT                   CCGKGRQGFIFANDAAKAKNLHNIHVTITPEECFHLMNTLQQSSTTFRQTGGVHNTALC
FT                   DRNNILLSRMDIGRHNALDKIYGHCLRNDISVKGKIIAFSGRISSEILLKVSKIGCEIV
FT                   LSKSAPTKLALQLAHDLGITVVGFIRNESCNIYTHPHRIDGYQSNN"
FT   gene            558848..561784
FT                   /gene="fdhF1"
FT                   /locus_tag="BACI_c05980"
FT   CDS_pept        558848..561784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF1"
FT                   /locus_tag="BACI_c05980"
FT                   /product="formate dehydrogenase, alpha subunit, anaerobic"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03312"
FT                   /db_xref="GOA:D8H0U7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U7"
FT                   /protein_id="ADK03312.1"
FT                   /translation="MAEQTVRVTVDGKEFSASGEKTILQLFNESNLEHPQICHVPEVDP
FT                   IQTCDTCIVEVDGKLMRACSTQIENGMHIERQSQRAKGAQTEAMDRILENHLLYCTVCD
FT                   NNNGNCKVHNTVHMMGIEEQKYPYEPKVSACEVDMSHPFYRYDPNQCIACGQCVEVCQN
FT                   LQVNETISIDWSLDRPRVIWDHGVSINDSSCVSCGQCVTVCPCNALMEKSMLGEAGFMT
FT                   GLNPDVLDPMIDFVKDVEPGYSSILAVSEVEAAMRKTKVNKTKTVCTFCGVGCSFEVWT
FT                   KDRHILKVQPVSDAPVNGISTCVKGKFGWDFVNSEDRITKPLIRQGDMFVEASWEEALE
FT                   VVASNMQHIKSEYGSDAFGFISSSKVTNEENYLMQKLARQIYGTNNVDNCSRYCQSPAT
FT                   DGLFKTVGMGGDAGTVKDIAEAGLVIIVGANPTEGHPVLATRVKRAHKLHEQKLIVADL
FT                   RKHEMAERADLFIHPRQGTDYVWLAGITKYIIDQDWHDKKFIAENVKNFDEYSKMVEKY
FT                   TLDYTEEITGISKENLKEMARMVYEADGTCVLWGMGVTQNTGGSTTSAAISNLLLVTGN
FT                   YRRPGAGAYPLRGHNNVQGACDMATLPNWLPGYQAVSDDTLRAKFEKAYGTTIPKAPGL
FT                   NNIAMLLAAEEGKLRGMYVMGEEMALVDSNANHVQHILANLDFLVVQDMFLSKTARFAD
FT                   VILPAAPSLEKEGTFTNTERRIQRLYEVLKPLGDSKPDWWILQKVARALGGDWNYESPS
FT                   EIMDEIASLAPLYSQATYDRLEGWNSLCWGSHDGSDTPLLYVDGFNFPDKLARLSLDEW
FT                   IPPVVAPDEYDLLLNNGRMLEHFHEGNMTNKSAGILSKVSEVFVEISPELAIERNVKDG
FT                   GLVELASPFGKIKVQALITDRVTGKELYLPMHATINEEAINILTGTATDLYTCTPAYKQ
FT                   TMVKMRVLREKGNRPLPSSNPRDKNRNPQNGVEIEQKWQRKQYVSLVD"
FT   gene            561797..562279
FT                   /locus_tag="BACI_c05990"
FT   CDS_pept        561797..562279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c05990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c05990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03313"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U8"
FT                   /protein_id="ADK03313.1"
FT                   /translation="MAKEITLIKKKVVTEEEQKQQVADALLNELSNNREAVEETMQLLA
FT                   QLQKAGILDAAISLLAAKEDVSKIAVEQLNREPVKNALNNMMGAGEALSSVDPEVTKQI
FT                   TSSLVTGLQFATDELNSGKKTKVMDFFKVLKDPDINRAITFGFSFLKAFGQGLEKK"
FT   gene            562297..562449
FT                   /locus_tag="BACI_c06000"
FT   CDS_pept        562297..562449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03314"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0U9"
FT                   /protein_id="ADK03314.1"
FT                   /translation="MGSNHHFFHCMYKSVHVKRNILLLKRWVRNGNMESISNIVLECGG
FT                   IYATP"
FT   gene            562436..564307
FT                   /gene="glpQ1"
FT                   /locus_tag="BACI_c06010"
FT   CDS_pept        562436..564307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ1"
FT                   /locus_tag="BACI_c06010"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03315"
FT                   /db_xref="GOA:D8H0V0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V0"
FT                   /protein_id="ADK03315.1"
FT                   /translation="MQHRKRLSIPGVMGHSFQTVKFAFWNVLTFQLAYKLLAAIVFVPL
FT                   FGIIFNKLLYFGGYANATNDELLAFLKTPYGILAIVILSLLALFLIFTEFAVLIIISYF
FT                   AHKRQKVKLRPILYKTVTYLPTLFTYCLPGFILYAVVLLPLLNMGYETALIPQIQIPNF
FT                   ITGELFKTTMGQVGYYTFFAVVAYLNLRWIFVLPIVVLEQKPFRVAARKSAKLVKESFF
FT                   KVLFFLVGFFISIGIVYVLFLGIYLLCLWGVYEFTNPKGTFALLAESTMSVFLTSTLYL
FT                   FSFIVTPFYIMAITRLYLQKVPVEDVLLEEGLDYSKTKADKCFFQKHRWKFIGVYIVGI
FT                   ITAGMVVAFIVTFITNTYKEPIIMAHRGYISKGVENTKEALQGAIDAKADYAEIDVLQT
FT                   KDGELAVIHDLKLKRLANANVHVSDLTMDELRQLTLSQDGFSGQISTLDEIIKLAKGKI
FT                   KLNIEVKLHGGEKDFVNKVLKTIKDNEFEKQCVIQTLHYPLIKEFKRTNPNIKVGYILY
FT                   ASRAHLKNVKADFYVAEEYMLNKKLVKEARKLNKPIYVWTVNDMESLKGYYKLNVDGII
FT                   TDYPEDARETIKMLKEQEEEESDLFNKITETTDDLFSKLFISYPAAS"
FT   gene            564675..565808
FT                   /gene="ald"
FT                   /locus_tag="BACI_c06020"
FT   CDS_pept        564675..565808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="BACI_c06020"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="L-alanine dehydrogenase, NAD-linked alanine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03316"
FT                   /db_xref="GOA:D8H0V1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V1"
FT                   /protein_id="ADK03316.1"
FT                   /translation="MRIGVPAEIKNNENRVAMTPAGVVHLIRNNHEVFIQKGAGLGSGF
FT                   TDAQYVEAGAKIVDTAEEAWNIEMVMKVKEPIESEYKHFSEGLILFTYLHLAPEPELTK
FT                   ALIEKKVVSIAYETVQLENRSLPLLAPMSEVAGRMAAQIGAQFLEKNKGGKGILLAGVP
FT                   GVKRGKVTIIGGGQAGTNAAKIAVGLGADVTIIDLSAERLRQLDDIFGNQVKTLMSNPY
FT                   NIAEAVKESDLVIGAVLIPGAKAPKLVTEEMIKSMEPGSVVVDIAIDQGGIFETTDRIT
FT                   THDNPTYEKHGVVHYAVANMPGAVPRTSTLALTNVTVPYAVQIANKGYKEACLGNSALL
FT                   KGINTLDGYVTFEAVAEAHGVEYKGAKELLEAETVSC"
FT   gene            565912..567327
FT                   /locus_tag="BACI_c06030"
FT   CDS_pept        565912..567327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06030"
FT                   /product="amino acid permease"
FT                   /note="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03317"
FT                   /db_xref="GOA:D8H0V2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V2"
FT                   /protein_id="ADK03317.1"
FT                   /translation="MANLFKKKSVTQLLGESKSKTLTKTLGAFDLTMLGIGAIIGTGVL
FT                   VLTGLVAARDAGPAVIFSFMIAAIVCGFAALCYAEVASTLPVSGSVYTYSYATIGEFIA
FT                   HLMGWTLLSVYVVTTAAVAGGWTGYFNNLVSGFGLEIPAELLKIPSQGGIVNLPAVVIT
FT                   LVLTWLLSRGTKESKRVNNIMVLIKIGIVILFIAVGAFYVQPENWTPFAPYGISGIFAG
FT                   GAAVFFAFLGFDALATSAEEVKNPQRDLPIGIIASLVICTIIYVVVCLVMTGMVSYKEL
FT                   DVPEAMAYVLEVVGQDKVAGVIAVGAVIGIMAVIFAYIYATTRVFFAMSRDGLLPKSFA
FT                   KINKKTEAPVFSTWLTGIGSALIAGFIDLKELSNLANIGALLTFAMVGVSVIILRKTHP
FT                   NLKRGFMVPLVPTLPLISIACCLFLMFNLPLTTWIYFGIWLAIGVVVYFVYSKKHSHLK
FT                   DDGSSQDNLEQAN"
FT   gene            567594..567971
FT                   /locus_tag="BACI_c06040"
FT   CDS_pept        567594..567971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06040"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03318"
FT                   /db_xref="GOA:D8H0V3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V3"
FT                   /protein_id="ADK03318.1"
FT                   /translation="MAGNKVETPQETCSQTIIHEEVVDQVKQTIPTDESLSKVAELFKV
FT                   LGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYS
FT                   LADQHVIHIFEQAFEHVNEEE"
FT   gene            567996..570362
FT                   /locus_tag="BACI_c06050"
FT   CDS_pept        567996..570362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06050"
FT                   /product="cation-transporting ATPase, P-type"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03319"
FT                   /db_xref="GOA:D8H0V4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V4"
FT                   /protein_id="ADK03319.1"
FT                   /translation="MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKT
FT                   MVLETAQNKESEVVTEAKQLVTKLEPHIKVQEEKNTKVAKEVFILEGLDCANCAMKIEN
FT                   KVKEMPTVSTATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKGGHD
FT                   HGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYLLIGGDIVWRAV
FT                   RNITRGQVFDENFLMAIATLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSL
FT                   MDIRPDYANVKIGNETKQVSPEDVQIGDYIIVKPGEKVPLDGKVVEGTSMVDTSALTGE
FT                   SVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITK
FT                   FARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGG
FT                   IGGASKSGVLVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYA
FT                   AFAEVYSNHPIAQSIRNAYRKSIDEKIIDDYNEISGHGTVVKVQGKEIFAGNAKLMRKE
FT                   NITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAK
FT                   LVGEAVGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADV
FT                   GIAMGGLGSDAAIEAADIVIMTDEPSKIATAVNIAKRTRRIVWQNIIFALGVKGLVLLL
FT                   GAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL"
FT   gene            complement(570566..572029)
FT                   /gene="pncB1"
FT                   /locus_tag="BACI_c06060"
FT   CDS_pept        complement(570566..572029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB1"
FT                   /locus_tag="BACI_c06060"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03320"
FT                   /db_xref="GOA:D8H0V5"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V5"
FT                   /protein_id="ADK03320.1"
FT                   /translation="MTYYKDDSYALHTDLYQINMAYTYWKDGIHNRRSVFDLYFRKLPF
FT                   ENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEAFLHYLQNMKFTGTVRSMQEGE
FT                   VVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAANNDELLEFGTRRA
FT                   HEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAET
FT                   HKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRINFYGIRLDSGDMAYLSKKARKLLDEAG
FT                   FTNTKIIASSDLDEYTIMHLKSQGAKIDVWGVGTKLITSFEQPALGAVYKLVAIEDTDG
FT                   KLNDTIKISSNPEKITTPGLKRIYRIINRVNDHAEGDYIALDSEEPGKEERLKMFHPVH
FT                   TYISKFVTNFEARELHKDIFVNGERTYELPSILDIQKYNEQSLSLFWEEYMRTLNPEEY
FT                   PVDLSQECWDHKMNYIQTVREQVEKNIQK"
FT   gene            572230..573504
FT                   /gene="nprR"
FT                   /locus_tag="BACI_c06070"
FT   CDS_pept        572230..573504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nprR"
FT                   /locus_tag="BACI_c06070"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03321"
FT                   /db_xref="GOA:D8H0V6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V6"
FT                   /protein_id="ADK03321.1"
FT                   /translation="MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIE
FT                   ASEEILQLLCARLEIAVTDLRDVEEDVKGKLDEWLNALVHLDKPQVERIYEELQGEMKH
FT                   VLDFEIINYYKLLYTRYLIMKRDFPAVEEELERLKKVYKKYSPFQKLLYTYSKALLLSL
FT                   QYKHKESLKYLIETEEMAKEQGYYETGIYYNLSLAYSHLNIPHLAMHFANIAMEGFRNE
FT                   YKFRYVINCQTIIALSYVEKAQYEEALKIYESILREVDSFAEKDMIKAMTLNNMGELYH
FT                   YKNEHDKSKSYFLQSFQLQQTVNMNYIETIYGLAKQSIHLKCYEEAQKWIEKGIECSRS
FT                   DEKYNKMIYSFCIFKYKYFGESQEFKRFLENEAIPFFKSVGSMKELKNAYLELAMYLEN
FT                   EFKYEESNKYYKEVIKVLEEREELN"
FT   gene            573600..573755
FT                   /locus_tag="BACI_c06080"
FT   CDS_pept        573600..573755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03322"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V7"
FT                   /protein_id="ADK03322.1"
FT                   /translation="MKEGSVNYSNSDIYGLNSLKEGSIKYSNPDIYGFNFSEEKVINYS
FT                   NPDIYG"
FT   gene            573931..575631
FT                   /gene="npr1"
FT                   /locus_tag="BACI_c06090"
FT   CDS_pept        573931..575631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npr1"
FT                   /locus_tag="BACI_c06090"
FT                   /product="bacillolysin"
FT                   /EC_number="3.4.24.28"
FT                   /note="thermolysin-like metalloprotease, peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03323"
FT                   /db_xref="GOA:D8H0V8"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V8"
FT                   /protein_id="ADK03323.1"
FT                   /translation="MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSP
FT                   EFVSGDLTEATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRL
FT                   QQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKD
FT                   LGVTPKYEVEPKADLYVYQNGEETTYAYVVNLNFLEPSPGNYYYFIEADSGKVLNKYNK
FT                   LDHVANEDKSPVKQEAPKQEAKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSASSYYLQ
FT                   DNTRGATIFTYDAKNRSTLPGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNR
FT                   NSINDAGAPLKSTVHYGSRYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVT
FT                   EYSSDLIYQNESGALNEAISDVFGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDP
FT                   TKYGDPDHYSKRYTGTGDNGGVHTNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIY
FT                   YRANTQYFTQSTTFSQARAGLVQAAADLYGASSAEVAAVKQSYSAVGVN"
FT   gene            complement(575694..576242)
FT                   /locus_tag="BACI_c06100"
FT   CDS_pept        complement(575694..576242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06100"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03324"
FT                   /db_xref="GOA:D8H0V9"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0V9"
FT                   /protein_id="ADK03324.1"
FT                   /translation="MAETIQNFLTDYYSIAIPLSILINIIISLLGFIPSIFLTAINIQL
FT                   FGVTNGTIISIAGEALGAIISFYIYRIGLQKFTHSKVNKYPKVERLLYVKGREAFLLVL
FT                   SFRFIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVINGTNEAKWI
FT                   VTIAGAIGLFYLWKKWRKK"
FT   gene            576619..577137
FT                   /locus_tag="BACI_c06110"
FT   CDS_pept        576619..577137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06110"
FT                   /product="possible lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03325"
FT                   /db_xref="InterPro:IPR041436"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W0"
FT                   /protein_id="ADK03325.1"
FT                   /translation="MKRISSLFLSSLLALMLILSGCAGKEQKTEKQTGNQSTSVEKISD
FT                   NILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQH
FT                   DKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMNVKDKLVKTVTVLARDKSGDLGYK
FT                   IITSYPSDK"
FT   gene            577153..577425
FT                   /locus_tag="BACI_c06120"
FT   CDS_pept        577153..577425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03326"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W1"
FT                   /protein_id="ADK03326.1"
FT                   /translation="MYTTLQYFLKSYCTLSIHEDEIVGVMEEFIEQEDEEIVLKLRDEL
FT                   LYMKKKDAWEEACVLAARQGNRMWSLEETKDHLTTFLVLLQKKKA"
FT   gene            complement(577474..578736)
FT                   /locus_tag="BACI_c06130"
FT   CDS_pept        complement(577474..578736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06130"
FT                   /product="possible vancomycin b-type resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03327"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W2"
FT                   /protein_id="ADK03327.1"
FT                   /translation="MKLSKILIGSAIAGGILLCVGGVSGYQYVSKLNNQLDTTALPNTT
FT                   FEGISLDGKNKKDIQAIINQKITELDQKSLTYIFQNDKQTYTWKDLGINYKEKDIIDKI
FT                   FKEQEGNAINRYKMRKQAENGELKRDYKLTPQLNTTAYESFMKDKYNETLKNPVNAELS
FT                   IEGTTVNISQSQNGEKIDKGKLTDLTKQAITSGTSDITLPVTLLKPERSTEDIQKMGIK
FT                   EVIAEYSTPMAGRNGNQSFNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAV
FT                   YSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPD
FT                   LKFKNNTGNHIYIQAFSNGGSITTRIFGTNTGKNVEVSSQVISRTNDKITAVTYKKVTQ
FT                   NGEVISNGQISKSVYKSAPKQ"
FT   gene            complement(578971..579987)
FT                   /locus_tag="BACI_c06140"
FT   CDS_pept        complement(578971..579987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06140"
FT                   /product="transcriptional regulator, LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03328"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W3"
FT                   /protein_id="ADK03328.1"
FT                   /translation="MMKSDMNKDTRAKKGRSKKKRLLWFLLIPLLIIALGAGGYSFHIY
FT                   SKAKSILSNAYSELGRGDKSSKREKAVKPMTDNISILIMGVDESDIRDKNYGKATRTDA
FT                   LLLATINKNDKSVKLVSIPRDSRVYIKSREKYDKITHAHVFGGVDSTIDTVENFLDVPV
FT                   DYYVKFNFKSFIKIVDSLGGITVDVPVEFTEQNSKDEADAIHLKKGRQHLNGEEALALA
FT                   RTRHIDSDYMRGQRQQLVLEAIAEKALSLNSINKIGGLLDAVDKDLKTNLTFDDMMTIA
FT                   KNSMGSNLKMDKLQVEGTDKYIGGIYYYVPNEKSVNNISTTLQEHLGVTNKNEHKKL"
FT   gene            complement(580248..581426)
FT                   /gene="nupC2"
FT                   /locus_tag="BACI_c06150"
FT   CDS_pept        complement(580248..581426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nupC2"
FT                   /locus_tag="BACI_c06150"
FT                   /product="nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03329"
FT                   /db_xref="GOA:D8H0W4"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W4"
FT                   /protein_id="ADK03329.1"
FT                   /translation="MKFITFFLGLIVVFFLAYIASNNKKHIKFKPIFIMLLIQLILTYL
FT                   LLNTEIGLILIRVISSLFTKLLEYAADGINFVFGGLANKGEMPFFLTVLLPIVFISVLI
FT                   GILQHFKILPFFIRWIGYFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKH
FT                   RLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIVLIINPYDVKDDEDI
FT                   LEIKGEKQSFFEMLGEYILDGFRVAIVVGAMLIGFVALISCINDLFLIIFGITFQQLIG
FT                   YVFAPIAFLIGVPSSEIVAAGSIMATKLVTNEFVAMMDLSKISNSLSPRTVGIISVFLV
FT                   SFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML"
FT   gene            581518..581904
FT                   /gene="gloA1"
FT                   /locus_tag="BACI_c06160"
FT   CDS_pept        581518..581904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA1"
FT                   /locus_tag="BACI_c06160"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="glyoxylase I"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03330"
FT                   /db_xref="GOA:D8H0W5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W5"
FT                   /protein_id="ADK03330.1"
FT                   /translation="MNISRVHHVAIICSNYEVSKDFYTRILGFKAINEVYRKERDSYKL
FT                   DLCVGKEYQIELFSFPNPPKRPRFPEAAGLRHLAFAVTNIEEAVQHLSQCGVETEAIRI
FT                   DEITGKKFVFFQDPDGLPLELYEV"
FT   gene            582012..583310
FT                   /gene="yqhB"
FT                   /locus_tag="BACI_c06170"
FT   CDS_pept        582012..583310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqhB"
FT                   /locus_tag="BACI_c06170"
FT                   /product="conserved hypothetical protein with CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03331"
FT                   /db_xref="GOA:D8H0W6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W6"
FT                   /protein_id="ADK03331.1"
FT                   /translation="MDILKLLMVAILIGLTAFFVAVEFAIIKVRSSRIDQLVSEKRRGA
FT                   LAAKKVTSNLDEYLSACQLGITITALGLGWLGEPTIKHLLEPLFLKLNLSPAIASTVSF
FT                   IIAFAVITFLHVVIGELAPKTFAIQRAEQVSLLLSKPLIYFYRIMYPFIWALNGSARLV
FT                   TGLFGLHPASEHEVAHSEEELRLILSESYESGEINQREFKYVNNIFEFDNRVAKEIMVP
FT                   RTEVIGLYEDEPFETHIKIIAQEKYTRYPVFGEDKDEIIGMVNVKDLFIRYMDGNRDEE
FT                   CSITPYTRPVIEVLENIPIHDLLLQMQRKHIPLAVLYDEYGGTAGIVTLEDILEEIVGE
FT                   IRDEYDEDEHPPIEHISEGCKIVEGKVLISEVNDLFGIHLIADDVDTIGGWIMVQKQIV
FT                   AEGDIIEKHGFSFKVLEKDMHQIKRVEIKKVEE"
FT   gene            583473..584906
FT                   /gene="aspA"
FT                   /locus_tag="BACI_c06180"
FT   CDS_pept        583473..584906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="BACI_c06180"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03332"
FT                   /db_xref="GOA:D8H0W7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W7"
FT                   /protein_id="ADK03332.1"
FT                   /translation="MIATKDIRIEKDFLGEKEVPSIAYYGVQTLRAVENFPITGYRIHP
FT                   SLITAMAIVKKAAALANMDTGYLAKDIGHEIAEAAQEIVDGKFHDQFIVDPIQGGAGTS
FT                   INMNTNEVIANRALERMGYEKGEYAKISPNTHVNMAQSTNDAFPTGIHIATLMMLEELL
FT                   ITMEELHAAFRAKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLARDIKRIKQSRQ
FT                   HLYEVNMGATAVGTGLNANPTYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSA
FT                   ALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAF
FT                   QVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIKGITANEEL
FT                   LKQYVEKSVGIITAVNPHIGYEAASRIAREAIETGKSVRELCLEHGVLTEEELDIILDP
FT                   FEMTHPEIAGASLLKDKKM"
FT   gene            complement(584946..586565)
FT                   /gene="lctP"
FT                   /locus_tag="BACI_c06190"
FT   CDS_pept        complement(584946..586565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BACI_c06190"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03333"
FT                   /db_xref="GOA:D8H0W8"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W8"
FT                   /protein_id="ADK03333.1"
FT                   /translation="MSTWTQIYDPLNNIWLSALIAALPIFCFIICLMGLKMKSYIAGLY
FT                   SVIVAIILAIFVYKMPATVAVASAGFGILSGFYPICTIVIAAIFLYKLTVKTEQFNIIR
FT                   DSISSITNDQRLQVLLIAYSFGAFLEGAAGLGVPVAITAALLVGMGFNPLKAAGICLVA
FT                   NIAGGAMGAMGIPVTVPAQLTELDALTIGRQTVLILPFISIVLPFLLVSMVDGIKGIKE
FT                   TWQGILVSGISFAITQFVVTYFLGAELTNIFAAVVSMISLALFLRVWQPKSSTKEEKQK
FT                   EKESHTFNQILYAWSPFVFLTAFVTIFNLKPIKALFAPDGALANLVFNIQFPGLHNAVM
FT                   KTTPITKADTPFAAVFKFDVFSSTTTAIVLAIIVSLIVYRVKGKMVKELMVETMKELKA
FT                   PVYTICSVIALAYVENYSGMSSTLGLAFSSTGNAFPILSPILGWIGVFITGSVVSSGSL
FT                   FAPLQAVTADQLNIVPSTLVALNVVGGTMAKMVSPQSVAVACAAVGLVGKESALFKTAM
FT                   KYSLIFLAIISLLQLNAVFNIF"
FT   gene            587377..587664
FT                   /locus_tag="BACI_c06200"
FT   CDS_pept        587377..587664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06200"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03334"
FT                   /db_xref="GOA:D8H0W9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0W9"
FT                   /protein_id="ADK03334.1"
FT                   /translation="MSQNQFECHISEEDVQMLRALAHPLRLRLVMELMQRGTCNVTQLQ
FT                   EVLEIPQSTVSQHLTKLKQNKVVRFERRGLEVYYQIHNDKVSEVVKTLFS"
FT   gene            587856..588035
FT                   /gene="sspH1"
FT                   /locus_tag="BACI_c06210"
FT   CDS_pept        587856..588035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspH1"
FT                   /locus_tag="BACI_c06210"
FT                   /product="acid-soluble spore protein H"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03335"
FT                   /db_xref="GOA:D8H0X0"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X0"
FT                   /protein_id="ADK03335.1"
FT                   /translation="MDVKRVKQILSSSSRIDVTYEGVPVWIESCDEQSGVAQVYDVSNP
FT                   GESVHVNVTALEEK"
FT   gene            complement(588127..589482)
FT                   /locus_tag="BACI_c06220"
FT   CDS_pept        complement(588127..589482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06220"
FT                   /product="Di-/tripeptide transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03336"
FT                   /db_xref="GOA:D8H0X1"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X1"
FT                   /protein_id="ADK03336.1"
FT                   /translation="MDAALKLDKAGEQQSPKKHPPGLYLLFLTEMWERFSYYGMRGLLV
FT                   LYLTTAAVSGGLGFDKAFAVQLYGTFTAAVYFMPIIGGWLTDHYITRRHAITLGGIIMA
FT                   IGNFVLFSMNTKTGLFLGLILLVIGNGFFKPNISTLLGELYSENDSRRDSAFTIFYMGI
FT                   NVGAFFAPLICGFLAEDFFKTSVDGVMVMGYKYGFLAACIGMIIGQIVFNLLAPRYLGT
FT                   AGTTVVGKKTKNQPAVEKKPLTKQEKNRTWAIVILTCFVVFFWAGFEQAGSSLTLYTDK
FT                   FVDRTIFGWEIPTSWFQSVNPAFIVLLAPFVSMLWLKLSKSKRGDLKIPTKMAFGMILL
FT                   GIGYLVLTLAVLKTGSSEADITVKANLLFIVITYMFHTIGELFLSPIGLSMVSAIAPVK
FT                   LASLLMGVWLAGSGMANWLAGKLASFTQSLGYLEVFASICKYLQVLALSLSS"
FT   gene            complement(589864..590817)
FT                   /gene="fecB"
FT                   /locus_tag="BACI_c06230"
FT   CDS_pept        complement(589864..590817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecB"
FT                   /locus_tag="BACI_c06230"
FT                   /product="iron(III) dicitrate ABC transporter, periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03337"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X2"
FT                   /protein_id="ADK03337.1"
FT                   /translation="MNFMRKKSFTLFVFLLAFSLLLSACGKSNTKEDTKKEMITVEHAM
FT                   GKTEVPANPKRVVILTNEGTEALLELGVKPVGAVKSWTGDPWYPHIKDKMKDVKVVGDE
FT                   GQVNVETIASLKPDLIIGNKMRHEKVYEQLKAIAPTVFSETLRGEWKDNFKFYAKALNK
FT                   EKEGQKVLADYDKRMKDLKAKLGDKVNQEISMVRFMPGDVRIYHGDTFSGVILKELGFK
FT                   RPGDQNKDDFAERNVSKERISAMDGDVLFYFTFDKGNEKKGSELEKEYINDPLFKNLNA
FT                   VKNNKAYKVDDVIWNTAGGVMAANLLLDDIEKRFVK"
FT   gene            590989..591993
FT                   /locus_tag="BACI_c06240"
FT   CDS_pept        590989..591993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06240"
FT                   /product="iron compound ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03338"
FT                   /db_xref="GOA:D8H0X3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X3"
FT                   /protein_id="ADK03338.1"
FT                   /translation="MLLKTNRAKWIGLFVGIIAVITCIWGSIIFGYTNTSWNLALDAFF
FT                   HFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFF
FT                   IVVAIVIFSVTSLSAFTWIAFLGAAVAAVLVFASSSLGKEGTTPLKLTLAGVAISALFS
FT                   SLTQGLLVLNEKALEEVLFWLAGSVQGRKLETLQSVFPYLLIGWIASIMMAGKVNTLMM
FT                   GEDVAKGLGQRTILMKSFILLIIVLLSGGSVAVAGPIGFIGIVTPHFARFLVGVDHRWR
FT                   VPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK"
FT   gene            591990..593048
FT                   /gene="fecD"
FT                   /locus_tag="BACI_c06250"
FT   CDS_pept        591990..593048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD"
FT                   /locus_tag="BACI_c06250"
FT                   /product="iron(III) dicitrate ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03339"
FT                   /db_xref="GOA:D8H0X4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X4"
FT                   /protein_id="ADK03339.1"
FT                   /translation="MKKYIPFRIGKGGLSFLMYKRACLVLFSLLVVLIGLFFASAGMGD
FT                   MKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLAS
FT                   PDIIGITGGASVAVVLFLAIFSDKNNALTVSIHYMPLAAFIGATIVALFVYLFAWRNDG
FT                   LSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWV
FT                   LILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRIFMLLLSTALIGGAVAFAGGIGFV
FT                   GLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTVFTPLEIPAGVFTSAIGAP
FT                   YFIYLLYKSRNS"
FT   gene            593061..593882
FT                   /gene="fecE"
FT                   /locus_tag="BACI_c06260"
FT   CDS_pept        593061..593882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecE"
FT                   /locus_tag="BACI_c06260"
FT                   /product="iron(III) dicitrate ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03340"
FT                   /db_xref="GOA:D8H0X5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X5"
FT                   /protein_id="ADK03340.1"
FT                   /translation="MQKALETKRLTLSYGETIIIDELNLEIPKGEITIFIGSNGCGKST
FT                   LLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRY
FT                   PYQTWLKQWSEKDEEMVQNALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIIL
FT                   LDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQ
FT                   GKPEEVVDEKLVRDVFRMECQISTDPLFGTPLCIPHGKGRRVRKEVAHAMR"
FT   gene            complement(593914..594174)
FT                   /locus_tag="BACI_c06270"
FT   CDS_pept        complement(593914..594174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06270"
FT                   /product="possible methyltransferase, C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03341"
FT                   /db_xref="GOA:D8H0X6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X6"
FT                   /protein_id="ADK03341.1"
FT                   /translation="MQTSGKRTSWLVDDYFKTGKRVEPWIDQEVIKYHRTTEEYFTLLQ
FT                   QAGFTITNLKEATPDQTYFQSEEEYERRLRIPLFLLFSCRK"
FT   gene            594384..595574
FT                   /gene="bioF1"
FT                   /locus_tag="BACI_c06280"
FT   CDS_pept        594384..595574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF1"
FT                   /locus_tag="BACI_c06280"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03342"
FT                   /db_xref="GOA:D8H0X7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X7"
FT                   /protein_id="ADK03342.1"
FT                   /translation="MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYI
FT                   NLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIRLEETIAKFKHTEA
FT                   AIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQ
FT                   KAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKG
FT                   AGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTALTPADA
FT                   AACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEF
FT                   SKRLNEEGVYAKSIVFPTVAKGTGRVRNMPTAAHTKEMLDEAIRKYEKVGKEMGII"
FT   gene            595619..596584
FT                   /locus_tag="BACI_c06290"
FT   CDS_pept        595619..596584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06290"
FT                   /product="NAD-dependent epimerase/dehydratase; L-threonine
FT                   dehydrogenase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03343"
FT                   /db_xref="GOA:D8H0X8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X8"
FT                   /protein_id="ADK03343.1"
FT                   /translation="MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVTS
FT                   GPFETLDVTDGQKLHDIAKRNEVDTIIHLAALLSATAEKNPLFAWNLNMGGLVNALEAA
FT                   RELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPTTMYGVNKVAGELLCDYYYQKFGVDT
FT                   RGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKGTYTSYIAEGTYMDIMYMPDALQAII
FT                   SLMEADPSKLVHRNAFNITAMSFEPEQIAASIRKHIPTFTMDYAVDPARQTIADSWPNS
FT                   IDATAAMKEWGFKAEYDLDKMTTDMLAKLKKKLTAELVMN"
FT   gene            596639..597061
FT                   /locus_tag="BACI_c06300"
FT   CDS_pept        596639..597061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06300"
FT                   /product="MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03344"
FT                   /db_xref="GOA:D8H0X9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0X9"
FT                   /protein_id="ADK03344.1"
FT                   /translation="MQRVDVVYALIHDEETDKILMVHNVEQNVWSLPGGAVEKGETLEE
FT                   ALVREVKEETGLTAVAGGLVAINEKFFEEPGNHALLFTFRAHVVKGELVAADEGEISAI
FT                   EWVDRAIANERFPFYDGGFDSLLEVAIPYKFQPETK"
FT   gene            complement(597101..598981)
FT                   /locus_tag="BACI_c06310"
FT   CDS_pept        complement(597101..598981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06310"
FT                   /product="von Willebrand factor (vWF) type A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03345"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y0"
FT                   /protein_id="ADK03345.1"
FT                   /translation="MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIE
FT                   KKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQ
FT                   LFVLLEDLRVEEIVKNLRPGTKHVFKRRKEMYRNYFSSQNEINRVRNYHGDRLFCLCYL
FT                   SLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYIVEKIRYRLEELLESDMLNNYFG
FT                   HAPLYLSVIADEKDSRPEKLANDDTQIVDDENKNKMNESFSTWHRENKNNENENFLRFE
FT                   LESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQNDGA
FT                   YGKYNVGASHTFKEARKSTPDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDKY
FT                   YGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLFH
FT                   EALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVTYKNSTLPNVGPEIMQLREEEDNR
FT                   DGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVIG
FT                   IFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE"
FT   gene            complement(598985..599878)
FT                   /gene="norQ"
FT                   /locus_tag="BACI_c06320"
FT   CDS_pept        complement(598985..599878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norQ"
FT                   /locus_tag="BACI_c06320"
FT                   /product="probable nitric-oxide reductase"
FT                   /EC_number="1.7.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03346"
FT                   /db_xref="GOA:D8H0Y1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y1"
FT                   /protein_id="ADK03346.1"
FT                   /translation="MLEQFHIHADLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSI
FT                   IEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTL
FT                   QTKDGASEVTFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQE
FT                   VVYGDDEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLKDVA
FT                   TIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDET
FT                   EQMTVRELAESYFFEG"
FT   gene            complement(600006..601535)
FT                   /gene="cls1"
FT                   /locus_tag="BACI_c06330"
FT   CDS_pept        complement(600006..601535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls1"
FT                   /locus_tag="BACI_c06330"
FT                   /product="cardiolipin synthetase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03347"
FT                   /db_xref="GOA:D8H0Y2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y2"
FT                   /protein_id="ADK03347.1"
FT                   /translation="MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGVLWSITIVGIS
FT                   FVIFIENRSPQSTLAWFLVLALLPVVGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREIL
FT                   EGRRLELSLKVPLSERSVHLTEVVQKFGGGPAADRTTTKLLTNGGQTFSEILQAIEQAK
FT                   HHIHIQYYIYKSDEIGTKVRDALIKKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIE
FT                   IVEFDPIFSAWLLETVNYRNHRKIVIVDEEIGFTGGLNVGDEYLGRSKKFPVWRDSHLK
FT                   VEGKALYKLQAIFLEDWLYASSGLNTYSWDPFMNRQYFPGKEISNAEGAVQIVASGPSS
FT                   DDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSII
FT                   SDQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDKIATIGTANMDVRSFELNYEIIS
FT                   VLYESETVHDIKRDFEDDFKHSTEIKWNAFQKRSIKKRILESFMRLISPLL"
FT   gene            601835..602173
FT                   /locus_tag="BACI_c06340"
FT   CDS_pept        601835..602173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03348"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y3"
FT                   /protein_id="ADK03348.1"
FT                   /translation="MNYIENNGLYYRNHHHGGHHHNGGHHHHGGHNHHDHHHHHGGGWG
FT                   WGGGSWGGGFFPGSFAGGVLGGLTAGALTGAAGGGYYPAPYPVTYPASYPVLYPTPYPG
FT                   YQQTIYPY"
FT   gene            602526..604235
FT                   /locus_tag="BACI_c06350"
FT   CDS_pept        602526..604235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06350"
FT                   /product="sensory box, GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03349"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y4"
FT                   /protein_id="ADK03349.1"
FT                   /translation="MRMLEQRGHALYESSLRDLKLALDESSIVAITDRKGLITYVNDKF
FT                   CEISKYTREELIGKDHRILNSGYHPKTFFQMLWKRILSGKVWRGEIRNQAKDGTYYWVK
FT                   TTIVPFLNEKGEPYQFIAIRNDISSRKEAEQRLRLSESRYRELAYHDALTSLPNRLQLI
FT                   TTVNELIADKKEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARL
FT                   GGDEFVLLTKNHTQDEMRQLATSVLSCFQAPFMLEGHEVYISASLGLCSYPQDGQDVET
FT                   LLKNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKIEFALQKAIRDEELDVVLQPIID
FT                   LKTKKYTGIEALVRCTTEEGPISPSEFIPIAEECGLIIKLGDWVLEKSCRLFKTLPEYE
FT                   EGLKLSVNLSIQQLMQKRFIISVRSILRRTGFPANRLILEITESIAVRHFDYIIATLQE
FT                   LRNMGILIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEI
FT                   AHSLNLAVVAEGVETVEQESLLKSMGCDYVQGFYYAKPLSVAELKEKLIIDF"
FT   gene            complement(604267..605664)
FT                   /gene="arcD1"
FT                   /locus_tag="BACI_c06360"
FT   CDS_pept        complement(604267..605664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcD1"
FT                   /locus_tag="BACI_c06360"
FT                   /product="arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03350"
FT                   /db_xref="GOA:D8H0Y5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y5"
FT                   /protein_id="ADK03350.1"
FT                   /translation="METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWS
FT                   ITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAA
FT                   TASVIISFAGYLSTFFPVLQSKQILFSTNGFSLELGKGLTFLVCSLMLWGIQYILSQNI
FT                   DRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAI
FT                   ATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALSQDALKDS
FT                   QKPLVDALNLAIGNKGAYIMALLALVSLFGSTVGWIVVSSEVPYQAAKNGLFPKFFAKT
FT                   NKKGSPSKSLFITNVMTQIFLFSTISGTVSEAYNFAIVVATLAYLIPYLVSTLYQFKLV
FT                   ITGETYDILPGSRIKDGIITTLAFVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLM
FT                   KDSQKMN"
FT   gene            606117..606827
FT                   /gene="treR"
FT                   /locus_tag="BACI_c06370"
FT   CDS_pept        606117..606827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="BACI_c06370"
FT                   /product="trehalose operon transcriptional repressor"
FT                   /note="GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03351"
FT                   /db_xref="GOA:D8H0Y6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y6"
FT                   /protein_id="ADK03351.1"
FT                   /translation="MMSKYEQIYTAISKSIDNKQLKEGCKIPSETELMKQYEASRGTVR
FT                   KAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEIEKI
FT                   KATKEIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEHIPGLTSEIAAGSIYKY
FT                   IEKELGLHISYSQRVIEVQPCTEDDRKYLDLNGTDYVVVVKNFTHFYDGSQFEYTESRH
FT                   RLDIFHFSDVARRK"
FT   gene            606965..608392
FT                   /gene="treB"
FT                   /locus_tag="BACI_c06380"
FT   CDS_pept        606965..608392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BACI_c06380"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /note="protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03352"
FT                   /db_xref="GOA:D8H0Y7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y7"
FT                   /protein_id="ADK03352.1"
FT                   /translation="MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDND
FT                   KLQSVSLVKGAFHNAGVFQIVIGPGDVDRVYAELITLAGMKEATVADVKDSGNQKLNPA
FT                   QKFVKVFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLGGLWDLINM
FT                   MANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWEYGKAATGLDGQKIE
FT                   YFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGV
FT                   LALGIIGPVTRHIGDLLTVGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQL
FT                   IAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGV
FT                   NLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMVIAV
FT                   VIPFTLTWLFAKRVKQK"
FT   gene            608406..610067
FT                   /gene="treC"
FT                   /locus_tag="BACI_c06390"
FT   CDS_pept        608406..610067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="BACI_c06390"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /EC_number="3.2.1.93"
FT                   /note="trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03353"
FT                   /db_xref="GOA:D8H0Y8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y8"
FT                   /protein_id="ADK03353.1"
FT                   /translation="MKDWHKSVVYQIYPKSFNSYYNKETGDIKGVTEKLDYLKELGVDY
FT                   IWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLEEAKARNIEIMLDIVVNHSST
FT                   EHKWFKEAKKDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTKQYFLHLFDETQADL
FT                   NWENEKLREEVYDMMRFWLDKGVTGFRLDVINLISKDQQFLNDDGSTATSDGRKYYTDG
FT                   PRVHEYLQEMNRNVFEGKDVLTVGEMSSTTIDNCIKYSNPDRNELSMTFSFHHLKVDYP
FT                   NGDKWTKADFDFIKLKEIMSNWQIEMQKGGGWNALFWCNHDQPRIVSRFGNDEKYRNES
FT                   AKMLATAMHMLQGTPYIYQGEEIGMTNPNFESIEQYRDVESLNIYDIKLEEGLSKEEII
FT                   GILKQKSRDNSRTPMQWNEDVNSGFTTSTPWISVAENFKEINVEKALEDKESVFYYYKK
FT                   LIELRKTYDVITEGEYAILDENDPKIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQL
FT                   DGMKQEVLLSNYKDSSKDIAKLNLRPYESIVYRYTK"
FT   gene            complement(610099..611223)
FT                   /gene="gerKC"
FT                   /locus_tag="BACI_c06400"
FT   CDS_pept        complement(610099..611223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BACI_c06400"
FT                   /product="probable spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03354"
FT                   /db_xref="GOA:D8H0Y9"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Y9"
FT                   /protein_id="ADK03354.1"
FT                   /translation="MFKKRVKLLFILCTSAFLSGCWDQEPLREARLAYSIGSDITEENK
FT                   LQQTIELVKSSSGEQASFENEIHSATGHNIRDTSDALKKNVTGNIRYFKYGVQLLGTKI
FT                   LKKGVLPYLDVSFRDPTNPTALVKLIAVDGETSEILEKKKVGNLLIGDFLKKKVKSLED
FT                   MSVFPKETLETAATKMLDPGKDFTLPSIKIKEKEVITNGLALFNNDKLTGHLPLKQSVL
FT                   FVLLTGKMGTSARITQKLTSDESEKTSDYLTMEVSNRKLKRDLKITTDKKGNVYAHIKL
FT                   QLKVIALEAPRDNLYKMDERKKLNKELSKQLTKEAKKITNKLQKANCDAFGIGRHLIAY
FT                   HPDLWKKKKWNKDYAKVKFKPEVDVNILYSGVLK"
FT   gene            complement(611204..612310)
FT                   /gene="gerKB"
FT                   /locus_tag="BACI_c06410"
FT   CDS_pept        complement(611204..612310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BACI_c06410"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03355"
FT                   /db_xref="GOA:D8H0Z0"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z0"
FT                   /protein_id="ADK03355.1"
FT                   /translation="MTNTQSKISLVQFTFFVIQCQIGVGILSLPNRLHPIAKGGGWISA
FT                   LIAGLAIQLIILLMWIFLKRFPDADMYESVCMLFGNKFGKLLGFAYVFYFTLIGMTVML
FT                   NACNVIKVWVLQATPWYAILLLFTIACCYIAYNTFKVILRFYVMASILILPMALLIALG
FT                   FSRADFSYIFPITEAGWWNIIQASKETITAMYGFEIILIAFPKVNGSSVAKLKAISIAN
FT                   GFVTLFYTFTVWICFIVFSPKQIELIPEPVAYLLRSLHIGIIDRTDLLFIPIWMITVVA
FT                   SIASYYCAASIGIGHIFNLANHKKAVPIVGIIAFSVALFIDTPEELKVIATFTDKFTYI
FT                   FIVVLPLLFLLYSVIRNKKGEQYVQKKS"
FT   gene            complement(612291..612854)
FT                   /gene="gerKA1"
FT                   /locus_tag="BACI_c06420"
FT   CDS_pept        complement(612291..612854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA1"
FT                   /locus_tag="BACI_c06420"
FT                   /product="spore germination protein KA"
FT                   /note="C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03356"
FT                   /db_xref="GOA:D8H0Z1"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z1"
FT                   /protein_id="ADK03356.1"
FT                   /translation="MPLELVYTIKASLEKVPLPPIFEALLMELIFELLREAGIRLPSRV
FT                   GQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAISSFLVPSNDMSSAVRILRFPLMLL
FT                   AALFGYVGISFGLIITFVHLCQLHSFHTPYLSPVAPMRIKDMKDSFVRLPIWSFWERPH
FT                   DPKPKKMQRQHVTREEEDGDKHAK"
FT   gene            complement(612859..613794)
FT                   /gene="gerKA2"
FT                   /locus_tag="BACI_c06430"
FT   CDS_pept        complement(612859..613794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA2"
FT                   /locus_tag="BACI_c06430"
FT                   /product="spore germination protein KA"
FT                   /note="N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03357"
FT                   /db_xref="GOA:D8H0Z2"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z2"
FT                   /protein_id="ADK03357.1"
FT                   /translation="MTEQKNSQQENNKKHMFPSLPENINYIENKLFHSDDIKKLDLPFQ
FT                   NGKGTILYIESLADPNLIHQLALEPLLTRSDLSLDKAFSTLNMKKETNLNYGVQLLLQG
FT                   KSLYFHEHVDSFCIFETALSLKRDITEPDNEGVVRGPHNGFVEDLATNLASIRKLIKSP
FT                   NIVVKYFTLGEEMHTKVAIAYMQNIANDDLVTEVKRRLETIKTDALMPPGYIQEFIEDT
FT                   SFSPFPQQLNTERPDRVAANLMEGRVAILSDGDPTALIVPVTLFAFYQSPDDYNNRWIV
FT                   GSFVRMIRLVSFLIAFLLPAIYIANRSLSS"
FT   gene            614221..615075
FT                   /locus_tag="BACI_c06440"
FT   CDS_pept        614221..615075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06440"
FT                   /product="hypothetical histidine kinase N-terminal part"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03358"
FT                   /db_xref="GOA:D8H0Z3"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z3"
FT                   /protein_id="ADK03358.1"
FT                   /translation="MITITISLLEIKIPSYPTILILLLIFMGIAEYFPVRFWRGTSSLT
FT                   FPIIYAMSWQFGIHITIIAIVLVTLIIHLHRRSPIQRMLFNSTQHALSLILAQWFSNKC
FT                   MSLLINKIDMSVLYENLISLLLFCVFFCFFNNRFYDLLMILLPQPYSIYQWYKKTVTVF
FT                   LCETFGFSYAALMHVLISTYSVEVNEVTVLFFFFPLVAASIISSFSVRIRMEKERLYEL
FT                   FLITTEISRGLTGGNLKHIKQALKGFFGIQAYVIWTKDDGNWNILLKDGKVRPDISDHS
FT                   EKK"
FT   gene            615128..615979
FT                   /locus_tag="BACI_c06450"
FT   CDS_pept        615128..615979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06450"
FT                   /product="hypothetical histidine kinase, C-terminal part"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03359"
FT                   /db_xref="GOA:D8H0Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z4"
FT                   /protein_id="ADK03359.1"
FT                   /translation="MAPGDEIFDSVIRSLVYFPLIVNDELVGMFVAGKSRTAGFFPEDV
FT                   QSLATFSNQLANVVKTRILISEQEKRMILEERNRIAREIHDGIAQTLAGVIFQLESAQK
FT                   KYRDKPIDMQQVVEKSIKDLRGSLGEVRYSIYALKPYPTQQLGLKQAIASKIKSLKQEY
FT                   ELDIIYHERGHARALSFSKERVIFDTLQESLQNIVKHAKAEKTDVLLSYQSEHVLLRVK
FT                   DNGVGFSLFESMVKTKNEPHYGILHMNEQAEQLGATLQINSSVGKGTEITLLIPDSQTR
FT                   GA"
FT   gene            615981..616622
FT                   /locus_tag="BACI_c06460"
FT   CDS_pept        615981..616622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06460"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03360"
FT                   /db_xref="GOA:D8H0Z5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z5"
FT                   /protein_id="ADK03360.1"
FT                   /translation="MIKILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLKKVEE
FT                   CRPDCILMDINLPGKNGIEATELVKKNYPNCRVLVFTMYEHDEYLMDALQAGADGYLLK
FT                   DSSSEQVVAAIRMLYRGDSVIHPRMTKKLITYHQQKMKVESNENELTEREKEILFELVK
FT                   GLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLVPLD"
FT   gene            617031..621269
FT                   /locus_tag="BACI_c06470"
FT   CDS_pept        617031..621269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06470"
FT                   /product="subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03361"
FT                   /db_xref="GOA:D8H0Z6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017292"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z6"
FT                   /protein_id="ADK03361.1"
FT                   /translation="MKRGKFGKILIGTLTVGMLLSQGIPYNVLAEEVNKSALTGIDDAN
FT                   AILKGLTKEQRNALKTLDTKPGFVISPGINTASPNNVNVIIEFKQAPSKIEVLKQAAKG
FT                   KKVALSNAEQKVEASHKGFKAELEQLQKNKEKGTNVKSAKITREYKNAFNGVAISLPAN
FT                   MIEDLVRTGIVKRVWEDHEVKIDLPKETAKTAVEPKMADSVPQIGVDKLHDEKITGKGI
FT                   KVGVLDTGIDYNHPDLKDAYKGYRAKQGEDPSKVDPNSIKGWDFVNNDADPMETTYKDW
FT                   QNSGGYPEIYEGSAYYTSHGTHVAGTIAADKQNSVDYAVKGVAPDVDLYSYRVLGPYGS
FT                   GQTSGILAAIDKAVKDDMDVINLSLGASINDPLYPTSVAVNNAMLAGVVTVVAAGNSGP
FT                   EEGTIGSPSAAALPITVGASDAAMNIPTFSAYAGDVHVDKMMLLGKSFTDKIEDLKGQS
FT                   LSVVYAGLGKSGDFTGKDIKGKLALIQRGEITFDEKIKNAKEAGAKAVIVYNNVDGEIT
FT                   SYLGESTSSIPSFRLTKVDGEKLQAKAVQGDVSLAFGEISNIKTEGDHLADFSSRGPAT
FT                   KTDDIKPDIVAPGVSIFSTVPEYINDPKDGENYPVAYGRMSGTSMATPHTAGVAALILQ
FT                   EHPNYSPFEVKEALMNTAVDLKEERSVFEVGSGRIDAYRAVHADTSIEVIDKTSNVVDD
FT                   EEVEIEEKTGSIAFGYKNQIENGPIKDSRKVLIKNSSKTDGKEFKLEVEFSPTSVGVQD
FT                   AAKNGVKLNVPDSIKIAPGTSEEISPEIIIPENAEFGRYEGYIHISNKNNEKEVYQVPF
FT                   AVKFTEKGIASVDLLRDAMATDASKFHPFMERPSSPLTFKVNSPLETIDAVVKDRKTGK
FT                   ALGVVGTLDASSLTPNVEYMMFSGMGGYVLPFTGDPAHPIGDKPVMLPDGDYELNFVGY
FT                   DKEGKSYTKGDNIIIDNVIPEMKFKDVQPGIHEVNDSMFKEEDGQRALWVHGNIYDSTV
FT                   DALKAKGLQYDQKANQIVYYQNSAFTSGWLNTIQTNGDFKFGVLPEEINEPLNLKLFGY
FT                   DLATAGNMATGYKNYVFVKEGTEYAVPSYDKDKIKLGEKITLTLNLNNVKQLMSGTFEI
FT                   PFDKQLFKFTDVKPNPALTEYVKQHGLNLKLEDPKISEEGAWENKVKVGASLEGKEFKG
FT                   LDGDTPFLDVTFEMTSDEYFNDVTAFGVDKFSYTKAGASDIEIPVFKDKSFAIVSKHST
FT                   VTGYIGPEAFLNEEGYLGKKDYTKLGAKVYAVGKDGKKYTGTIDDNGQFEIRSVPVSDK
FT                   EYDIFVEMPGHLNSKLTTKIGKMQDGELVGQNFRADMDDNLAGDVNGDKMVDIQDARIA
FT                   ALSYGKGKVSVKDGDINQDSVVDETDIRFIEKNFLKKGPDAKGNQKPKENVGPVTLDKI
FT                   LRSIGLEPKK"
FT   gene            621528..622127
FT                   /locus_tag="BACI_c06480"
FT   CDS_pept        621528..622127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06480"
FT                   /product="camelysin"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03362"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z7"
FT                   /protein_id="ADK03362.1"
FT                   /translation="MSMKKKIGMGVITAALGLSLIGGGTYAYFSDKEVSQNTFAAGTLD
FT                   LSVNPEVVINVDNMKPGDEMERGFQLVNKGTLAIGDVKLLTDYSVIDAKGDNGNADFGD
FT                   HIRVDFLWNLDKNEIPIWSTTLSELKVATQNGSIPDLVQKGVVDREGNGLAPGDDDTFY
FT                   VMFTFVDNDEEQNVFQGDSLKLNWNFNSMQTKGEEK"
FT   gene            622329..623015
FT                   /locus_tag="BACI_c06490"
FT   CDS_pept        622329..623015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06490"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03363"
FT                   /db_xref="GOA:D8H0Z8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z8"
FT                   /protein_id="ADK03363.1"
FT                   /translation="MTLRHMWGWKEILYLFMFVFVIVPVTVESLFYKYILEIIGNSLYA
FT                   GVLMGFIMAVIFTTVVYLFCIKRYKLSWKDIGIRKLSWKDLLWTVGAVIFLIVASIAVL
FT                   VIMEKMGISFENSKTETVQNDKSIYSFCIAVIGAAIISPIYEEILYRGVFYTFFRNRYG
FT                   IWGGMFISSIIFTVVHIPTYNTLPVNFLSGVVFAWLYEKTNSILSAMIAHALFNFIAVL
FT                   LTFMSN"
FT   gene            623039..624010
FT                   /locus_tag="BACI_c06500"
FT   CDS_pept        623039..624010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06500"
FT                   /product="possible aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03364"
FT                   /db_xref="GOA:D8H0Z9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D8H0Z9"
FT                   /protein_id="ADK03364.1"
FT                   /translation="MEIAVERVFTKEILERAANLFHVTVEENPLGDFENYIFKAKGDRG
FT                   EDYVLRLTHSSHRSKQEVEAELDFLRYVAENGAKVAGPLYSTSRNLVEEIVAEDGTSFF
FT                   ASLFTYAKGEQVKGEESPYWGDAYFEAWGKAIGQLHRLTMNYPKTNHRDTWEEDESGIV
FT                   NELEDDQVKKIAAVLMDEIKALPIEKETFGLMHGDIHPGNFHYDGKELTIFDFDDAAYN
FT                   YFIHDLAMVLYYSVLFTPWTAEEKTEFARKQLQVLRKGYEYEHRLADSWYESLPLFLRL
FT                   RDVGLYGTLQKKFKGKDMPDNFRKLSEELYERIISKEAIVNI"
FT   gene            624168..625628
FT                   /gene="alsT1"
FT                   /locus_tag="BACI_c06510"
FT   CDS_pept        624168..625628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsT1"
FT                   /locus_tag="BACI_c06510"
FT                   /product="sodium/alanine symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03365"
FT                   /db_xref="GOA:D8H100"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D8H100"
FT                   /protein_id="ADK03365.1"
FT                   /translation="MEAFVNWLNNIVWSPALVYLCLGVGLYFSIRTRFLQVRHVGEMVK
FT                   LTFKGEKSEAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAGS
FT                   AYVESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGLLLPGVQANS
FT                   IAVSLETAFGINTTLSGALLVVVLALIIFGGVKRIVNVAQVVVPFMAVGYILVACVIVA
FT                   MNIEKLPEAFMLIIRSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGPHAAAAAEV
FT                   SHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKYVIVNKLNGAQPGPGY
FT                   TQAAVESVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWLSMVLKFV
FT                   FLGAVFYGCIKTAATAWALGDIGVGIMAWVNIIAILLLQKPALVALKDYEKQKKEGKDP
FT                   VFDPGPLGIKNADFWEHEYRKDKKEEVS"
FT   gene            625762..626493
FT                   /gene="glnQ2"
FT                   /locus_tag="BACI_c06520"
FT   CDS_pept        625762..626493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ2"
FT                   /locus_tag="BACI_c06520"
FT                   /product="ABC transporter, ATP-binding protein; probable
FT                   glutamine ABC transporter, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03366"
FT                   /db_xref="GOA:D8H101"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D8H101"
FT                   /protein_id="ADK03366.1"
FT                   /translation="MLIEFRNVNKYYGNFQVLKDINVQVKKGEVVVVVGPSGSGKSTLL
FT                   RCINQLESITDGELIVQNTEVHNAKTDMNELRRNIGMVFQHFYLYPHKTVLQNITLAPI
FT                   KVNKISKEEAEKTAMFYLEKVGIPEKANVYPHQLSGGQQQRVAIARGLAMQPEIMLFDE
FT                   PTSALDPEMIGEVLDVMKTLAKEGMTMVVVTHEMGFAREVADRILFMDDGKIIEDTTPA
FT                   QFFASPEQERARLFLSRVLNH"
FT   gene            626506..627336
FT                   /gene="glnH"
FT                   /locus_tag="BACI_c06530"
FT   CDS_pept        626506..627336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="BACI_c06530"
FT                   /product="ABC transporter, substrate-binding protein;
FT                   probable glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03367"
FT                   /db_xref="GOA:D8H102"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D8H102"
FT                   /protein_id="ADK03367.1"
FT                   /translation="MLKMKKLFTLIVFSCLFVLVVAGCGSKKEEAKETNTKQGGAVEQI
FT                   KKRGKLVVGVKNDTNLFGLKNPSTGQVEGFDVDVAKALAKKILGDEKKLELKEVTSKTR
FT                   IPLLKNGDIDAIIATMTITEERKKEVDFSDVYFKAGQSLLVKKGSDIKSIDDVKKGVKV
FT                   LAVKGSTSTNNIRQKSPEATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNY
FT                   EVVGKIFTDEPYGIAVQKGADDLTKEINSLIKDMKANGEYDKLYEKWIGQKPEK"
FT   gene            627399..628055
FT                   /gene="glnP1"
FT                   /locus_tag="BACI_c06540"
FT   CDS_pept        627399..628055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP1"
FT                   /locus_tag="BACI_c06540"
FT                   /product="ABC transporter, permease; probable glutamine ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03368"
FT                   /db_xref="GOA:D8H103"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H103"
FT                   /protein_id="ADK03368.1"
FT                   /translation="MPDFSILTNNIDMYLEGFKYTVMSSVIALIGSFILGVVLAIMRIA
FT                   PIRILNWLGTAFVEFVRNIPLVLIAFIFYFALPVVGITLNGFVAGTVTLTVYTAAFIAE
FT                   VIRAGILSVAKGQMEAARSSGLTYTQAMYHVVLPQAMKIVIPPLGNQFLNLVKNSSILG
FT                   IIAGTDLMYQGDLISTKTFVTFDVYIFVGMFYLILTIPLSMLVRYLEKRLAKEAV"
FT   gene            628056..628700
FT                   /gene="glnP2"
FT                   /locus_tag="BACI_c06550"
FT   CDS_pept        628056..628700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP2"
FT                   /locus_tag="BACI_c06550"
FT                   /product="ABC transporter, permease; probable glutamine ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03369"
FT                   /db_xref="GOA:D8H104"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H104"
FT                   /protein_id="ADK03369.1"
FT                   /translation="MDFKGAITGDHILFLLKGLLITLEVALVAIILSFIIGSVIGILRY
FT                   MKIPVVSQILGIIVEVIRNLPLLLIIFFTYFALPEAGLKLEIITAAIVALTIFEAAMIS
FT                   EIVRSGLLSIEKGQIEAARSSGLTYVQALWHIILPQALRRMVPPLVSQFISLLKDTSLA
FT                   VVISLPELMHNAQIISGQNVNYMIPTFIVVACMYFIVNYSLSILSRRLELH"
FT   gene            628906..630333
FT                   /gene="rocE2"
FT                   /locus_tag="BACI_c06560"
FT   CDS_pept        628906..630333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocE2"
FT                   /locus_tag="BACI_c06560"
FT                   /product="amino acid ABC transporter,possible arginine
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03370"
FT                   /db_xref="GOA:D8H105"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8H105"
FT                   /protein_id="ADK03370.1"
FT                   /translation="MQQPTNEKLHRTMKSRHLFMIALGGVIGTGFFLGSGYTINQAGPG
FT                   GAILSYLVGGFIMYLTMLCLGELTVAMPVSGSFQKYATKFIGPGTGFMIGWLYWLGWAV
FT                   TVGLELTSIGLMMKRWFPNVDVWVWCLVFGAILYASNAISAKSYAELEFWFSSIKVVTI
FT                   LAFVVLGGSALLGFISYDGKEAAPLFSNFVSDGGLFPNGLTAVLLTMITVNFSFQGTEL
FT                   IGIAAGESENPEKTIPRAIRNTVWRIMLFFILTMTILVGLISWKEAGVIESPFVVVFDK
FT                   IGIPYAADIMNFVIITALLSVANSGLYAATRILWSLANEGMAPTSFQKVNKRGIPITAL
FT                   VVTIAVAGLSLFTSFLAEDTVYMYLLSIAGLSAVSSWIIIALSQLRFRSQYIKGGGKLE
FT                   DLKYRTPLYPIVPILALITNSIVVISLAFIPEQRMALYCGIPFIIFCYIYYYINKKRQK
FT                   PMKVEMEKANETNNQTR"
FT   gene            630308..630685
FT                   /locus_tag="BACI_c06570"
FT   CDS_pept        630308..630685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06570"
FT                   /product="possible OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03371"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D8H106"
FT                   /protein_id="ADK03371.1"
FT                   /translation="MKLTIKHDDIEADLSYGPLAIGKENGYSPLQLLVSSIAGCSAIVF
FT                   QTILEKKRIPYDTFTIETEIGRSEALSKPVESVHLHYKIKAQNITEEQLDKALQLAVKN
FT                   CTIVQSVKDSIKVTETIELIK"
FT   gene            630748..631182
FT                   /locus_tag="BACI_c06580"
FT   CDS_pept        630748..631182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06580"
FT                   /product="hydrolase, HIT family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03372"
FT                   /db_xref="GOA:D8H107"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D8H107"
FT                   /protein_id="ADK03372.1"
FT                   /translation="MDCLGCKLANEEEKIYKIYEDDYVTCFLDHAPFYPGHTLIVPKQH
FT                   VVEVDELDDIVAKSIMDASKLITKAIKLLYKPDGVTVCQNGGIFNELTHYHMHVVPRYK
FT                   ERSFAEFYTVQQGEKKNYNFEETKNLLKEAIERILYIKKA"
FT   gene            complement(631204..632145)
FT                   /locus_tag="BACI_c06590"
FT   CDS_pept        complement(631204..632145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06590"
FT                   /product="possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03373"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H108"
FT                   /protein_id="ADK03373.1"
FT                   /translation="MSKAKRLLDILIFASAKKTFTAQEIADEFNISVRTVHRYIVDLSD
FT                   MGLPIYAEQGRNGGYKVLTNRVIPPILFTEEEAVSIFFAFQSLSYYRDLPFNTEINSVT
FT                   HKLYSSLQHDAKTKVDKIRSYIAFWNPKRTVNTPLLNEVLTAAIENKNLHFQYESKSGI
FT                   KTKHVHPIGVYAHDGLWYLPSYDFSRKKVLLYRVDRILSILSAEENESTFMNLEEWFDS
FT                   SSNVVHIPTQLHVLLTTEGVRQCKSVPYLEEFVIANADGTGYIHSTIDKAEINFITPLF
FT                   YRLGKDARVLEPKELINGLRIRAKEILHMYGD"
FT   gene            632252..632773
FT                   /locus_tag="BACI_c06600"
FT   CDS_pept        632252..632773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06600"
FT                   /product="possible dihydrofolate reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03374"
FT                   /db_xref="GOA:D8H109"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D8H109"
FT                   /protein_id="ADK03374.1"
FT                   /translation="MSREIVLFIAASLDGYIAKEDDDLQWLMETEGEGDNGYTEMYETI
FT                   DTIIMGKRTYDYVVEHMETFPYVDKKCYVFSNSEKGSNEHVEFVNEDVVEFTKRLKEQE
FT                   GSKIWMVGGGSLLREFFKNNLIDEYVVTITPHILGSGVPLFQDKNPEIHLTLTDTKRFG
FT                   QFVNLYYKVK"
FT   gene            complement(632790..634178)
FT                   /gene="lcoS"
FT                   /locus_tag="BACI_c06610"
FT   CDS_pept        complement(632790..634178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcoS"
FT                   /locus_tag="BACI_c06610"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03375"
FT                   /db_xref="GOA:D8H110"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8H110"
FT                   /protein_id="ADK03375.1"
FT                   /translation="MKRISIQFGFYFLIVTLLIESVLFVLLYYSLVNTRVNEEMTALLK
FT                   RGNSHRDVLEKYYDEQTISHVALMESEAETTVVITNTNKEVLAKSNEINTTIKDHISSM
FT                   QTRTNHDGAIIENHWKTSNYICTVSPIIVAGKHEGYVYMFLGTESIEKLVNGLTKQFII
FT                   AGAITFLLTVITIFLLSRLLTKPLLHMKHATEKMSKGDLSVSLTTTRNDEIGELSSSIQ
FT                   TLANDLHYMKTERSEFLASVAHELRTPLTYVRGYADIALKENTSPEQRLRYLSIIKDES
FT                   DYITNLVQDLFSLAQMEQHNFSIQVKEVHLHTFLTRIVEKVNAMYKERYITVSFSCPPT
FT                   LLVNLDEQRFEQVVMNILNNAYRHSKEHSHINISVTEEHKHISITIEDEGEGIPSEDLP
FT                   HIFDRFYRVDKARSRATGGTGLGLSIVKEIVELHGGTITVTSEVDHGSCFIISLPSIQK
FT                   HDYY"
FT   gene            complement(634190..634867)
FT                   /gene="lcoR1"
FT                   /locus_tag="BACI_c06620"
FT   CDS_pept        complement(634190..634867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcoR1"
FT                   /locus_tag="BACI_c06620"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03376"
FT                   /db_xref="GOA:D8H111"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8H111"
FT                   /protein_id="ADK03376.1"
FT                   /translation="MIDILLVDDEPRMLELLTLYLTPIGYNCICARSGEEAISHIENQN
FT                   FKFILLDIMMPKMDGWETCKKIRSFSNVPIIMVTARDQTIDVVQGLKLGADDYVTKPFH
FT                   EEELFARIEAVLRRTNQHAQIQYHGILWDEAKHFVSVDNEELLLTPIEFSLLGLFLRHV
FT                   NYVLSRDQLIERIWGLNTNTEDRTVDSHIRNLRDKLRKVNFPIDNHLKTVYGVGYRWID
FT                   IEH"
FT   gene            635044..636294
FT                   /locus_tag="BACI_c06630"
FT   CDS_pept        635044..636294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03377"
FT                   /db_xref="UniProtKB/TrEMBL:D8H112"
FT                   /protein_id="ADK03377.1"
FT                   /translation="MKKATRILGVTIITAVGLAACGQTNNMDHTKHESKKEKETEQKEM
FT                   KMNQEVTAPKEMNKGASNDLLTTSLKNVTRLNTNDSLQMAVLTSQTIWPATHKENQPGA
FT                   VILVPVNEWQLGIASADLIHHPNNGPILFIEKEKVPEMTLKEIKRLNPLGTKDGTQIMV
FT                   MGDVDASILEQLKEYKVKQIKETDPATFAKDVDKEYADITGSYPNSVIIGSFEEEGRLY
FT                   TTPAVNWISHMPEPLLYTEKDKVPEATIEALKMRKDKANIYVLGPEKVVSKEVEKELSK
FT                   YGKVTRISGETPVENSIAFAKFKDEKTKFGWGFTKPGHGVSFVSNKTPDLAVAGAPFSH
FT                   MGKHAPVILLEEGKASQPVYDFLATIQPKFKDDPTLGPYNHGFLLGSTSDISFETQGIL
FT                   DERLEIVQESGQGHGGH"
FT   gene            636452..637903
FT                   /locus_tag="BACI_c06640"
FT   CDS_pept        636452..637903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06640"
FT                   /product="sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03378"
FT                   /db_xref="GOA:D8H113"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D8H113"
FT                   /protein_id="ADK03378.1"
FT                   /translation="MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVG
FT                   LYAAFCIAVTISFVGGRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFG
FT                   VFKLSSFMKFVPKSVMSGFLNALGILVFTAQLPQFKNATWQMYALVALGLVIIYVFPRI
FT                   TTAVPSTLIAIIIVTSIALMSGLQLKTVGDMGSLPKELPFFSIPDVPFTLETLGIILPY
FT                   AVMLAIIGLLESLLTASVLDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSV
FT                   INIKSGGRGRLSTFVAGGFLIVLLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVATI
FT                   HKVPKGNAFVMIVTVVVVLITHNLGLGVVIGTVISAVLFAFNMAKIHVKHLYIENKKIY
FT                   EIHGQLFFASTADFINNFSFNEDVKEIEMNFTHAHVWDDSAVASIDKVIMKYEQSGVKV
FT                   SITGLNERSAKLVTNLATYNKRIAS"
FT   gene            637969..638391
FT                   /gene="uspA"
FT                   /locus_tag="BACI_c06650"
FT   CDS_pept        637969..638391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="BACI_c06650"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03379"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D8H114"
FT                   /protein_id="ADK03379.1"
FT                   /translation="MYKQIILACDGSEHALRAAEHATHIAKFNEETNVEVVYVVDNRTA
FT                   KSDIIQGQTDLETVSASRKDKLKEIEGLLKKENISYKITILHGDPGDTIVQYVNTGDID
FT                   LVIAGSRGLNTLQEMVLGSVSHKIAKRVKCPVMIIK"
FT   gene            complement(638826..640610)
FT                   /gene="oppA5"
FT                   /locus_tag="BACI_c06660"
FT   CDS_pept        complement(638826..640610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA5"
FT                   /locus_tag="BACI_c06660"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03380"
FT                   /db_xref="GOA:D8H115"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D8H115"
FT                   /protein_id="ADK03380.1"
FT                   /translation="MEEMTNKPKFFKVLSTLAVSTLLLSACGGSGGSEKTSSTKKVDTN
FT                   KFSTNVKNDKKEVKDGSLTYGLVSNTPFEGLLNFAVYEGDPDNQVITIFDESLLSNDEN
FT                   WEYTNDGAATYEISKDKKTITLKIKDNVKWHDGNPVTAEDLEYSYLVIGSKQYAGSRYD
FT                   SQMQMIEGMEDYHNGKAEKISGIKVTDPKTISITFKEPNPSVKTGLWTYPLHKKYLGDV
FT                   PIDKLAESDKIRKNPIGFGPFKVKKITPGESVEFERFDDYYGGKPKLKSMVLKVVNPSV
FT                   VNASLKNGDIDIAEVSADQYPNVSKLKNAQLVGKTDLYYSYIGFKLGHMDKEKEEVVMD
FT                   KDKFKDVRVRQAMAYAIDRKEIGEKLYHGLRYPANSPIPPSLPKYHNNKIGAYDKDVEK
FT                   AKKLLDEAGYKDTNGDGFREDPNGKEFKANFLSMSGSDVSEPLAKFFIQSWKDIGLKVE
FT                   LLDGRLHEFNSFYDMIKKDDPKVDLFAAAWGTASDPDPSGIWAKNAPFNYTRWATDKNT
FT                   ELLKQGISKEAADEKYRKDVYDKWQKLVHDEVPLIPLHYKFDLKGVNNRVKDYKYTPED
FT                   QYKWGKVSVTSDKAETEK"
FT   gene            complement(640614..641519)
FT                   /gene="oppC3"
FT                   /locus_tag="BACI_c06670"
FT   CDS_pept        complement(640614..641519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC3"
FT                   /locus_tag="BACI_c06670"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03381"
FT                   /db_xref="GOA:D8H116"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H116"
FT                   /protein_id="ADK03381.1"
FT                   /translation="MLANPEKQTEVVHYEKSPSGFSIMWRELRKDKLAMFSLVFLAILL
FT                   LAVYAASFIMKQEDIVRVDLFAIYAPPSAEHWLGTDYGGRDIFGQLIIGTRNSFTIGLA
FT                   ITILSCLIGLSIGLIAGYFGGAIDNMIMRVIDFVMVLPFLMLVIVFITLVPTFNIFTFI
FT                   LIMSVFLWTGKARLIRSKVLTEKELDYVSASKTLGTPNWKIILFQVLPNLSSIIIVSVT
FT                   LNLAGNIGIESGLTFLGFGLPESTPSLGTLVSYARNPDVLQEKWWIWLPASVMILTLML
FT                   CINFIGQALRRSADARQRKG"
FT   gene            complement(641537..642502)
FT                   /gene="oppB3"
FT                   /locus_tag="BACI_c06680"
FT   CDS_pept        complement(641537..642502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB3"
FT                   /locus_tag="BACI_c06680"
FT                   /product="oligopeptide ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03382"
FT                   /db_xref="GOA:D8H117"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H117"
FT                   /protein_id="ADK03382.1"
FT                   /translation="MWKFILRRFLVMIPQLFVLSVLVFLLAKAMPGDALTGRAMNPKAD
FT                   PKVIEEQREKLGLNDPVTTQYVRWIKNAVQGDFGISYAHKMKVTDLIGERLGNTVSLAL
FT                   VILILTYLIAIPLGVISGRWNDTWADRLITIYNYLGFATPLFIFALIMLFLFGFKFAIF
FT                   PTGGSVDPQVATGTFAYYLSKLNHMLLPALSGALIATVGTVQYLRSEIIDTKHKDFVRT
FT                   VRAKGVPESKIYSRHILRNSFLPIAAFLGYEITGLVGGAIFLESIFSYPGIGQLFIQSI
FT                   SQRDFSVITALVMFTGFATLLGTLLSDIILSIVDPRIRID"
FT   gene            complement(642517..643443)
FT                   /gene="oppF3"
FT                   /locus_tag="BACI_c06690"
FT   CDS_pept        complement(642517..643443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF3"
FT                   /locus_tag="BACI_c06690"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03383"
FT                   /db_xref="GOA:D8H118"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8H118"
FT                   /protein_id="ADK03383.1"
FT                   /translation="MALLKVEDLKVHFPIKGGFFGRTLDYVRAVDGVSFELQPGETYGI
FT                   VGESGSGKSTTGKAIMHLTKATAGSIHFNNRDLTKLSRSELREQRKDIQMIFQDPYSSL
FT                   NPKKRVLDIIAEPLRNFEKLSPDEERRAVQEYLDKVGLNPESIYKYPHEFSGGQRQRIG
FT                   IARALTLKPKLIIADEPVSALDVSVQAQVLNFLQDLQSELGLTYLFISHDLGVIRHMCD
FT                   RIGVMYRGRIVEEATSAEIYSNPQHIYTKRLISAIPDIRPENRERQRKLRQQVSSEYEK
FT                   SYENYFNENGRAYDLKAISPTHRVALP"
FT   gene            complement(643430..644449)
FT                   /gene="oppD3"
FT                   /locus_tag="BACI_c06700"
FT   CDS_pept        complement(643430..644449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD3"
FT                   /locus_tag="BACI_c06700"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03384"
FT                   /db_xref="GOA:D8H119"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8H119"
FT                   /protein_id="ADK03384.1"
FT                   /translation="MKNSLLRIENLQTSFRIQDQYHAAVDDVSLTVHENEIVAIVGESG
FT                   CGKSALALSIMRLHNEANTKLQGQLNYRDKDLLSMSAAEMNKVRGSNIGMIFQEPLTAL
FT                   DPLMTVGKQIEENLDYHTSLSKVEKKERTLELLHQVGIPKPELTYKQYPHELSGGMRQR
FT                   IVIAIAIACNPALIIADEPTTALDVTIQAQILDLLKSIQEQTKMGIILITHDLSVVAET
FT                   ADRIVVMYAGQVVETGKVEEIFNNPLHPYTRSLLNSIPSAYVEKEKLHVIQGVVPTLAK
FT                   LPRTGCRFQARIPWIRPDQHEENPILHEVKPDHWVRCTCYKHFNFQDKKGDDVTHGTA"
FT   gene            complement(644733..646082)
FT                   /gene="glpT1"
FT                   /locus_tag="BACI_c06710"
FT   CDS_pept        complement(644733..646082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT1"
FT                   /locus_tag="BACI_c06710"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03385"
FT                   /db_xref="GOA:D8H120"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8H120"
FT                   /protein_id="ADK03385.1"
FT                   /translation="MFFTQFFKPAPHAERLPADRVDSEYRKLRLQVFLGIFIGYAGYYF
FT                   VRKNFSLAMPYLIEQGFSKGELGVILSAVSIAYGLSKFLMGIVSDRCNPRYFLAAGLFL
FT                   SGIINIIFGSFSFITTSIILMFVLQFLNGWVQGMGWPPCGRTMVHWFSISERGTKMSIW
FT                   NVAHNVGGALMPSLVTLGLYFFANDWKSIFYFPGILSILVGVYVLITMKDTPQSCGLPS
FT                   IEEHTGEYPPDEKIKDRERELSAKEILFKYVLNNKFLWYIAIANVFVYFVRYGVVDWAP
FT                   TYLVEEKSFTHSSSRTAYALYEWAGIPGTLLCGWMSDKLFKGRRAPAGILFMVGVFIAV
FT                   LVYWLNPPGNPMVDSIALVAIGFLIYGPVMLIGLHALDLAPKKAAGTAAGLTGFFGYLG
FT                   GAAFASAAMGFIVDAFGWDGGFILLLASCVLAMFFLALTLKTGSVKQKQA"
FT   gene            646355..646813
FT                   /locus_tag="BACI_c06720"
FT   CDS_pept        646355..646813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06720"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03386"
FT                   /db_xref="GOA:D8H121"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8H121"
FT                   /protein_id="ADK03386.1"
FT                   /translation="MPNDMTHIDKIQALAFSIGKKMQTELLEQMQATGLTPPQFYILKI
FT                   LDHYGASRATKLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRVVIIELTKKGKAR
FT                   VEEAMVARNEHIAKYFSHLELQEREDLLRLFEKLETIICGTQEKKENN"
FT   gene            646833..648446
FT                   /locus_tag="BACI_c06730"
FT   CDS_pept        646833..648446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06730"
FT                   /product="multidrug resistance protein B; sugar (and other)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03387"
FT                   /db_xref="GOA:D8H122"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8H122"
FT                   /protein_id="ADK03387.1"
FT                   /translation="MEQQENINRKLLLIGLIIAMLFAALDGTIVGTAMPRIVGELGGLS
FT                   LMTWLTTAYMLTSTTVVPIAGKLADLLGRRNVYITGLVIFMVGSALCGMANGMTELIIF
FT                   RGIQGLGGGIMMPMAMIIIGDMFTGKERAKWQGIFGALYGLASVIGPQVGGWIVDAVNW
FT                   RWVFYINLPVGILATIFIAMGLKSHKQTGPIKIDIAGIFTMILGVVSLLLALTFGGKDY
FT                   AWDSWQIIGLFALALIGIVSFVIVETKAEEPILPMHFFKNRTFTLLNAIGFFMSIGMFG
FT                   AIMFVPFFMQGIVGVSAAESGTIMTPMMITMIVMSIIGGQLVLKVGVKPQIITGMLIMA
FT                   GGFWLLTTMDMHTTKLTATSYMMVIGLGMGLVMPTLTLALQESFPKKDLGVVTSSSQFF
FT                   RQIGGTFGITILGSIMNNTSGTTLTKNLVPVLDTFPKEAGQMVTKFKDMIHTDPQGLYS
FT                   MLFSPEALKQMPEAFANSIVPILKNSLVDSLHTVFLTGLVFIVVGAIFTIFLQKIKLSD
FT                   RKKDAEEPAAEEKEQTVSYS"
FT   gene            648584..649555
FT                   /gene="rbsR1"
FT                   /locus_tag="BACI_c06740"
FT   CDS_pept        648584..649555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR1"
FT                   /locus_tag="BACI_c06740"
FT                   /product="ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03388"
FT                   /db_xref="GOA:D8H123"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8H123"
FT                   /protein_id="ADK03388.1"
FT                   /translation="MSTIKDVAKLAGVSVATVSRVLNKNGYVHEDTLKKVERAIEMLDY
FT                   KPSTVARSLYNKKSRLIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDESLEKE
FT                   KQYIDVLRQNNVDGFIVATNPQNSVNYMNLSVPVVAIDRMFNERIPAVYADNYAGSQAA
FT                   TKLLIDKGCKQIAHIRGPRDVSTANERFEGFVDVITQNNLSYMIAESTFDPANSERVAV
FT                   ELLEEYPHIDGIVAGNDLIAIGIVKAALQKGISIPDDLQIIGFDGISLTEMMYPSITTV
FT                   AQPIYEMGKVATELLLEQMEGNVLEEKHYRLPIEIIERNTTK"
FT   gene            649569..650465
FT                   /gene="rbsK"
FT                   /locus_tag="BACI_c06750"
FT   CDS_pept        649569..650465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="BACI_c06750"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03389"
FT                   /db_xref="GOA:D8H124"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D8H124"
FT                   /protein_id="ADK03389.1"
FT                   /translation="MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQA
FT                   VAAARLGANVAMVGAVGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDN
FT                   SIVVVQGANALVNESVVNRSKDLLIKADMVVLQLEIPLETVKYVLAICEEHKIPVMLNP
FT                   APAQVLSEDILEKATYITPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHN
FT                   GTEIVHVPSIAVDVVDTTGAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQ
FT                   GGMPTRDRVREVQVIVG"
FT   gene            650462..650857
FT                   /gene="rbsD"
FT                   /locus_tag="BACI_c06760"
FT   CDS_pept        650462..650857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="BACI_c06760"
FT                   /product="ribose ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03390"
FT                   /db_xref="GOA:D8H125"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D8H125"
FT                   /protein_id="ADK03390.1"
FT                   /translation="MKKHGVLNSEIAAVLASLGHTDTIVIADCGLPIPDGVKRIDLAVE
FT                   IGKPSFLDVLQVVADDMAIEKVTLAEEVINNNAEVNKEIELKLIEPAFEYVCHEQFKEH
FT                   TKKAKAIIRTGEATPYANVILHAGVIF"
FT   gene            650870..652360
FT                   /gene="rbsA"
FT                   /locus_tag="BACI_c06770"
FT   CDS_pept        650870..652360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="BACI_c06770"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03391"
FT                   /db_xref="GOA:D8H126"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8H126"
FT                   /protein_id="ADK03391.1"
FT                   /translation="MGMRIEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKST
FT                   LMKILTGVYKRDGGTITIDGQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGK
FT                   ELMYGKTGILRTRQMNAIAQQQLAELGLHVKGAMLAGELSVGQQQIIEIAKALMTNASV
FT                   IIMDEPTAALTDCEIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVG
FT                   KRSIPETSFDEVVSMMVGRSIGERYPERNSQIGDVIFEMRNGTKKGKFENVSFQVRKGE
FT                   ILGVAGLMGAGRTDIMKAIFGYEPLDSGQIFINGQEVKIDSPIDAIRQRIAFITEDRKS
FT                   EGLVLDFSIRENLALPNLESLSKGSVLSNELEQQFTADMMKLLNVKASSGEQAVKSLSG
FT                   GNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIMNKLTEEGDAVIMVSSELPE
FT                   VLGMSDRVLVIHEGKVGGILEKDEASQESIMALATGGE"
FT   gene            652363..653298
FT                   /gene="rbsC"
FT                   /locus_tag="BACI_c06780"
FT   CDS_pept        652363..653298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="BACI_c06780"
FT                   /product="ribose ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03392"
FT                   /db_xref="GOA:D8H127"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D8H127"
FT                   /protein_id="ADK03392.1"
FT                   /translation="MAKKGNVLQQLGSLIGLALIIVVITALNPAFIEIPNLFNILRQVS
FT                   INALIAFGMTFVILTGGIDLSVGSILALSSALVAGMMASGMDPFLAMAVGLLAGLVMGI
FT                   VNGIIIAKGKVAPFIATLATMTIFRGLTLVYMDGRPITGLGDHLMFQMFGRGYFLGIPV
FT                   PAVTMVIAFAVLYFILKKTTFGRRTFAIGGNEEAAALSGINVTRIKVMIYGLSGILAAL
FT                   AGIVLTSRLDSAQPTAGTSYELDAIAAVVLGGTSLSGGRGWIVGTFIGVLIIGVLNNGL
FT                   NLLGVSSFFQQVVKGLVILLAVLIDRRKEA"
FT   gene            653313..654239
FT                   /gene="rbsB"
FT                   /locus_tag="BACI_c06790"
FT   CDS_pept        653313..654239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="BACI_c06790"
FT                   /product="ribose ABC transporter, ribose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03393"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8H128"
FT                   /protein_id="ADK03393.1"
FT                   /translation="MKKWLLILVACMMVITAGCSMEPPEWAKDSSDKGRNKTIKVGFSV
FT                   STLNNPFFVTLKKGAEKKAKESGIELIAVDAQNDAAKQTNDVEDLIQKGVDVVVINPTD
FT                   SDAVASAVSAANAANVPVITVDRVANSGKVVSHIASNNIEGGQMASDYIRELVGEGANV
FT                   AELEGIPGSSAARERGKGFHNVADKSLKVVAKQAADFDRAKGLSVMENILQANGDIKAV
FT                   FAHNDEMALGALEALKSAGKTDVVVVGFDATEDAVKAVNDGRMAATVAQKPELIGEKAM
FT                   QTAKEITQGKKVDKSIPIELELIKKNK"
FT   gene            654274..654921
FT                   /gene="tal"
FT                   /locus_tag="BACI_c06800"
FT   CDS_pept        654274..654921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="BACI_c06800"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03394"
FT                   /db_xref="GOA:D8H129"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D8H129"
FT                   /protein_id="ADK03394.1"
FT                   /translation="MKFFIDTANINEIKEANALGVLAGVTTNPSLVAKEGVDFHERIRE
FT                   ICNVVEGPVSAEVISLEADKMIEEGKELAKIAPNVVVKVPMTTEGLKAVKAFSDLGIRT
FT                   NVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFAIHGIETEIIAA
FT                   SVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK"
FT   gene            655239..657638
FT                   /gene="inhA2"
FT                   /locus_tag="BACI_c06810"
FT   CDS_pept        655239..657638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inhA2"
FT                   /locus_tag="BACI_c06810"
FT                   /product="immune inhibitor A, metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03395"
FT                   /db_xref="GOA:D8H130"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="PDB:4YU5"
FT                   /db_xref="PDB:4YU6"
FT                   /db_xref="UniProtKB/TrEMBL:D8H130"
FT                   /protein_id="ADK03395.1"
FT                   /translation="MRRKAPLKVLSSLAIAAIIGCTSVMSAPLAYAETPAKEKENVSTT
FT                   PIDYNLIQEDRLAEALKERGTINPASSKEETKKAVEKYIEKKQGDQANKEILPADTAKE
FT                   ASDFVKKVKEKKMEEKEKVKKPEKNVSPEQKPEPNKKQLNGQVPTSKAKQAPYKGSVRT
FT                   DKVLVLLVEFSDYKHNNIDQTPGYMYSNDFSREHYQKMLFGNEPYTLFDGSKVKTFKQY
FT                   YEEQSGGSYTTDGYVTEWLTVPGKASDYGADGSSGHDNKGPKGARDLVKEALYAAAEKG
FT                   LDLSQFDQFDRYDTNSDGNQNEPDGVIDHLMVIHAGVGQEAGGGKLGDDAIWSHRSKLA
FT                   IDPVAIEGTKSKVDYFGGKVAAHDYTIEPEDGAVGVFAHEFGHDLGLPDEYDTKYTGTG
FT                   SPVEAWSLMSGGSWTGKIAGTEPTSFSPQNKDFLQKNMGGNWAKILEVDYDKIKRGVGV
FT                   PTYIDQSVTKSNRPGVVRVNLPGKSVETIKPEFGKHAYYSTRGDDMHTTLETPFFDLTK
FT                   GTNAKFDYKANYELEAECDFVEVHAVTEDGTKTLIDRLGEKVVQGDKDTTDGKWIDKSY
FT                   DLSQFKGKKVKLQFDYITDPAVTYKGFAMDHVNVTVDGQVVFSDDAEGQSKMNVNGFVV
FT                   SDGTEKKAHYYYLEWRNYAGSDNGLKAGKGPVYNTGLVVWYADDSFKDNWVGVHPGEGF
FT                   LGVVDSHPEAFVGNLNGKPTYGNTGMQIADAAFSFDQTPAWSVNSLTRGQFKYSGLQGV
FT                   TTFDDSKVYSNNQIADAGRKVPNLGLKFQVVGQADDKSAGAVWIKR"
FT   gene            complement(657920..659092)
FT                   /locus_tag="BACI_c06820"
FT   CDS_pept        complement(657920..659092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06820"
FT                   /product="probable multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03396"
FT                   /db_xref="GOA:D8H1U8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1U8"
FT                   /protein_id="ADK03396.1"
FT                   /translation="MKYFIYFIVIVAFLDTFSQLPIMSTFAQSLGGSPLIIGLVVGMYS
FT                   FANMIGNIIAGAAVDKFGAKKILYISMGLTSFIVLLYTVVQSGEQLLVVRFMHGFSDGF
FT                   LIPAAFTFLSKQTNAARQGKAMALSGAAVGTAAIVGPAFSGIMKATAGIEWVFITISIL
FT                   MVLGTIVSLFFLPNNVSRKDTSRTQMMNKEDMFELLKSEPLLQAYIGAFTLMFSQGIVT
FT                   YMLPVKVEALALKASTTGMMLSVFGITAILFFLLPTNRIYDRFNRSKLMLIGIAVMALA
FT                   LSLLGLFATKGMLFIVMMIYGIGFAILFPSINALLVENTTDDKRGKAFGLFYAFFSLGV
FT                   VAGSFTVGAIGASPSVSFVIGTAFLLTFAGMIYVRSKIKNKGKVKKTMMG"
FT   gene            659318..660370
FT                   /gene="adhB1"
FT                   /locus_tag="BACI_c06830"
FT   CDS_pept        659318..660370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhB1"
FT                   /locus_tag="BACI_c06830"
FT                   /product="zinc-containing alcohol dehydrogenase,
FT                   long-chain"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03397"
FT                   /db_xref="GOA:D8H1U9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1U9"
FT                   /protein_id="ADK03397.1"
FT                   /translation="MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYL
FT                   AGPIFIPTEEHPLTHVKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEA
FT                   CKHGHYNVCEQLVFHGLGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHA
FT                   VRQSKLKEGEAVAVFGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLN
FT                   PATQDVLAEIRNLTNGLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITP
FT                   NNLVLKEKEVVGILGYRHIFPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDK
FT                   TQVKILVSPK"
FT   gene            660489..660833
FT                   /locus_tag="BACI_c06840"
FT   CDS_pept        660489..660833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06840"
FT                   /product="possible potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03398"
FT                   /db_xref="GOA:D8H1V0"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V0"
FT                   /protein_id="ADK03398.1"
FT                   /translation="MLSFMLTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTV
FT                   EGLRPLDALYFSVVTLTTVGDANFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
FT                   PSILSNRKKE"
FT   gene            661087..661917
FT                   /gene="plcB"
FT                   /locus_tag="BACI_c06850"
FT   CDS_pept        661087..661917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="BACI_c06850"
FT                   /product="phosphatdylcholine-specific phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03399"
FT                   /db_xref="GOA:D8H1V1"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V1"
FT                   /protein_id="ADK03399.1"
FT                   /translation="MKKKVLALAAAITLVAPLQSVAFAHENDGGSKIKIVHRWSAEDKH
FT                   KEGVNSHLWIVNRVIDIMSRNTTLVKQDRVAQLNEWRTELENGIYAADYENPYYDNSTF
FT                   ASHFYDPDNGKTYIPFAKQAKETGAKYFKLAGESYKNKDMKQAFFYLGDVNQPMHAANF
FT                   TNLSYPQGFHSKYENFVDTIKDNYKVTDGNGYWNWKGTNPEDWIHGAAVVAKQDYSGIV
FT                   NDNTKDWFVKAAVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYGDR"
FT   gene            661991..662992
FT                   /gene="spH"
FT                   /locus_tag="BACI_c06860"
FT   CDS_pept        661991..662992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spH"
FT                   /locus_tag="BACI_c06860"
FT                   /product="sphingomyelinase"
FT                   /EC_number="3.1.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03400"
FT                   /db_xref="GOA:D8H1V2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR017766"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V2"
FT                   /protein_id="ADK03400.1"
FT                   /translation="MKGKLLKGVLSFGIGLGVLYGGSSAQADTSTDQNNTLKVMTHNVY
FT                   MLSTNLYPNWGQSERADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAV
FT                   LGRSNGNEWDKTLGSYSSATPEDGGVAIVSKWPIVEKVQYVFANGCGPDNLSNKGFVYT
FT                   KIKKNDRFVHVIGTHLQAEDSMCGKTSPASVRTNQLKEIQDFIKNKNIPNDEYVLFGGD
FT                   MNVNKINAENNSDSEYASMFKTLHASIPSYTGHTATWDATTNSIAKYNFPDSPAEYLDY
FT                   IIASKDHANPSFIENKVLQPKSPQWTVTSWLKKYTYNDYSDHYPVEATISMK"
FT   gene            663100..664272
FT                   /locus_tag="BACI_c06870"
FT   CDS_pept        663100..664272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03401"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V3"
FT                   /protein_id="ADK03401.1"
FT                   /translation="MDRGIFKEVPLPCAFLDEVALDRNIQSIIELSGNKKIRIASKSLR
FT                   SVPIMKRILAANNRFQGIMCFSPREALFLIEQGFNDLLLGYPAYDERALHEISLLTKQG
FT                   LIITCMVDCEDHIVYLERIAEKSKGCFRVCLDIDMSSRFFKFHFGVKRSPVKDVQGTLK
FT                   IVERVKESSFLILDGVMGYEAQIAGVGDHIPNQRVKSKVISYLKKKSVLEVKERRGHIV
FT                   KEIQNLGIELRFVNGGGTGSIKTTEQDHSVSEITIGSAFYAPKLFDYYKEVQFHPAVGF
FT                   ALPVVRKPAPTIYTCLGGGYIASGAIGKDKEPEIWRPGGAKLLALEGVGEVQTPIFYNG
FT                   EERVEIGDSILFRHSKAGELCERFPFLYRVKEGEIVGEYSTYRGDGQCFL"
FT   gene            664260..665573
FT                   /locus_tag="BACI_c06880"
FT   CDS_pept        664260..665573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06880"
FT                   /product="probable FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03402"
FT                   /db_xref="GOA:D8H1V4"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V4"
FT                   /protein_id="ADK03402.1"
FT                   /translation="MLSIKGQKWRNWTGNVEGTPHYTMYPESIQDVVEVIELARKKGKK
FT                   IRVVGSGHSFTPLVQTEEILVSLDELKGIVNIDTEKMIAEVWAGTKLHELGKLLEEKGY
FT                   AQENLGDIDSQSIAGAISTGTHGTGITFGSLSTQVIEITAVLSTGETIVCSETENVEYW
FT                   RAFQLSLGMLGIIVRIKLNIIRAYSLVYESEKQSLATVMNKLEEYKKNRHFEFFVFPYS
FT                   DEVQVKVTNETTGKKSDLKWHKLKVELLENKMFSLLSKGCKWFPSISKGVSRLSAKAVP
FT                   NTKIIGPSYEVFATSRAVPFYEMEYSVPSKYMQAVVEEISNLIEKKKYKVHFPIECRYV
FT                   KRDDIWLSPAYGRDSAYIAVHMYKGMKYAAYFGEVEKIFLKYEGRPHWGKMHTLTYGKL
FT                   QNIYPELHSFLKVRKLLDEAEMFSNPYTEKLFTIMKKS"
FT   gene            complement(665581..666675)
FT                   /locus_tag="BACI_c06890"
FT   CDS_pept        complement(665581..666675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06890"
FT                   /product="probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03403"
FT                   /db_xref="GOA:D8H1V5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="InterPro:IPR021192"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V5"
FT                   /protein_id="ADK03403.1"
FT                   /translation="MFLLIPFLIFNYRKYGYLNKWRSFILYSLLLYLLNAYFLVILPLP
FT                   QTYDTCSLQPANTQHMQLSPFYFIQEISNRTSAILTKPATYFYLLKESAFLQVAFNVLL
FT                   TVPFGIYLRYYFRRSFLQTICISFCLSLFFELTQVTGLYGIYNCAYRLFDIDDLFLNTL
FT                   GGVIGFIIAPIFMYFLPKANELDSHVDLETKPVGFVRRFIAMQIDWIFLSIVVPVIKNK
FT                   GNSFFVSNLQAYTNIYELIFITCSILIYFIIIPYFTNGKTIGKALLRIYVKGKSDRITM
FT                   KELFIRYGIFYFILGGINYILSSSSILNLKEPLVLIVIVLFQLVINGLFIVHVLLHVFS
FT                   RDKLLFYERISQTRNAIILKKADK"
FT   gene            666905..667108
FT                   /locus_tag="BACI_c06900"
FT   CDS_pept        666905..667108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03404"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V6"
FT                   /protein_id="ADK03404.1"
FT                   /translation="MRYELFSVSGNHITTFESAWRFQEGEQIFVHDDQTKRNFIIIRLT
FT                   HDVFQQNKHVIRLYCQEKKVYA"
FT   gene            complement(667166..667978)
FT                   /gene="uppP1"
FT                   /locus_tag="BACI_c06910"
FT   CDS_pept        complement(667166..667978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP1"
FT                   /locus_tag="BACI_c06910"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /EC_number="2.7.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03405"
FT                   /db_xref="GOA:D8H1V7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V7"
FT                   /protein_id="ADK03405.1"
FT                   /translation="MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGF
FT                   SFELLVNSASLLAVLLIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGV
FT                   IGVLFKDYIDQYLKGVKMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQAC
FT                   ALIPGISRSGATIVAAMLLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLF
FT                   VPYIVAFIATFIMTYISLKWFMNIMAKGNLKYFSFYCIIVGVLTLIFL"
FT   gene            complement(668111..669055)
FT                   /gene="mcpC"
FT                   /locus_tag="BACI_c06920"
FT   CDS_pept        complement(668111..669055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpC"
FT                   /locus_tag="BACI_c06920"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03406"
FT                   /db_xref="GOA:D8H1V8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V8"
FT                   /protein_id="ADK03406.1"
FT                   /translation="MFTQKKSLQHKIDQLENRIQELEAELKQKDIEQQETISSIHDRVQ
FT                   SVVQEHKLVNNQHHTLQNLVQQLNSCFENVSTRTTHSNELNNEMLQKEQSLIQSIEEII
FT                   DCSNEGKESVHRLLIVINKLGEQSQRTSNSMNHLSERSKEIEQIVEVIQNIAAQTNLLA
FT                   LNASIEAARAGEHGKGFAVVANEVRKLAESTTESTKNIGNLTKKIQEEIEKAYDNTKDN
FT                   LHLVDEGVEMSADTNARIENILIMIQTLQNGATNVIKAIENQKSCNDDILREFANTQQM
FT                   FQKLNTTIMNHIHDAEKVDVQLTKSLEETAVSR"
FT   gene            669276..670550
FT                   /locus_tag="BACI_c06930"
FT   CDS_pept        669276..670550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03407"
FT                   /db_xref="GOA:D8H1V9"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1V9"
FT                   /protein_id="ADK03407.1"
FT                   /translation="MNYFKRISSLVLAGIIGLSSTVAVKAESNDEKLNNMQQQLQQNDA
FT                   EMQKKEQEKQAVSKEIQGIENELHNLNNTIAKNKEDQAAIQRKIDETHKQIEQKKNEIV
FT                   VLEDKVLARKDIMRKRMVSVQNSSNTSLVVEVVVESKNFADFLQRMNAVSTILEADKEI
FT                   LRLQEQDLRQIEEDKKTIDEKEASLVVDKQKLAKAQAELQDNLKKRQANLQTVQAKYNQ
FT                   VASQLNLAAEEKAKIESNMKAVQETIAREQEAARIAAEERAKAEAAAKAEQEALAKAQA
FT                   EVAEKKKQEQASKPAEPVANNNSKVEPVQPTKPTAGGREIYVHATAYTADPGENGYAPG
FT                   QQVYSAWGPGGKPYNLTANPGMKLIAVDPSVIPLGSTVNVEGYGIAIAADTGGAIKGHK
FT                   IDVLMPDKASSSNWGRKNVKVTILN"
FT   gene            670663..670881
FT                   /locus_tag="BACI_c06940"
FT   CDS_pept        670663..670881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06940"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03408"
FT                   /db_xref="GOA:D8H1W0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W0"
FT                   /protein_id="ADK03408.1"
FT                   /translation="MTILNRVKELRARFNFSQSVLAEKVGVTRQTIAAIEKGDYVPSLL
FT                   LALTICDVFELKMEDVFVLNKEGKEDE"
FT   gene            670874..671347
FT                   /locus_tag="BACI_c06950"
FT   CDS_pept        670874..671347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03409"
FT                   /db_xref="GOA:D8H1W1"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W1"
FT                   /protein_id="ADK03409.1"
FT                   /translation="MNRLVFSYMLNVLLMVLAGWAFIELYYFTIEVANFIQTKRVPFEV
FT                   SVSLMPLGLLLIFGIVSTILYKVQKKKYKELSYWMFPLLFPQEDEREKAITEKACRTTF
FT                   MSLWYVLPCAVGFLTLSPIVNLYVPAYPIYIAFSIFFIQMTIFHVSLYRNKIA"
FT   gene            671464..672096
FT                   /locus_tag="BACI_c06960"
FT   CDS_pept        671464..672096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06960"
FT                   /product="probable sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03410"
FT                   /db_xref="GOA:D8H1W2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W2"
FT                   /protein_id="ADK03410.1"
FT                   /translation="MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQK
FT                   MDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLL
FT                   SGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGEKIYLYDNENEYEYAVTGV
FT                   SEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGNLVGTKAKK"
FT   gene            complement(672126..673511)
FT                   /locus_tag="BACI_c06970"
FT   CDS_pept        complement(672126..673511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06970"
FT                   /product="peptide symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03411"
FT                   /db_xref="GOA:D8H1W3"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W3"
FT                   /protein_id="ADK03411.1"
FT                   /translation="MESAIQLEKEQQRKKKHPPGLYLLFFTEMWERFSYYGLRGLLTLY
FT                   LTTALVSGGLGFSPAWALSIYGFYTGACYFTPMIGGYLTDRFLGRRKAITIGGITMAIG
FT                   NLTLFAMQNQVGLYLGLALIIIGNGFFKPNISTLVGELYEENDPKRDSAFTIFYMGINV
FT                   GSFLAPLVCGFLSENLFKTTVDGVVHYGFRYGFLAASIGMIIGQILFTTLSNRFLGDIG
FT                   KKPTRDLQTTDGQPSVGDTPLTKKEKQRTAVIVILTCFVVFFWAGFEQAGSSLTLYTNK
FT                   FVDRSVFGWEVPTSWFQSVNPLFIILLAPVISALWAKLATRKRGDLKIPTKMGLGMILL
FT                   GIGYIILVIATLKTGSDEHNITEKANLLFIVFTYLFHTLGELFLSPVGLSMVSALAPVK
FT                   LASLLMGVWLASSGIANILGGQLASFTTSLGYAEVFTVIGAVAIVLGCVLLLISKKLVK
FT                   WMD"
FT   gene            673764..675065
FT                   /gene="brnQ1"
FT                   /locus_tag="BACI_c06980"
FT   CDS_pept        673764..675065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ1"
FT                   /locus_tag="BACI_c06980"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03412"
FT                   /db_xref="GOA:D8H1W4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W4"
FT                   /protein_id="ADK03412.1"
FT                   /translation="MKLLQKKEILLISLMLFSMFFGAGNLIFPPFLGYEAGEHVWISLV
FT                   GFIISATGLPILGVIAIAKAGSFQALAGRVHSSFAIIFPCIVYLFIGPGLGIPRAGSLA
FT                   FEMGPGQFFPEAGSIVLLCYTVIFFSIVYWLSLSPSKLMGLFGKVLTPLLLGMIALIFI
FT                   KSMFTSVGSVKEASGNYGQAPMFQGFLDGYLTMDALAALIFGIVIANALRAKGIEDDKG
FT                   LAKYMSIAGIGAGLLLSIIYVILGYVGSISGSLGAFNNGAQVLAQVMTTLFGQGGVVLL
FT                   GIIFTIACLCVSIGLVTSCSQFFASAFPKVAYKVWAFMLSFVSMILANLGLTQILKVSV
FT                   PILGFIYPVALTLIILGLFHKYIGKYAYVYAVTVGIVAVFSAIDIFNKNVMMNQWTSVL
FT                   KYIPFYIEGVGWIVPAIIGACIGVIVSFVFNKKK"
FT   gene            675199..676920
FT                   /locus_tag="BACI_c06990"
FT   CDS_pept        675199..676920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c06990"
FT                   /product="probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c06990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03413"
FT                   /db_xref="GOA:D8H1W5"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W5"
FT                   /protein_id="ADK03413.1"
FT                   /translation="MKEDLNKKIEALETAIETMQEALFELKAKQRGIEVKNAQQHVSKE
FT                   KKEYIETVMEEKQKEEVVTIKEPVQEREVKQVDISAFKPEPFNIIKFCQTWLPRIFVGI
FT                   MLLGVIWLFKAGVDAGLLTPAIRIVFGIVLSIGFYYIGDIQIKRERQALGLVLAGGSIT
FT                   GIVLTTFAAHYLYGFIPASVAFVCNIAWVILGIYIAKRYQSEYLTIFVAVGAFFVPFLL
FT                   NSTTPNPYIFFGYETILTLSLLWYALKNRYQYLYMISYAVAAIVLFVFFAVMSMLVEDL
FT                   QVQLTVVYGLIHLLLFWHMFTERSFIVETRLAIFSANAVFFILAISKIPEFTTWGLMIS
FT                   ALVHATMFVFEYRKNRHSTFTNLLFGFAMGAFSLAILYEYSLVNAAIVLLLQGFLGMVT
FT                   SIKGKQQIKLYVSATVYAIGMIQTIFSPFDQFISAGFVAHIILIGTFYYCMKQAKDVLK
FT                   SFGKYVYSIALYWFMVIVFIAITRVGEVLSTDGSIISVSVSLLWMVYALFAVWLGRNKH
FT                   MNEILYAGLIVLVVTIGKLFLLDLPEVSMMIRAVLFLIVGSIGIVISRMFFSKEEK"
FT   gene            complement(676955..678502)
FT                   /locus_tag="BACI_c07000"
FT   CDS_pept        complement(676955..678502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03414"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR039975"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W6"
FT                   /protein_id="ADK03414.1"
FT                   /translation="MKNKKWITFSLATAITLSIGASFIPSTYAESSVDPAPEIAAKVVN
FT                   QNNGKKVLFDNTHGQTAGTADWVIDGGFSDFGNGIAQNGYHVKELRKSTPITYEDLKDY
FT                   NVFIVPEANIPYKKSEQDAMLQYVKNGGSIFFIADHYNADRNKNRWDSSEVFNGYRRGA
FT                   WDNPAKGMSNEEANSQAMQGVESSDWLSDNFGIRFRYNAIGDVAAKNIVSPEQSFGITE
FT                   GVSSVAMHAGSTLAITNPKLAKGLVYLPENPSKWNNAVDSGVYNGGGVAEGPYAAIAKV
FT                   GLGKAAFIGDSSPVEDATPKYVREDSGQTKKTYDGYKEENDAILLENIVNWLSNKETFT
FT                   SLDQVSGLQLDLPTTLQTFEQPSLSTEPQPEPWSAPNAGYQWFNTNTFKPGSYGYNGAV
FT                   TANDYVVTHPSILPNNEVFQMKIQVNNLLPNTTYDNYSLGIFTTGGTQVAKVQNTNGTW
FT                   PSTFGYSSAFSFTTNSLGSAEKIVNVQINPNTTGQATLRLRQNTTAKYSETVTINKK"
FT   gene            complement(678684..680075)
FT                   /gene="proY"
FT                   /locus_tag="BACI_c07010"
FT   CDS_pept        complement(678684..680075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="BACI_c07010"
FT                   /product="amino acid permease; possible proline-specific
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03415"
FT                   /db_xref="GOA:D8H1W7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W7"
FT                   /protein_id="ADK03415.1"
FT                   /translation="MQHSNKSGTLNRGLKERHITLMSLGSAIGVGLFLGSASAIKLAGP
FT                   SILLGYMIAGLVIFFIMRALGEMAIEQPVAGSFSKYAYDYLGPLAGYITGWNYWFLWVV
FT                   TCMAEITAAGIYMQYWFPDIPRWTWALLALLLMSAFNFLSVKVFGELEFWFALIKIVTI
FT                   ICMIVVGAGIILFGFGNGGIATGISNLWSHGGWFPNGFSGLLLSMQMVLFAYLGVELIG
FT                   VTAGEAQNPKKTLAKAIDNVFWRILLFYVGALFVMMAIYPWNELGEKGSPFVLTFQQIG
FT                   IAKAAGIINFVVLTAALSSCNGGLFSTGRMLYTLAQQKKAPERFGRLNKNGIPSQGIVA
FT                   TAIVLLIGVILNYLVPAKVFTWLTSISTFGAIWTWGIILVAQIKFRKSLPTQNRQKLSY
FT                   KMPLYPLSSYFSLAFLVLVLGIMAYSEDTRIALIVGPIWLIGLAIVYYMKGFHKIDETP
FT                   NSKIS"
FT   gene            680356..681648
FT                   /locus_tag="BACI_c07020"
FT   CDS_pept        680356..681648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07020"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03416"
FT                   /db_xref="GOA:D8H1W8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W8"
FT                   /protein_id="ADK03416.1"
FT                   /translation="MFQLQKYNTSVKQEFLAGITTFFTFAYILVINPKILSDAGVPFDQ
FT                   AFTATIIATVVGTIGMAIFANYPIVIAPAMGMNAYFAYSVVQKAEGITYVIAFSAVFVT
FT                   GIIFLLLSFTSFRQKLILAIPDSLKHAIAGGIGLFIAFIGLRLSGIIVDHPSNLVTIGD
FT                   FHSPAVILTLIGLILAAVLMALRVSGALFISMIVTGVIAFFTGQLKFTDKIVAMPHLPE
FT                   GIIVSNPINAFSDVIEYGLYGVVFSFLLVLLFDTTGALLGLIKQAGLITDNTEKRFGKA
FT                   FIADAIGGTTGSIFGTSPTAATIESSAGIAAGGKTGLTGIVVVGLTIITAFFSPVIASL
FT                   SSVAAITAPSLIIVGSLMAQSIRDINWNEFEDALPAFLIFVGIPLTSSIANGIAIGFLV
FT                   YPVLKIVKGKGMEVHPLLYLFTILFGCHLFL"
FT   gene            681780..681980
FT                   /locus_tag="BACI_c07030"
FT   CDS_pept        681780..681980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07030"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03417"
FT                   /db_xref="GOA:D8H1W9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1W9"
FT                   /protein_id="ADK03417.1"
FT                   /translation="MAVSKIKVARVQLDLTQQQLAEKVGVTRQTISLIEKGKYNPSLDL
FT                   CLKICYAVDKTLNDLFWEEKE"
FT   gene            681985..682413
FT                   /locus_tag="BACI_c07040"
FT   CDS_pept        681985..682413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03418"
FT                   /db_xref="GOA:D8H1X0"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X0"
FT                   /protein_id="ADK03418.1"
FT                   /translation="MKIVKDERLMIEGLKHIRLVFILQNIFILGIVFYRYVLQDAGYES
FT                   VSDLLMVFMGGIVVINFLNLKNSVEVYEHTGGVSRSYFMKLLLVPVSIVIGILAICIVV
FT                   TPDISIKEISMTGLIMFACFLVPSLFIYIYMKKIKSED"
FT   gene            complement(682451..682888)
FT                   /locus_tag="BACI_c07050"
FT   CDS_pept        complement(682451..682888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07050"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03419"
FT                   /db_xref="GOA:D8H1X1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X1"
FT                   /protein_id="ADK03419.1"
FT                   /translation="MITVKNIDGSETYVLRQKILRPNQTLADCKYPSDYETDTFHLGAF
FT                   INDQLISIASFSKEMHPDLQAGMHYRLRGMATLPEFRNNHAGSSLIQKAEQILQERQAN
FT                   ILWCNGRVTVANYYKRLGFQEHGEIFEIEPIGLHKVLYKRI"
FT   gene            complement(682903..683124)
FT                   /locus_tag="BACI_c07060"
FT   CDS_pept        complement(682903..683124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03420"
FT                   /db_xref="GOA:D8H1X2"
FT                   /db_xref="InterPro:IPR025095"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X2"
FT                   /protein_id="ADK03420.1"
FT                   /translation="MSIITLALLLLAEILVAIILIGVSIEICSYGWKKSNGIKYSCLLL
FT                   SLLLGTASILGLFAAPAYFFIQLTEKAL"
FT   gene            complement(683214..685043)
FT                   /gene="napA1"
FT                   /locus_tag="BACI_c07070"
FT   CDS_pept        complement(683214..685043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA1"
FT                   /locus_tag="BACI_c07070"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03421"
FT                   /db_xref="GOA:D8H1X3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X3"
FT                   /protein_id="ADK03421.1"
FT                   /translation="MEHHTSVLSLMVVVAIAFFVPLLLQRFKLKALPVVVAEIIAGIFV
FT                   GKSGFNIIEPDMWLQVLSTLGFIFLMFLSGLEIDFSIFKQKGKKNTTNEPNTFQAASVI
FT                   FLFIFILSYALSLLFVWLGFVDNAMFMTLIISTISLGVVVPTLKENNLGKTAIGQIILL
FT                   VAVIADLVTMILLAVFVGLNSESGQSMWLLLLLFGAGIIIYFVAKRFKNIPYLDSLKAG
FT                   SVQIDTRAVFALILILVGLSESVGAENILGAFLAGVLVSLLSPNEDMVEKLDSIGYGFF
FT                   IPIFFVMVGVNLEVWSIFKEPSSMLMIPILIVGLFISKLIPSLVLRKWYPRNIVLGSAI
FT                   LLTSTLSLVIAAAQIGEKLGIISPSLSASLILSAVITCIFAPILFKKMFPKVETPKPKV
FT                   SIIGASRITLPLSLDLKREDYDVTLYMMRQNKINDEEAKSHDFPIVKLDDITIASLTEQ
FT                   TAFHADRVVVATSDDEQNLLLAEHAKELGVEHVIASVEDPLLQEKATQEHIAVFSTINS
FT                   TRILLRALIDKPSLVRLITTANETVREVELRSNKYNGVALRRLPFLGDVLVIQIYRGNK
FT                   ALIPHGDTRLQHGDTLLVTGSKEHIDTLKSILE"
FT   gene            complement(685264..685575)
FT                   /gene="qoxD"
FT                   /locus_tag="BACI_c07080"
FT   CDS_pept        complement(685264..685575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="BACI_c07080"
FT                   /product="quinol oxidase, subunit IV"
FT                   /EC_number="1.9.3.1"
FT                   /note="cytochrome C oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03422"
FT                   /db_xref="GOA:D8H1X4"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014250"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X4"
FT                   /protein_id="ADK03422.1"
FT                   /translation="MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTNLPL
FT                   STILTTIIIMAVAQALLQLIMFMHLKEGEGRVQVLTMIYSFFVATATVGLTVWIFFSM"
FT   gene            complement(685576..686178)
FT                   /gene="qoxC"
FT                   /locus_tag="BACI_c07090"
FT   CDS_pept        complement(685576..686178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="BACI_c07090"
FT                   /product="quinol oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03423"
FT                   /db_xref="GOA:D8H1X5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014246"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X5"
FT                   /protein_id="ADK03423.1"
FT                   /translation="MAALDKSLPLEYQSEQSRLNILGFWIFLGAEIMLFATLFASYLVL
FT                   AGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIVIHEMRKHNQKAMLGWFVLTLLLG
FT                   AGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGTHGAHVTGGIIWAICVIIQILKRG
FT                   LTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMVA"
FT   gene            complement(686192..688126)
FT                   /gene="qoxB"
FT                   /locus_tag="BACI_c07100"
FT   CDS_pept        complement(686192..688126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="BACI_c07100"
FT                   /product="quinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03424"
FT                   /db_xref="GOA:D8H1X6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014233"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X6"
FT                   /protein_id="ADK03424.1"
FT                   /translation="MKLDEFFVTGDPIIYGADASIVLVTLAIIFVLTKYKKWKWLWDEW
FT                   LTTVDHKKIGAMYIISAVIMLFRGGMDGLMIRAQLTFPETTYLNAEHYNGIFTTHGTVM
FT                   ILFMAMPFVMGLMNLVVPLQIGARDVAYPFLNALSFWLFFVGAMLFNIAFVIGGSPDAG
FT                   WTSYFPMAGTEFTSGVGNNYYAIALQISGLGTLMTGINFLVTILKMRTPGMTLMRMPMF
FT                   TWSILITTIIIIFAFPVLTVALALMTFDRLFDAHFFTMASGGMPMLWANLFWVWGHPEV
FT                   YIVILPAFGIFSEIISTFSRKRLFGYSAMVYSMVAISLLSFVVWLHHFFTMGAGPAVNS
FT                   FFSISTMAISIPTGVKIFNWLFTLYKGRIRFTVPMLWSLAFIPNFVVGGVTGVMLGMAA
FT                   ADYQYHNSYFLIAHFHYVLIAGTVFAMLAGFTFWYPKMTGHMLNERLGKWTFWIFMSGF
FT                   NICFFPMYFLGLDGMTRRMYTYSESLGWGWLNQIASVGAVMMGIGFLLLCYNVIWSARH
FT                   GERDTTGDPWDGRTLEWATQSPVQHYNFAKLPEIKEADAFWYMKKRGETVTPAAEDIKP
FT                   IHMPSNSGVPIIASGFFGLAGFALVFSWFWLAAIGGIGILACLIYRSFDYDEGYYISVD
FT                   EIKKSEHVA"
FT   gene            complement(688160..689035)
FT                   /gene="qoxA"
FT                   /locus_tag="BACI_c07110"
FT   CDS_pept        complement(688160..689035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="BACI_c07110"
FT                   /product="quinol oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03425"
FT                   /db_xref="GOA:D8H1X7"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006332"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X7"
FT                   /protein_id="ADK03425.1"
FT                   /translation="MQLKKAFWKLASLLPLSLLLFLGGCDKKLAVLNPQGPVAKAQYDL
FT                   IVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGNTLLEIIWTLVPVIIVI
FT                   ALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEEKIETVNYLNIPAGVP
FT                   IQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLGRSANFSGEGFTHME
FT                   FEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSSHHLSYVDPKSLEY
FT                   CDYNYYKNKK"
FT   gene            complement(689317..689475)
FT                   /locus_tag="BACI_c07120"
FT   CDS_pept        complement(689317..689475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07120"
FT                   /product="amino acid permease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03426"
FT                   /db_xref="GOA:D8H1X8"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X8"
FT                   /protein_id="ADK03426.1"
FT                   /translation="MFTFVSLVFIPDQRIALYYGIPFMVICCILYQMKYKKIVTFEQQR
FT                   TISKGIN"
FT   gene            689571..690281
FT                   /gene="yvpB"
FT                   /locus_tag="BACI_c07130"
FT   CDS_pept        689571..690281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvpB"
FT                   /locus_tag="BACI_c07130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03427"
FT                   /db_xref="GOA:D8H1X9"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1X9"
FT                   /protein_id="ADK03427.1"
FT                   /translation="MKKLKYLFVFGIIFAAVFFIGKDKIIQKAQVLRLDFLSEMKEAAM
FT                   IENVPFIKQLPELPRGCEVTSLAMLLQYKGVQVDKMQLASEIHRVPFEQDGLRGNPYEG
FT                   FVGNIYTKAEPGYGVYNKPIFNLAEKYVSEKVINLTDRDVNDLYKVISSGSPVWVIINT
FT                   TFKPLAESSFETWNTSSGEVKITYFEHSVVVVGYDQNFVYVNDPLKNNPRFAVPRAEFE
FT                   KAWEQMGKQAITIL"
FT   gene            690414..691589
FT                   /gene="amaA1"
FT                   /locus_tag="BACI_c07140"
FT   CDS_pept        690414..691589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaA1"
FT                   /locus_tag="BACI_c07140"
FT                   /product="probable N-acyl-L-amino acid amidohydrolase"
FT                   /note="aminoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03428"
FT                   /db_xref="GOA:D8H1Y0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y0"
FT                   /protein_id="ADK03428.1"
FT                   /translation="MDVAKELVVSKNQLIEWRRHFHKYPELSFQEEKTSQFVFDILRKI
FT                   PHLEVSRPTKYSVMAKLIGKQPGKTIAVRADMDALPIHEENEFDFISAYPGVMHACGHD
FT                   GHIAILLGVVHKLVEAREKIKGEVRFLFQHAEENFPGGAEEMVAAGVMEGVDYIVGAHL
FT                   WASLEVGKVGVIYGPAMAAPDVFKIKIEGKGGHAGIPHETVDSIAIGTQVVSQLQQIVS
FT                   RLTNPLDSLVVSVTQFHAGTTHNVIPAQTEIEGTVRSLRHELREETEKRIEQIVKHVTE
FT                   AYGAKYTFSYEYGYRPVVNDYEVTEIIEQTALQLYGRERVTRLQPTMAGEDFSAFLQKV
FT                   PGTFFFIGAGNKEKGIIYPHHHPRFTIDEDALPIGVQVFVSSIMNFISKGE"
FT   gene            691591..691788
FT                   /locus_tag="BACI_c07150"
FT   CDS_pept        691591..691788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03429"
FT                   /db_xref="GOA:D8H1Y1"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y1"
FT                   /protein_id="ADK03429.1"
FT                   /translation="MKKIHVLALIPVFCLVVGPVFANSVTPYILGMPFLLFWILLSVLI
FT                   TSLCMGIVYVFDPANKGDVK"
FT   gene            691785..693257
FT                   /locus_tag="BACI_c07160"
FT   CDS_pept        691785..693257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BACI_c07160"
FT                   /product="sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03430"
FT                   /db_xref="GOA:D8H1Y2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y2"
FT                   /protein_id="ADK03430.1"
FT                   /translation="MTALLIIILFLFLALFLGIRAQHGKDMNLEQWSVGGRGFGTIFVF
FT                   LLMAGEIYTTFTFLGGSGWAYSKGAPTFYILGYGALAYILSYFLLPPVWKYAKEHNLVS
FT                   QPDFFVKKYKSQALGLIVSIIGVISIIPYLVLQLKGLGIIVSEASYGRVSPVIAVWIGA
FT                   IVITIYVMVSGIHGSAWTAALKDIMILFIVMFLGIYLPYHYYGGFQPMFEAVEAAKPGF
FT                   LSLPDEGMSISWFVSTIILTALGFYMWPHTFASAFSAKNEKVFRKNAAIMPLYSLVLLF
FT                   VFFAGFAAILQVPGLKGGDVDLSLFRLALQTFDPWFIGIIGSAGVLTALVPGSMLVMAA
FT                   STLLAKNIYRTMVPSASDRQVAKVAKLFVPVVTLVAVLFTFKGGETIGALLLMGYSIVT
FT                   QLFPALVCSLFPRQTITKQGAIAGMGIGLLVVAYITLSGSTIATMFPGFPQYIKDLNVG
FT                   IVALLMNMIVMFIVSGFTKNVSIKKDNIIVEK"
FT   gene            693360..694838
FT                   /gene="gerLA"
FT                   /locus_tag="BACI_c07170"
FT   CDS_pept        693360..694838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLA"
FT                   /locus_tag="BACI_c07170"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03431"
FT                   /db_xref="GOA:D8H1Y3"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y3"
FT                   /protein_id="ADK03431.1"
FT                   /translation="MGDLLELKGNLFEVMKEIRDELGSPNDLTIREVALAGSFTRCAVV
FT                   FLCGLTDKDNVYKYVVRTLQYEEIQKDEAVVQTLLDRFISIAEVGKKTTFPDIINAILA
FT                   GDTVILIDNIQTAIVINSRAWEKRSLEPPVTEDLIRGPRIGLNEDINVNKMLIRRSLRD
FT                   PKLRFQSYIMGKRSQKEVTLVYIEDIINPYIVKELNRRLQSIVTDVVFETGTIEQLIQD
FT                   NNLSPFPQFLNTERPDNIVASLAKGKAAILVDGSPFALIAPLVFVDIFQSVEDHYERWV
FT                   IGTLLRILRMGSGIVAILMPAMYVALVSYHQGLIPSKLAYSIAGAREGVPFPAYIETLM
FT                   MALTMELIREAGIRLPKPMGQTIGIVGGLVIGEAAVNAGIVNPFLVIIIAVTAIATFSL
FT                   PVYSITITFRILLFVFVLAATAFGLYGIILALIALAVHITNLTSVGVPYTTPIAPAFYK
FT                   DWKEEFIRMPKSMLKERPEYLQTKDSTVRPKERE"
FT   gene            694839..695963
FT                   /gene="gerLB"
FT                   /locus_tag="BACI_c07180"
FT   CDS_pept        694839..695963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLB"
FT                   /locus_tag="BACI_c07180"
FT                   /product="spore germination protein"
FT                   /note="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03432"
FT                   /db_xref="GOA:D8H1Y4"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y4"
FT                   /protein_id="ADK03432.1"
FT                   /translation="MKPFEYGDEEIGSREIGFAVSSTIIGIGALSMPRDIANQTLFSDG
FT                   WIILLLGGLICAVLGWFVTRVAILFPKQNFVQYTSIHLTKPVAYTISSILVLTFAALTA
FT                   YESRMIAIISQTYLFSDTPVQLLSFFFLLVVIYGIAGSRAALLRLNVMFLPIVLIAIVL
FT                   LSLLNINLMEINNLFPAFQTEVGQYAVGVKNSIFTFIGFEVALFYAVLLNDKTAKKAPM
FT                   AVAKAVIVNVLSYILIYVTCISVFTYMTTRGLTYPTIELGKEIEIGGGFLERFDAIFFT
FT                   TWIITIYNTTAMYYDVASLLFCAMFPKVKKHIFIFGSAPLIFMLNMLPGNLDTLSSYGT
FT                   YLAWIDMGFVVLAPLLVFIVYKIKRRNGRNETPS"
FT   gene            695947..697113
FT                   /gene="gerLC"
FT                   /locus_tag="BACI_c07190"
FT   CDS_pept        695947..697113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLC"
FT                   /locus_tag="BACI_c07190"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03433"
FT                   /db_xref="GOA:D8H1Y5"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y5"
FT                   /protein_id="ADK03433.1"
FT                   /translation="MKHLLKIIMVMVLAGSISGCSELEEIEERGFVVGAAYDIVKKKKS
FT                   NPIMKGTYQMVLPSKLAQQGGQGDGDSENYINVSAKADSVFEQIRIIAKKISRTLFFPH
FT                   IQVIIFSDELLANPYVLQNTLDVYFRDHEMRRNIRLFVSKKNAESILKQSAKPENLPAQ
FT                   YIDMLAEHPPKNAQMIEAARIGEVQGKMIADRSFALPLLGLTKQGVQMEGAALIRGKDN
FT                   KCVGTLSGEQTLGMNYVIGKKIGGFFTVRKKNQLITYEIHKLRRKIQVSTENATKPKFD
FT                   IHLSTEGILAELHFNEPKQVMNEKFLKKEISKEMKKRIEKSIQLVQKKYKVDALELGEV
FT                   YKRHNYKEWKKISKNWDQGQNYFSNAEINVHVDPTIEHSGSALPKKVK"
FT   gene            complement(697324..699410)
FT                   /pseudo
FT                   /locus_tag="BACI_c07200"
FT                   /note="ferrous iron transport protein B; gene inactivated
FT                   by frameshift"
FT   gene            complement(699407..699664)
FT                   /gene="feoA"
FT                   /locus_tag="BACI_c07230"
FT   CDS_pept        complement(699407..699664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="BACI_c07230"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03434"
FT                   /db_xref="GOA:D8H1Y6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y6"
FT                   /protein_id="ADK03434.1"
FT                   /translation="MVSANTKPLSEFKTGEFVQIEKIQLEGTMKRRLLDLGFIPGATIK
FT                   VLQRSPLGDPVAYQVSNTTIALRKEESSLIFGVLIGDDFR"
FT   gene            700163..701077
FT                   /gene="pstS1"
FT                   /locus_tag="BACI_c07240"
FT   CDS_pept        700163..701077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS1"
FT                   /locus_tag="BACI_c07240"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03435"
FT                   /db_xref="GOA:D8H1Y7"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y7"
FT                   /protein_id="ADK03435.1"
FT                   /translation="MGVQDMVMKKGIKFSLAALVVAGSLVGCGKAEETSGKDAKGSDNA
FT                   KQELSGTIAAAGSTALQPLAEEAGKKFMEKNSNVSIQVQGGGSGTGINQVASGAVQIGN
FT                   SDVPSADKIKDADKAKELVDNKVAGIAFALVVNKDVKVDNLTVQQVQDIFTGKVTNWKE
FT                   VGGKDEKINVINRPASSGTRATFEKTIMKDAKINDGTGTTQDSNGAVEQAINSTPGSVS
FT                   YLAMSYMVGEKKGALQTVKIDGAEPKVENIASGKYPFWSYEYMVTKGEAKEATKAYIDY
FT                   VKGKDFEKQVEDMGYIPMSKLNK"
FT   gene            701148..702038
FT                   /gene="pstC1"
FT                   /locus_tag="BACI_c07250"
FT   CDS_pept        701148..702038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC1"
FT                   /locus_tag="BACI_c07250"
FT                   /product="phosphate ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03436"
FT                   /db_xref="GOA:D8H1Y8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y8"
FT                   /protein_id="ADK03436.1"
FT                   /translation="MKGKKQINYVKSEYIGRSLVTFCGIFIVLVTLAIIAFICGKGIQS
FT                   FTQSGISFTEMLTSTKWSPNADEGTFGAVIFIVGSTVVSLGAVIISAPIAIALAIFMNL
FT                   ISPKFGNKVLKPVLELLVGIPSVVYGLLGVTILVPLLRDSFGGVGFSLIAGIVVLSIMI
FT                   LPTIASIASDAIRSVPFDYLEASYGLGSTKWQAISRVIVPAAKKGILTGVVLGLARAFG
FT                   EALAVQMVIGNTIKLPEGIYSPTATLTGILTMDMTNTLNGTAWNNALWTLAMILLVISF
FT                   LFILVIRAIGQRGER"
FT   gene            702041..702961
FT                   /gene="pstA1"
FT                   /locus_tag="BACI_c07260"
FT   CDS_pept        702041..702961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA1"
FT                   /locus_tag="BACI_c07260"
FT                   /product="phosphate ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03437"
FT                   /db_xref="GOA:D8H1Y9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Y9"
FT                   /protein_id="ADK03437.1"
FT                   /translation="MNARTVNKVWTGIFYAVAALVVALLVFLVFEILQKGWGFWDPNFL
FT                   FGEPSNTRAGGGIGPQLFNSFYMLVITLIISIPLGLGAGIYLAEYAKQGRFLNFVRLCI
FT                   ETMASLPSIVVGLFGLLVFVTMTGWGYTVMGGALALTILNLPGLTRVCENAISEVPSNV
FT                   KEASLGLGATKWQTITRIIIPSSLPQIITGVILAAGRIFGEAAALIYTAGLTSPILNSA
FT                   ADFSSPAHPLNPFRPAETLAVHIWKLNSEGIIPDAKLIATKSAAVLIIMVLLFNVISRL
FT                   VASILHKRFTGAKRKSKTTKKVKAA"
FT   gene            complement(703186..706230)
FT                   /gene="acrB"
FT                   /locus_tag="BACI_c07270"
FT   CDS_pept        complement(703186..706230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="BACI_c07270"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BACI_c07270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK03438"
FT                   /db_xref="GOA:D8H1Z0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D8H1Z0"
FT                   /protein_id="ADK03438.1"
FT                   /translation="MDRLTKFSLKNRAAVIIMVFLISILGVYSGSKLPMEFLPSIDNPA
FT                   VTVTTLSPGLDAEAMTKEVTDPLEKQFRNLEHIDNITSSTHEGLSRIDIAYTSKANMKD
FT                   ATREVEKAINTIKLPKDATKPIVSQLNTSMIPLAQIAIQKQNGFSKADEKQIEKEIVPQ
FT                   LESIDGVANVMFFGKSTSELSIILDPNQLKDKNVTTEQILKVLQGKETSTPAGAVTVNK
FT                   EEYNLRVIGDIKNVDDIKNITVAPQVKLQDVAQIELKQHYDTISHINGEEGTGLIIMKE
FT                   PSKNAVTIGKEIDKKIKDISKQYKDQFSIKLLASTHEQVENAVTSMGKEVILGAIAATL
FT                   IILIFLRNFRTTLIAVVSIPLSILLTLFLLHQSNITLNTLTLGGLAVAVGRLVDDSIVV
FT                   IENIFRRLQKESFSKDIILDATKEVAVAITSSTLTTVAVFLPIGLVSGVIGKLMLPMVL
FT                   AVVYSILSSLIVALTVVPLMAFLLLKKIKHKKPSSSPRYVATLKWALSHKFIILLTSFL
FT                   LFAGSIAAYVLLPKANIKSEDDTMLSINMTFPADYALETQKQKAFDFEKKLLSNSDVTD
FT                   VILRMGSSAEDAQWGQTTKNNLASIFVVFKKGSDIDQYIKELKKEHNAFEPAELDYIKT
FT                   SYSSSGGGNNLQFNVTATNETNLKKAATIVETKLKNMDDLSKVKTNLEDSKKEWQIHVD
FT                   QTKAEQLGLTPELAAQQVAFLMKKSPIGEVSINNEKTTIMIEHKKESITKQEDILNTNI
FT                   LSPINGPIPLKDIATISEKQLQTEVFHKDGKETIQITAEASNEDLSKVSAEVNKAITDL
FT                   DLPSGAKVNIAGATESMQENFTDLFKIMGIAIGIVYLIMVITFGQARAPFAILFSLPLA
FT                   AVGGILGLIISGTPVDVNSLIGALMLIGIVVTNAIVLIERVQQNREHGMETREALLEAG
FT                   STRLRPIIMTAITTIVAMLPLLFGQSQAGSMVSKSLAVVVIGGLAVSTVLTLVVVPVMY
FT                   ELLDKIGRKRRSRRKISTSTETPDI"
FT   gene            706933..708472
FT                   /locus_tag="BACI_c07280"
FT   rRNA            706933..708472
FT                   /locus_tag="BACI_c07280"
FT                   /product="16S ribosomal RNA"
FT   gene            708626..711545
FT                   /locus_tag="BACI_c07290"
FT   rRNA            708626..711545
FT                   /locus_tag="BACI_c07290"
FT                   /product="23S ribosomal RNA"
FT   gene            711649..711763
FT                   /locus_tag="BACI_c07300"
FT   rRNA            711649..711763
FT                   /locus_tag="BACI_c07300"
FT                   /product="5S ribosomal RNA"
FT   gene            711768..711843
FT                   /locus_tag="BACI_c07310"
FT   tRNA            711768..711843
FT                   /locus_tag="BACI_c07310"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            711852..711935
FT                   /locus_tag="BACI_c07320"
FT   tRNA            711852..711935
FT                   /locus_tag="BACI_c07320"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            711947..712021
FT                   /locus_tag="BACI_c07330"
FT   tRNA            711947..712021
FT                   /locus_tag="BACI_c07330"
FT                   /product="tRNA-Gln"
FT                   /note="codon